Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0E07964g37236617570.0
Scas_628.537236614070.0
Sklu_2380.737436413910.0
YIR034C (LYS1)37336513660.0
CAGL0F06875g37236513170.0
Kwal_14.88037336413080.0
ACR167C37236612211e-168
KLLA0D01474g15436680.93
AGR112C62368701.0
CAGL0F06567g505142672.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E07964g
         (366 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E07964g complement(718820..719938) similar to sp|P38998 Sac...   681   0.0  
Scas_628.5                                                            546   0.0  
Sklu_2380.7 YIR034C, Contig c2380 16828-17952                         540   0.0  
YIR034C (LYS1) [2698] chr9 complement(419612..420733) Saccharopi...   530   0.0  
CAGL0F06875g complement(673222..674340) highly similar to sp|P38...   511   0.0  
Kwal_14.880                                                           508   0.0  
ACR167C [1214] [Homologous to ScYIR034C (LYS1) - SH] (649155..65...   474   e-168
KLLA0D01474g complement(128902..129366) no similarity, hypotheti...    31   0.93 
AGR112C [4423] [Homologous to ScYER173W (RAD24) - SH] (948295..9...    32   1.0  
CAGL0F06567g 646495..648012 weakly similar to sp|P32493 Saccharo...    30   2.4  

>KLLA0E07964g complement(718820..719938) similar to sp|P38998
           Saccharomyces cerevisiae YIR034c LYS1 saccharopine
           dehydrogenase singleton, start by similarity
          Length = 372

 Score =  681 bits (1757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/366 (90%), Positives = 333/366 (90%)

Query: 1   MSVTLHLRAETKPLEARXXXXXXXXXXXXXXGFKIFVEESSQSAFDIEEYKKVGATIVPE 60
           MSVTLHLRAETKPLEAR              GFKIFVEESSQSAFDIEEYKKVGATIVPE
Sbjct: 1   MSVTLHLRAETKPLEARTALTPTTTKKLLDKGFKIFVEESSQSAFDIEEYKKVGATIVPE 60

Query: 61  GSWKTAPRDRIIIGLKEMPETDTFPLVHEHIQFAHCYKNQAGWEDVLSRFKRGNGVLYDL 120
           GSWKTAPRDRIIIGLKEMPETDTFPLVHEHIQFAHCYKNQAGWEDVLSRFKRGNGVLYDL
Sbjct: 61  GSWKTAPRDRIIIGLKEMPETDTFPLVHEHIQFAHCYKNQAGWEDVLSRFKRGNGVLYDL 120

Query: 121 EFLENDQXXXXXXXXXXXXXXXXXXXIRDWAFKQTHSDSENLGAIEPYENEEAMIKDVRR 180
           EFLENDQ                   IRDWAFKQTHSDSENLGAIEPYENEEAMIKDVRR
Sbjct: 121 EFLENDQGRRVAAFGFYAGFAGAAVGIRDWAFKQTHSDSENLGAIEPYENEEAMIKDVRR 180

Query: 181 DYQLALKRGARKPKVLIIGALGRCGSGAADLLRKCGLPEENIIKWDMKETARGGPFQEIA 240
           DYQLALKRGARKPKVLIIGALGRCGSGAADLLRKCGLPEENIIKWDMKETARGGPFQEIA
Sbjct: 181 DYQLALKRGARKPKVLIIGALGRCGSGAADLLRKCGLPEENIIKWDMKETARGGPFQEIA 240

Query: 241 DADVFINCIYLSKPIPPFINNELLNKPTRRLRTVVDVSADTTNPHNPVPIYTINTTFDAP 300
           DADVFINCIYLSKPIPPFINNELLNKPTRRLRTVVDVSADTTNPHNPVPIYTINTTFDAP
Sbjct: 241 DADVFINCIYLSKPIPPFINNELLNKPTRRLRTVVDVSADTTNPHNPVPIYTINTTFDAP 300

Query: 301 TVQVPTTVGPKLSVCSIDHLPSLLPKEASESFSRDLLPSLEQLPQRATASVWVKARNLYE 360
           TVQVPTTVGPKLSVCSIDHLPSLLPKEASESFSRDLLPSLEQLPQRATASVWVKARNLYE
Sbjct: 301 TVQVPTTVGPKLSVCSIDHLPSLLPKEASESFSRDLLPSLEQLPQRATASVWVKARNLYE 360

Query: 361 KFAAKV 366
           KFAAKV
Sbjct: 361 KFAAKV 366

>Scas_628.5
          Length = 372

 Score =  546 bits (1407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/366 (72%), Positives = 294/366 (80%)

Query: 1   MSVTLHLRAETKPLEARXXXXXXXXXXXXXXGFKIFVEESSQSAFDIEEYKKVGATIVPE 60
           M+VTLHLRAETKPLEAR              GFKI+VE+S QS F I+EYKK GA IVP 
Sbjct: 1   MTVTLHLRAETKPLEARAALTPTTVKQLIAKGFKIYVEDSPQSIFHIDEYKKAGAIIVPA 60

Query: 61  GSWKTAPRDRIIIGLKEMPETDTFPLVHEHIQFAHCYKNQAGWEDVLSRFKRGNGVLYDL 120
           GSW +APRDRIIIGLKEMPETD FPLVHEHIQFAHCYKNQAGW+DVL+RF  GNG LYDL
Sbjct: 61  GSWISAPRDRIIIGLKEMPETDKFPLVHEHIQFAHCYKNQAGWKDVLTRFINGNGTLYDL 120

Query: 121 EFLENDQXXXXXXXXXXXXXXXXXXXIRDWAFKQTHSDSENLGAIEPYENEEAMIKDVRR 180
           EFLE+D+                   +RDWAFKQTHSD+E+L A+ PY NE+A+IKD+  
Sbjct: 121 EFLEDDEGRRVAAFGFYAGFAGAALGLRDWAFKQTHSDAEDLPAVSPYPNEKALIKDISI 180

Query: 181 DYQLALKRGARKPKVLIIGALGRCGSGAADLLRKCGLPEENIIKWDMKETARGGPFQEIA 240
           +Y+ ALK+GA+KP VLIIGALGRCGSGA DLLRK GLPEENIIKWDMKETARGGPF EIA
Sbjct: 181 EYKNALKKGAKKPTVLIIGALGRCGSGAIDLLRKIGLPEENIIKWDMKETARGGPFPEIA 240

Query: 241 DADVFINCIYLSKPIPPFINNELLNKPTRRLRTVVDVSADTTNPHNPVPIYTINTTFDAP 300
            AD+FINCIYLSKPIPPFIN +LLNK TRRLRTVVDVSADTTNPHNP+PIY I T F+ P
Sbjct: 241 QADIFINCIYLSKPIPPFINYDLLNKDTRRLRTVVDVSADTTNPHNPIPIYNIATVFNKP 300

Query: 301 TVQVPTTVGPKLSVCSIDHLPSLLPKEASESFSRDLLPSLEQLPQRATASVWVKARNLYE 360
           TV VPTT GPKLSV SIDHLPSLLP+EASE F+RDLLPSLEQLP+R TA VWVKA  L+ 
Sbjct: 301 TVLVPTTAGPKLSVISIDHLPSLLPREASEFFARDLLPSLEQLPERYTAPVWVKAEKLFN 360

Query: 361 KFAAKV 366
           +  A+V
Sbjct: 361 RHCARV 366

>Sklu_2380.7 YIR034C, Contig c2380 16828-17952
          Length = 374

 Score =  540 bits (1391), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/364 (70%), Positives = 291/364 (79%)

Query: 3   VTLHLRAETKPLEARXXXXXXXXXXXXXXGFKIFVEESSQSAFDIEEYKKVGATIVPEGS 62
           VTLHLRAETKP+EAR              GFKI+VEES QS FDI EY++ GA IVP GS
Sbjct: 5   VTLHLRAETKPMEARAALTPTTVKKLLSKGFKIYVEESEQSTFDINEYREAGAEIVPTGS 64

Query: 63  WKTAPRDRIIIGLKEMPETDTFPLVHEHIQFAHCYKNQAGWEDVLSRFKRGNGVLYDLEF 122
           W  AP+DRIIIGLKEMPETDTFPLVHEHIQFAHCYKNQAGW+DVL RFKRGNG LYDLEF
Sbjct: 65  WVNAPKDRIIIGLKEMPETDTFPLVHEHIQFAHCYKNQAGWQDVLGRFKRGNGTLYDLEF 124

Query: 123 LENDQXXXXXXXXXXXXXXXXXXXIRDWAFKQTHSDSENLGAIEPYENEEAMIKDVRRDY 182
           LENDQ                   +RDW+FKQ HSD+++L A+ PY NE+A+IKDV  DY
Sbjct: 125 LENDQGRRVAAFGFYAGFAGAALGLRDWSFKQLHSDNQDLPAVSPYPNEKALIKDVVNDY 184

Query: 183 QLALKRGARKPKVLIIGALGRCGSGAADLLRKCGLPEENIIKWDMKETARGGPFQEIADA 242
           Q ALK+GA+KP+VLIIGALGRCGSGA DLL K G+ +ENI+KWD+KET+RGGPF+EIA A
Sbjct: 185 QAALKKGAKKPRVLIIGALGRCGSGAVDLLHKAGVSDENILKWDIKETSRGGPFEEIAQA 244

Query: 243 DVFINCIYLSKPIPPFINNELLNKPTRRLRTVVDVSADTTNPHNPVPIYTINTTFDAPTV 302
           D+FINCIYLSKPI PFIN ELLNK  R+LRTVVDVSADTTNPHNPVPIY I T F +PTV
Sbjct: 245 DIFINCIYLSKPIAPFINYELLNKKNRKLRTVVDVSADTTNPHNPVPIYEIATVFSSPTV 304

Query: 303 QVPTTVGPKLSVCSIDHLPSLLPKEASESFSRDLLPSLEQLPQRATASVWVKARNLYEKF 362
            VPTT GPKLSV SIDHLPSLLP+E+SE F+ DLLPSLEQLP+R TA VWVKA+ L++K 
Sbjct: 305 LVPTTAGPKLSVISIDHLPSLLPRESSEFFAHDLLPSLEQLPERYTAPVWVKAKKLFDKH 364

Query: 363 AAKV 366
            A++
Sbjct: 365 CARL 368

>YIR034C (LYS1) [2698] chr9 complement(419612..420733) Saccharopine
           dehydrogenase (NAD+, L-lysine forming), catalyzes the
           eighth and final step in lysine biosynthesis pathway
           [1122 bp, 373 aa]
          Length = 373

 Score =  530 bits (1366), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/365 (69%), Positives = 287/365 (78%)

Query: 2   SVTLHLRAETKPLEARXXXXXXXXXXXXXXGFKIFVEESSQSAFDIEEYKKVGATIVPEG 61
           +VTLHLRAETKPLEAR              GFKI+VE+S QS F+I EY++ GA IVP G
Sbjct: 3   AVTLHLRAETKPLEARAALTPTTVKKLIAKGFKIYVEDSPQSTFNINEYRQAGAIIVPAG 62

Query: 62  SWKTAPRDRIIIGLKEMPETDTFPLVHEHIQFAHCYKNQAGWEDVLSRFKRGNGVLYDLE 121
           SWKTAPRDRIIIGLKEMPETDTFPLVHEHIQFAHCYK+QAGW++VL RF +G+G LYDLE
Sbjct: 63  SWKTAPRDRIIIGLKEMPETDTFPLVHEHIQFAHCYKDQAGWQNVLMRFIKGHGTLYDLE 122

Query: 122 FLENDQXXXXXXXXXXXXXXXXXXXIRDWAFKQTHSDSENLGAIEPYENEEAMIKDVRRD 181
           FLENDQ                   +RDWAFKQTHSD E+L A+ PY NE+A++KDV +D
Sbjct: 123 FLENDQGRRVAAFGFYAGFAGAALGVRDWAFKQTHSDDEDLPAVSPYPNEKALVKDVTKD 182

Query: 182 YQLALKRGARKPKVLIIGALGRCGSGAADLLRKCGLPEENIIKWDMKETARGGPFQEIAD 241
           Y+ AL  GARKP VLIIGALGRCGSGA DLL K G+P+ NI+KWD+KET+RGGPF EI  
Sbjct: 183 YKEALATGARKPTVLIIGALGRCGSGAIDLLHKVGIPDANILKWDIKETSRGGPFDEIPQ 242

Query: 242 ADVFINCIYLSKPIPPFINNELLNKPTRRLRTVVDVSADTTNPHNPVPIYTINTTFDAPT 301
           AD+FINCIYLSKPI PF N E LN P RRLRTVVDVSADTTNPHNP+PIYT+ T F+ PT
Sbjct: 243 ADIFINCIYLSKPIAPFTNMEKLNNPNRRLRTVVDVSADTTNPHNPIPIYTVATVFNKPT 302

Query: 302 VQVPTTVGPKLSVCSIDHLPSLLPKEASESFSRDLLPSLEQLPQRATASVWVKARNLYEK 361
           V VPTT GPKLSV SIDHLPSLLP+EASE FS DLLPSLE LPQR TA VWV+A+ L+++
Sbjct: 303 VLVPTTAGPKLSVISIDHLPSLLPREASEFFSHDLLPSLELLPQRKTAPVWVRAKKLFDR 362

Query: 362 FAAKV 366
             A+V
Sbjct: 363 HCARV 367

>CAGL0F06875g complement(673222..674340) highly similar to sp|P38998
           Saccharomyces cerevisiae YIR034c LYS1 saccharopine
           dehydrogenase, hypothetical start
          Length = 372

 Score =  511 bits (1317), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/365 (67%), Positives = 282/365 (77%)

Query: 1   MSVTLHLRAETKPLEARXXXXXXXXXXXXXXGFKIFVEESSQSAFDIEEYKKVGATIVPE 60
           MSVTLHLR ETKPLE R              GFKI+VEES QS F I+EY++ GA IVP 
Sbjct: 1   MSVTLHLRGETKPLEHRAALTPTTVKHLIGKGFKIYVEESPQSIFKIDEYRRAGAIIVPF 60

Query: 61  GSWKTAPRDRIIIGLKEMPETDTFPLVHEHIQFAHCYKNQAGWEDVLSRFKRGNGVLYDL 120
           GSW +APRDRIIIGLKEMPE D FPLVHEHIQFAHCYK+QAGW+DVL RF  GNG LYDL
Sbjct: 61  GSWISAPRDRIIIGLKEMPEEDKFPLVHEHIQFAHCYKDQAGWKDVLRRFINGNGTLYDL 120

Query: 121 EFLENDQXXXXXXXXXXXXXXXXXXXIRDWAFKQTHSDSENLGAIEPYENEEAMIKDVRR 180
           EFLE+D                    + DWAFKQTH DSE+L A+ PY NE+A+IKD+ +
Sbjct: 121 EFLEDDNGRRVAAFGFYAGFAGAALGLADWAFKQTHKDSEDLPAVSPYPNEKALIKDIGK 180

Query: 181 DYQLALKRGARKPKVLIIGALGRCGSGAADLLRKCGLPEENIIKWDMKETARGGPFQEIA 240
            Y+ ALK GA+KPKVLIIGALGRCGSGA D L+K GLPEENIIKWD++ET+RGGPF EIA
Sbjct: 181 AYKNALKTGAKKPKVLIIGALGRCGSGAIDFLKKVGLPEENIIKWDIQETSRGGPFPEIA 240

Query: 241 DADVFINCIYLSKPIPPFINNELLNKPTRRLRTVVDVSADTTNPHNPVPIYTINTTFDAP 300
            +D+FINCIYLSKPI PFIN ELLNKP R+LRTVVDVSADTTNPHNP+PIY I T F+ P
Sbjct: 241 ASDIFINCIYLSKPIAPFINYELLNKPDRKLRTVVDVSADTTNPHNPIPIYNIATVFNKP 300

Query: 301 TVQVPTTVGPKLSVCSIDHLPSLLPKEASESFSRDLLPSLEQLPQRATASVWVKARNLYE 360
           TV+V T+ GPKLSV SIDHLPSLLP+EASE F+ DLLPSLEQLP R  + VWV+A  L+ 
Sbjct: 301 TVKVNTSSGPKLSVISIDHLPSLLPREASEFFAHDLLPSLEQLPSRHVSPVWVRAEKLFN 360

Query: 361 KFAAK 365
           + +A+
Sbjct: 361 RHSAR 365

>Kwal_14.880
          Length = 373

 Score =  508 bits (1308), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/364 (68%), Positives = 282/364 (77%)

Query: 3   VTLHLRAETKPLEARXXXXXXXXXXXXXXGFKIFVEESSQSAFDIEEYKKVGATIVPEGS 62
           V LHLRAETK  EAR              GFKI+VEES QS F IEEYKK GA IVP+GS
Sbjct: 4   VILHLRAETKDQEARAALTPTTVQKLIAKGFKIYVEESEQSTFSIEEYKKAGAEIVPKGS 63

Query: 63  WKTAPRDRIIIGLKEMPETDTFPLVHEHIQFAHCYKNQAGWEDVLSRFKRGNGVLYDLEF 122
           W  AP+DRIIIGLKE+PE DTFPLVHEHIQFAHCYKNQAGW+DVL RFKRG+G LYDLEF
Sbjct: 64  WVNAPKDRIIIGLKELPEEDTFPLVHEHIQFAHCYKNQAGWQDVLGRFKRGHGTLYDLEF 123

Query: 123 LENDQXXXXXXXXXXXXXXXXXXXIRDWAFKQTHSDSENLGAIEPYENEEAMIKDVRRDY 182
           LENDQ                   ++DWAFKQTHSDSE+L  + P+ NE  ++KDV  DY
Sbjct: 124 LENDQGRRVAAFGFYAGFAGAALGLKDWAFKQTHSDSEDLPGVTPFPNEHELVKDVVGDY 183

Query: 183 QLALKRGARKPKVLIIGALGRCGSGAADLLRKCGLPEENIIKWDMKETARGGPFQEIADA 242
           + ALK+GA+KP VLIIGALGRCGSGA D+LRK G+PE+NIIKWDMKETARGGPFQEIA A
Sbjct: 184 KAALKKGAKKPTVLIIGALGRCGSGAVDMLRKAGIPEKNIIKWDMKETARGGPFQEIAQA 243

Query: 243 DVFINCIYLSKPIPPFINNELLNKPTRRLRTVVDVSADTTNPHNPVPIYTINTTFDAPTV 302
           D+FINCIYLSKPI PFIN+ LLN  +RRLR++VDVSADTTN HNPVP+YTI T F  PTV
Sbjct: 244 DIFINCIYLSKPIAPFINSTLLNSKSRRLRSIVDVSADTTNVHNPVPVYTIATVFSKPTV 303

Query: 303 QVPTTVGPKLSVCSIDHLPSLLPKEASESFSRDLLPSLEQLPQRATASVWVKARNLYEKF 362
            VPTT GPKLSV SIDHLPSLLP+E+SE F+ DLLPSLEQLP R  A VW +A+ LY K 
Sbjct: 304 LVPTTAGPKLSVISIDHLPSLLPRESSEFFAHDLLPSLEQLPYRDQAPVWARAKALYHKH 363

Query: 363 AAKV 366
            A++
Sbjct: 364 CARL 367

>ACR167C [1214] [Homologous to ScYIR034C (LYS1) - SH]
           (649155..650273) [1119 bp, 372 aa]
          Length = 372

 Score =  474 bits (1221), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 223/366 (60%), Positives = 282/366 (77%)

Query: 1   MSVTLHLRAETKPLEARXXXXXXXXXXXXXXGFKIFVEESSQSAFDIEEYKKVGATIVPE 60
           MS  LHLRAETKP+EAR              GFKI+VEES+QS F+  EY   GA +V  
Sbjct: 1   MSAILHLRAETKPMEARAALTPTTVRTLVSHGFKIYVEESAQSVFEAAEYAAAGAEVVAT 60

Query: 61  GSWKTAPRDRIIIGLKEMPETDTFPLVHEHIQFAHCYKNQAGWEDVLSRFKRGNGVLYDL 120
           GSW+ APR+RII+GLKE+PE DTFPL H HIQFAHCYKNQ+GW +VL RF+ G G+LYDL
Sbjct: 61  GSWRGAPRERIIVGLKELPEEDTFPLEHTHIQFAHCYKNQSGWREVLGRFQSGGGLLYDL 120

Query: 121 EFLENDQXXXXXXXXXXXXXXXXXXXIRDWAFKQTHSDSENLGAIEPYENEEAMIKDVRR 180
           EFL++D+                   +RDWA+KQTH+D+E+L A+ PYENE+A++ +V  
Sbjct: 121 EFLQDDRGRRVAAFGYYAGFAGAALGLRDWAWKQTHTDAEDLPAVAPYENEQALVSEVAA 180

Query: 181 DYQLALKRGARKPKVLIIGALGRCGSGAADLLRKCGLPEENIIKWDMKETARGGPFQEIA 240
             + A K+GARKP+VL+IGALGRCGSGA +LLR+CGL +++II+WD+ ETARGGPF EIA
Sbjct: 181 ACEEAYKKGARKPRVLVIGALGRCGSGAVELLRQCGLHDKHIIRWDIAETARGGPFPEIA 240

Query: 241 DADVFINCIYLSKPIPPFINNELLNKPTRRLRTVVDVSADTTNPHNPVPIYTINTTFDAP 300
            AD+FINCIYLS+PI PFIN ELL++P R+LRT+VDVSADTTNPHNPVP+Y + T F +P
Sbjct: 241 AADIFINCIYLSQPIAPFINMELLDRPDRKLRTIVDVSADTTNPHNPVPVYNVATVFSSP 300

Query: 301 TVQVPTTVGPKLSVCSIDHLPSLLPKEASESFSRDLLPSLEQLPQRATASVWVKARNLYE 360
           TV VPT+ GPKLSV SIDHLPSLLP+EASE+F+ DLLPSL QLP+R TA VW++A+ L++
Sbjct: 301 TVVVPTSQGPKLSVISIDHLPSLLPREASEAFASDLLPSLLQLPERDTAPVWLRAKELFQ 360

Query: 361 KFAAKV 366
           +   ++
Sbjct: 361 QHCERL 366

>KLLA0D01474g complement(128902..129366) no similarity, hypothetical
           start
          Length = 154

 Score = 30.8 bits (68), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 24/36 (66%)

Query: 297 FDAPTVQVPTTVGPKLSVCSIDHLPSLLPKEASESF 332
           F++  +Q+P+T+ PK+  C+I  L +++  + SES 
Sbjct: 22  FNSTNIQLPSTMLPKIMRCTIILLSTIVEHQISESL 57

>AGR112C [4423] [Homologous to ScYER173W (RAD24) - SH]
           (948295..950166) [1872 bp, 623 aa]
          Length = 623

 Score = 31.6 bits (70), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 31/68 (45%), Gaps = 8/68 (11%)

Query: 270 RLRTVVDVSADTTNPHNPVPIYTINTTFDAPTVQVPTTVGPKLSVCSIDHLPSLLPKEAS 329
           R  T V+ S DT  P    P+      FD    Q    +GP L+V  ++ LP++  +E  
Sbjct: 125 RANTYVEYSNDTDAP----PL----EQFDEFLQQAKYRIGPNLAVALVEELPNVFHEETR 176

Query: 330 ESFSRDLL 337
             F+  LL
Sbjct: 177 HRFNMSLL 184

>CAGL0F06567g 646495..648012 weakly similar to sp|P32493
           Saccharomyces cerevisiae YMR064w AEP1, hypothetical
           start
          Length = 505

 Score = 30.4 bits (67), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 57/142 (40%), Gaps = 7/142 (4%)

Query: 221 NIIKWDMKETARGGPFQEIADADVFINCIYLSKPIPPFINNELLNKPTRRLRTVVDVSAD 280
           N+I  D    ++G   + + +          S+ I  F  N+ ++K +  L  V++ + D
Sbjct: 142 NLINNDGSHISKGIILELVHELSSDFELAVFSENILIFFLNDKVSKRSE-LACVLEAAFD 200

Query: 281 TTNPH--NPVPIYTINTTFDAPTVQVPTTVGPKLSVCSIDHLPSLLPKEASESFSRDLLP 338
             + H   P  IY     F A   +VP      L+   +  L  L  K   ES    ++P
Sbjct: 201 LLDTHIDQPKTIYKFLMAFFAKYFEVPVQTDTDLNTLMVKLLMKLENKFHLESMYSKMVP 260

Query: 339 SLEQLPQRATASVWVKARNLYE 360
            L +    A  S + +  NL+E
Sbjct: 261 ELTE----ALFSFYTREGNLHE 278

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.135    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,295,277
Number of extensions: 476382
Number of successful extensions: 1144
Number of sequences better than 10.0: 11
Number of HSP's gapped: 1156
Number of HSP's successfully gapped: 11
Length of query: 366
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 263
Effective length of database: 13,030,455
Effective search space: 3427009665
Effective search space used: 3427009665
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 62 (28.5 bits)