Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0E07744g53352527320.0
Sklu_2411.949749812061e-162
Kwal_26.821450250411561e-154
YMR020W (FMS1)50850010811e-142
Scas_709.5055254210151e-132
ABR057W5205099541e-123
CAGL0M07612g5815918511e-107
KLLA0E14806g40063790.14
Kwal_26.7237409109780.19
AFR367W50390760.30
KLLA0D11154g49352721.1
Kwal_23.347340944711.3
Scas_608.1048753711.3
Kwal_27.1008849872701.9
KLLA0F16753g48747692.0
CAGL0D01628g360161692.1
Scas_678.468035692.3
KLLA0F02860g43331683.3
YEL047C47052673.9
KLLA0E22858g138757674.1
AGR055C50241664.6
ADR290W219544674.9
YIL144W (TID3)69161665.5
Sklu_2060.252651665.8
Scas_651.9*603107656.6
Scas_709.1950590648.0
Scas_712.1667049658.1
YGR144W (THI4)32687648.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E07744g
         (525 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E07744g complement(696382..697983) similar to sp|P50264 Sac...  1056   0.0  
Sklu_2411.9 YMR020W, Contig c2411 17037-18530 reverse complement      469   e-162
Kwal_26.8214                                                          449   e-154
YMR020W (FMS1) [3984] chr13 (315376..316902) Protein involved in...   421   e-142
Scas_709.50                                                           395   e-132
ABR057W [648] [Homologous to ScYMR020W (FMS1) - SH] complement(5...   372   e-123
CAGL0M07612g complement(760610..762355) similar to sp|P50264 Sac...   332   e-107
KLLA0E14806g 1322461..1323663 similar to ca|CA0218|IPF15294 Cand...    35   0.14 
Kwal_26.7237                                                           35   0.19 
AFR367W [3559] [Homologous to ScYEL047C - SH; ScYJR051W (OSM1) -...    34   0.30 
KLLA0D11154g 952049..953530 highly similar to sp|P09624 Saccharo...    32   1.1  
Kwal_23.3473                                                           32   1.3  
Scas_608.10                                                            32   1.3  
Kwal_27.10088                                                          32   1.9  
KLLA0F16753g complement(1541959..1543422) similar to sp|P21375 S...    31   2.0  
CAGL0D01628g complement(170546..171628) weakly similar to tr|Q99...    31   2.1  
Scas_678.4                                                             31   2.3  
KLLA0F02860g 267100..268401 weakly similar to sp|Q9UTM9 Schizosa...    31   3.3  
YEL047C (YEL047C) [1381] chr5 complement(65385..66797) Cytoplasm...    30   3.9  
KLLA0E22858g 2028791..2032954 similar to sp|P39993 Saccharomyces...    30   4.1  
AGR055C [4365] [Homologous to NOHBY] (816615..818123) [1509 bp, ...    30   4.6  
ADR290W [2031] [Homologous to ScYDL171C (GLT1) - SH] complement(...    30   4.9  
YIL144W (TID3) [2533] chr9 (78074..80149) Component of the Tid3p...    30   5.5  
Sklu_2060.2 YER014W, Contig c2060 2550-4130                            30   5.8  
Scas_651.9*                                                            30   6.6  
Scas_709.19                                                            29   8.0  
Scas_712.16                                                            30   8.1  
YGR144W (THI4) [2099] chr7 (780402..781382) Thiamine-repressed p...    29   8.2  

>KLLA0E07744g complement(696382..697983) similar to sp|P50264
           Saccharomyces cerevisiae YMR020w FMS1 suppressor of
           fenpropimorph resistance mutation FEN2 singleton, start
           by similarity
          Length = 533

 Score = 1056 bits (2732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 511/525 (97%), Positives = 511/525 (97%)

Query: 1   MVTILNNHLSHSGHRLTTVCWSRSHCASLRIIMTDYSVIVIGAGISGLKATSDLVKSGIE 60
           MVTILNNHLSHSGHRLTTVCWSRSHCASLRIIMTDYSVIVIGAGISGLKATSDLVKSGIE
Sbjct: 1   MVTILNNHLSHSGHRLTTVCWSRSHCASLRIIMTDYSVIVIGAGISGLKATSDLVKSGIE 60

Query: 61  SVICIESRDRVGGRLNTRQGRNGKYDIGGSWHHDTLSNGLFMEEMSLPESERAGFVFDDE 120
           SVICIESRDRVGGRLNTRQGRNGKYDIGGSWHHDTLSNGLFMEEMSLPESERAGFVFDDE
Sbjct: 61  SVICIESRDRVGGRLNTRQGRNGKYDIGGSWHHDTLSNGLFMEEMSLPESERAGFVFDDE 120

Query: 121 DRACLVDKKLGVLEVDQLECLAYEFEKWVEMRYYDSLDVEDVSYFQLCIEFCFSRKEFLT 180
           DRACLVDKKLGVLEVDQLECLAYEFEKWVEMRYYDSLDVEDVSYFQLCIEFCFSRKEFLT
Sbjct: 121 DRACLVDKKLGVLEVDQLECLAYEFEKWVEMRYYDSLDVEDVSYFQLCIEFCFSRKEFLT 180

Query: 181 DEQLYHLPQLLRYMELWHGVDWYALSGKWSGIEHNGRNALVLHYDKILARISNPVKDKIH 240
           DEQLYHLPQLLRYMELWHGVDWYALSGKWSGIEHNGRNALVLHYDKILARISNPVKDKIH
Sbjct: 181 DEQLYHLPQLLRYMELWHGVDWYALSGKWSGIEHNGRNALVLHYDKILARISNPVKDKIH 240

Query: 241 LSESVNLIKKLSNGKYQVNTDKGKYLCDYCIVTVPQSVLAISCEQEENEFSHMRKARIGF 300
           LSESVNLIKKLSNGKYQVNTDKGKYLCDYCIVTVPQSVLAISCEQEENEFSHMRKARIGF
Sbjct: 241 LSESVNLIKKLSNGKYQVNTDKGKYLCDYCIVTVPQSVLAISCEQEENEFSHMRKARIGF 300

Query: 301 EPPLNGDIFEAITTKASFGSLGKVIFEFDSIKWSKTSGRILTVHEQPTDFVESIRSAKDL 360
           EPPLNGDIFEAITTKASFGSLGKVIFEFDSIKWSKTSGRILTVHEQPTDFVESIRSAKDL
Sbjct: 301 EPPLNGDIFEAITTKASFGSLGKVIFEFDSIKWSKTSGRILTVHEQPTDFVESIRSAKDL 360

Query: 361 KTLLKDIEQKLPRSHEDSWKNPTCFLNLAKHTDTASFVALIQQPVXXXXXXXXXXXXXXF 420
           KTLLKDIEQKLPRSHEDSWKNPTCFLNLAKHTDTASFVALIQQPV              F
Sbjct: 361 KTLLKDIEQKLPRSHEDSWKNPTCFLNLAKHTDTASFVALIQQPVTEYIETLTTEEVEEF 420

Query: 421 FRPVLNKLLNSLGSSDYISDLNDEVKESKTPILKNILTSNWSSDPFSLGAYSACQPGDDP 480
           FRPVLNKLLNSLGSSDYISDLNDEVKESKTPILKNILTSNWSSDPFSLGAYSACQPGDDP
Sbjct: 421 FRPVLNKLLNSLGSSDYISDLNDEVKESKTPILKNILTSNWSSDPFSLGAYSACQPGDDP 480

Query: 481 MDLVIALNVGQGNLRFAGEHTIMDGAGCAYGAWESGKREANYIIE 525
           MDLVIALNVGQGNLRFAGEHTIMDGAGCAYGAWESGKREANYIIE
Sbjct: 481 MDLVIALNVGQGNLRFAGEHTIMDGAGCAYGAWESGKREANYIIE 525

>Sklu_2411.9 YMR020W, Contig c2411 17037-18530 reverse complement
          Length = 497

 Score =  469 bits (1206), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 239/498 (47%), Positives = 332/498 (66%), Gaps = 21/498 (4%)

Query: 37  SVIVIGAGISGLKATSDLVKSGIESVICIESRDRVGGRLNTRQGRNG-KYDIGGSWHHDT 95
           SV++IGAGI+GLKA SDL      S + +ESRDR+GGRL+T +G +G KYD+G SWHHDT
Sbjct: 6   SVVIIGAGIAGLKAASDLYAKNCHSCVVLESRDRIGGRLHTVEGYDGRKYDLGASWHHDT 65

Query: 96  LSNGLFMEEMSLPESERAGFVFDDEDRACLVD--KKLGVLEVDQLECLAYEFEKWVEMRY 153
           L NGLF+EE+ LPE ER  FVFDD+D     +  K+L       LE L  E ++++E+++
Sbjct: 66  LMNGLFLEELQLPEQERTPFVFDDDDLILFTENGKRLDHDPKLILEVLKEELDRFIELQF 125

Query: 154 YDSLDVEDVSYFQLCIEFCFSRKEFLTDEQLYHLPQLLRYMELWHGVDWYALSGKWSGIE 213
           ++SLDV+D+SYFQ+ +++ + R++FL+DEQL HLPQL RY+ELWHG+DW  LSGK++ I+
Sbjct: 126 FESLDVKDISYFQIILKYLYQRRDFLSDEQLKHLPQLARYLELWHGIDWKTLSGKYAHID 185

Query: 214 HNGRNALVLHYDKILARISNPV-KDKIHLSESVNLIKKLSNGKYQVNTDKGKYLCDYCIV 272
           H GRNA+VLHY  I+ R+++   K+ + LS  V  +++    K  V T +  Y+CDY +V
Sbjct: 186 HQGRNAMVLHYSSIVKRVASSFPKEWLKLSTEVCEVRR-EGKKVCVKTFEETYVCDYVVV 244

Query: 273 TVPQSVLAISCEQEENEFSHMRKARIGFEPPLNGDIFEAITTKASFGSLGKVIFEFDSIK 332
           TVPQS+L +S  +E       R  RI F PPLN DI E+   K  +G+LGKV+FEFD   
Sbjct: 245 TVPQSILELSLHKE------ARTGRIEFCPPLNKDIVESF-GKVHYGTLGKVVFEFDKCC 297

Query: 333 WSKTSGRILTVHEQPTDFVESIRSAKDLKTLLKDIEQKLPRSHE---DSWKNPTCFLNLA 389
           WS    +IL++ + P  F   +R+A D   L+K++++    S+E   D W  P  F+NLA
Sbjct: 298 WSTERAKILSMGKTPEGFARKVRNATDFCALVKELDKD--TSYELGNDPWDFPLYFVNLA 355

Query: 390 KHTDTASFVALIQQPVX-XXXXXXXXXXXXXFFRPVLNKLLNSLGSSDYISDLNDEVKES 448
           K T   SFV L+Q+P+               +F+P+L  L   LGS   I D    + ++
Sbjct: 356 KTTGVPSFVMLMQEPLTGYVESLEDKRHVYEYFKPILESLFKVLGSDAPICDFEKGIDDA 415

Query: 449 K--TPILKNILTSNWSSDPFSLGAYSACQPGDDPMDLVIALNVGQ-GNLRFAGEHTIMDG 505
           +   PILKN+ T+NW+ +P+SLGAYSAC P DDPMD ++AL  GQ  ++RFAGEHT+MDG
Sbjct: 416 RENVPILKNVFTTNWTREPYSLGAYSACFPNDDPMDFILALEKGQDSHIRFAGEHTVMDG 475

Query: 506 AGCAYGAWESGKREANYI 523
           AGC YGAWESGKREA+YI
Sbjct: 476 AGCVYGAWESGKREASYI 493

>Kwal_26.8214
          Length = 502

 Score =  449 bits (1156), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 241/504 (47%), Positives = 328/504 (65%), Gaps = 22/504 (4%)

Query: 33  MTDYSVIVIGAGISGLKATSDLVKSGIESVICIESRDRVGGRLNTRQGRNG-KYDIGGSW 91
           M +  V++IGAGISGLKA S L + G +S I IE+RDR+GGRL+T  G  G KYD+G SW
Sbjct: 1   MIEKKVVIIGAGISGLKAASVLHEKGCDSCIVIEARDRIGGRLHTVSGYKGRKYDVGASW 60

Query: 92  HHDTLSNGLFMEEMSLPESERAGFVFDDEDRACLVDKKLGVLEVD---QLECLAYEFEKW 148
           HHDTL NGLF+EEM LP  ER  FVFDD D   + DK  G ++ D   +LE L  E  K+
Sbjct: 61  HHDTLVNGLFLEEMGLPREERTPFVFDD-DSMLVFDKARGRVDYDSQMELEILVEELSKY 119

Query: 149 VEMRYYDSLDVEDVSYFQLCIEFCFSRKEFLTDEQLYHLPQLLRYMELWHGVDWYALSGK 208
            +++Y++ L+VEDV+YFQ  +++ + R+E LTD+Q+ +LPQL R+MELWHG+DW + S K
Sbjct: 120 TQLQYFEDLEVEDVNYFQTIMKYLYERRELLTDDQIQYLPQLARFMELWHGIDWKSQSSK 179

Query: 209 WSGIEHNGRNALVLHYDKILARISNPVKDK-IHLSESVNLIKKLSNGKYQVNTDKGKYL- 266
              I H GRNA VL++  I  R+++ +  +   L   V  +KK    K  V+T KG+ + 
Sbjct: 180 GLEIAHQGRNAFVLNFGNIAQRVASTIPQEWFELETEVREVKK-EGEKVLVSTSKGETIS 238

Query: 267 CDYCIVTVPQSVLAISCEQEENEFSHMRKARIGFEPPLNGDIFEAITTKASFGSLGKVIF 326
           CDY IVT+PQS+LA S + E       RK RI F PPL+ +I  ++   A FG LGKV+F
Sbjct: 239 CDYVIVTIPQSILAHSLQPEP------RKGRIEFIPPLSSEIKTSL-EHAHFGGLGKVVF 291

Query: 327 EFDSIKWSKTSGRILTVHEQPTDFVESIRSAKDLKTLLK--DIEQKLPRSHEDSWKNPTC 384
           EF+S  WSK   R L + +   D    IR A DL  L++  D++ K    + +SW  P  
Sbjct: 292 EFESCCWSKERSRALALGKPIVDLTSKIREAVDLSQLVEKLDLDSKYTYKNGESWDFPLL 351

Query: 385 FLNLAKHTDTASFVALIQQPVXXXXXXXX-XXXXXXFFRPVLNKLLNSLGSSD-YISDLN 442
           F+NLAKHTD  SF+ L+  P+               FF+P+L++LL + G  +  I D +
Sbjct: 352 FVNLAKHTDIPSFIMLMPNPLTEYIESIKDKEKLYEFFKPILDQLLVTFGCFEPIIKDFD 411

Query: 443 DEV--KESKTPILKNILTSNWSSDPFSLGAYSACQPGDDPMDLVIALNVGQ-GNLRFAGE 499
           DE+  ++ K P+LKNILT++W+ D ++LGAYSAC PGDDPM++V+AL+  Q   +RFAGE
Sbjct: 412 DEIVSEDEKKPVLKNILTTSWTGDDYALGAYSACYPGDDPMNVVLALSNNQTSRIRFAGE 471

Query: 500 HTIMDGAGCAYGAWESGKREANYI 523
           HTIMDGAGC YGAWESGKREA +I
Sbjct: 472 HTIMDGAGCVYGAWESGKREALFI 495

>YMR020W (FMS1) [3984] chr13 (315376..316902) Protein involved in
           the biosynthesis of pantothenic acid, has similarity to
           Candida albicans corticosteroid-binding protein CBP1
           [1527 bp, 508 aa]
          Length = 508

 Score =  421 bits (1081), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 228/500 (45%), Positives = 319/500 (63%), Gaps = 21/500 (4%)

Query: 38  VIVIGAGISGLKATSDLVKSGIESVICIESRDRVGGRLNTRQGRNG-KYDIGGSWHHDTL 96
           VI+IGAGI+GLKA S L ++GI+  + +E+RDRVGGRL T  G  G KYDIG SWHHDTL
Sbjct: 11  VIIIGAGIAGLKAASTLHQNGIQDCLVLEARDRVGGRLQTVTGYQGRKYDIGASWHHDTL 70

Query: 97  SNGLFMEEMSLPESE-RAGFVFDDEDRACLVDKKLGVLEVDQ---LECLAYEFEKWVEMR 152
           +N LF+EE  L  ++ R  FVFDD D    +D++ G ++ D+   LE +  E  K+ E+ 
Sbjct: 71  TNPLFLEEAQLSLNDGRTRFVFDD-DNFIYIDEERGRVDHDKELLLEIVDNEMSKFAELE 129

Query: 153 YYDSLDVEDVSYFQLCIEFCFSRKEFLTDEQLYHLPQLLRYMELWHGVDWYALSGKWSGI 212
           ++  L V D S+FQL +++   R++FLT++Q+ +LPQL RY+ELWHG+DW  LS K +  
Sbjct: 130 FHQHLGVSDCSFFQLVMKYLLQRRQFLTNDQIRYLPQLCRYLELWHGLDWKLLSAKDTYF 189

Query: 213 EHNGRNALVLHYDKILARISNPV-KDKIHLSESVNLIKKLSNGKYQVNTDKGK-YLCDYC 270
            H GRNA  L+YD ++ RI+    ++ + LS  V  I +  +    VN + G  Y  DY 
Sbjct: 190 GHQGRNAFALNYDSVVQRIAQSFPQNWLKLSCEVKSITREPSKNVTVNCEDGTVYNADYV 249

Query: 271 IVTVPQSVLAISCEQEENEFSHMRKARIGFEPPLNGDIFEAITTKASFGSLGKVIFEFDS 330
           I+TVPQSVL +S + E+N      + RI F+PPL   I +A   K  FG+LGKVIFEF+ 
Sbjct: 250 IITVPQSVLNLSVQPEKN-----LRGRIEFQPPLKPVIQDAF-DKIHFGALGKVIFEFEE 303

Query: 331 IKWSKTSGRILTVHEQPTDFVESIRSAKDLKTLLKDIEQKLPRSHED--SWKNPTCFLNL 388
             WS  S +I+T+     +FVE +R+A++L  L   +E++  + H     W  P  F+NL
Sbjct: 304 CCWSNESSKIVTLANSTNEFVEIVRNAENLDELDSMLEREDSQKHTSVTCWSQPLFFVNL 363

Query: 389 AKHTDTASFVALIQQPVXX--XXXXXXXXXXXXFFRPVLNKLLNSLGSSDYISDLN--DE 444
           +K T  ASF+ L+Q P+                FF+PVLNK++  L S D I  +   + 
Sbjct: 364 SKSTGVASFMMLMQAPLTNHIESIREDKERLFSFFQPVLNKIMKCLDSEDVIDGMRPIEN 423

Query: 445 VKESKTPILKNILTSNWSSDPFSLGAYSACQPGDDPMDLVIALNVGQ-GNLRFAGEHTIM 503
           +  +  P+L+NI+ SNW+ DP+S GAYSAC PGDDP+D+V+A++ GQ   +RFAGEHTIM
Sbjct: 424 IANANKPVLRNIIVSNWTRDPYSRGAYSACFPGDDPVDMVVAMSNGQDSRIRFAGEHTIM 483

Query: 504 DGAGCAYGAWESGKREANYI 523
           DGAGCAYGAWESG+REA  I
Sbjct: 484 DGAGCAYGAWESGRREATRI 503

>Scas_709.50
          Length = 552

 Score =  395 bits (1015), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 221/542 (40%), Positives = 328/542 (60%), Gaps = 37/542 (6%)

Query: 8   HLSHSGHRLTT--VCWSRSHCASLRIIMT---DYSVIVIGAGISGLKATSDLVKSGIESV 62
           +L H G  + +  +  +  H      IMT   +  VI+IGAGI+GLKA S L  +GI++ 
Sbjct: 19  NLEHQGSYIASLNIVSNTLHIGPAIQIMTKPKEQQVIIIGAGIAGLKAASTLYANGIKNC 78

Query: 63  ICIESRDRVGGRLNTRQGRNG-KYDIGGSWHHDTLSNGLFMEEM-SLPESERAGFVFDDE 120
           + IE+RDR+GGRL T +G  G KYD+G  WHHDTL N LF+EE  ++ +  +  FVF+D 
Sbjct: 79  LVIEARDRIGGRLLTVKGYKGDKYDLGAGWHHDTLMNPLFLEEAEAMKKDSKKRFVFEDS 138

Query: 121 DRACLVDKKLGVLEVD---QLECLAYEFEKWVEMRYYDSLDVEDVSYFQLCIEFCFSRKE 177
            +   +D + G ++ D    LE +  E +K+  + +Y SLDV+D S++ + +++   R++
Sbjct: 139 -QFIYIDDQRGRIDHDPDMSLEFVDAEIDKFTGLEFYQSLDVKDCSFYHIILKYLLQRRD 197

Query: 178 FLTDEQLYHLPQLLRYMELWHGVDWYALSGKWSGIEHNGRNALVLHYDKILARISNPV-K 236
           FLTD+Q+    Q+ RY+ELWHG  W  LS K +  +H GRNALV ++D ++ RI +   K
Sbjct: 198 FLTDDQIKFSAQIARYLELWHGASWDKLSAKDTYFDHQGRNALVTNFDSVVNRIGDTFPK 257

Query: 237 DKIHLSESV--------NLIKKLSNGKYQVNTDKGKYLCDYCIVTVPQSVLAISCEQEEN 288
           D I L+  V        N++ KLS+G+        +Y+C Y IVT+PQSVL +S +  + 
Sbjct: 258 DWIRLNTEVKAIERDGKNVLIKLSSGE--------EYICQYTIVTIPQSVLQLSLQLPDE 309

Query: 289 EFSHMRKARIGFEPPLNGDIFEAITTKASFGSLGKVIFEFDSIKWSKTSGRILTVHEQPT 348
             +   K RI F+PPLN  I EA   K  FG LGKV+FEFD   WS  S RI T+     
Sbjct: 310 SNT---KGRIDFKPPLNPQIQEAF-KKIHFGGLGKVVFEFDKCTWSNESSRIFTLAHSQE 365

Query: 349 DFVESIRSAKDLKTLLKDIEQKLPRSHEDSWKNPTCFLNLAKHTDTASFVALIQQPVXXX 408
           +FVE +R A+  + L+ +++    +  E+ W  P  F+NLAK     + + L+Q P+   
Sbjct: 366 NFVEDVRKAETWEGLIDNLKTPSSQLFENCWDFPLLFINLAKSIGRPTLIMLMQSPLSNY 425

Query: 409 XXX--XXXXXXXXFFRPVLNKLLNSLGSSDYISDL--NDEVKESKTPILKNILTSNWSSD 464
                        FF+PVL+K++ +L S+  I+ L  N    E+ +PILKN+L +NW++D
Sbjct: 426 IESIGNDKQKVYEFFQPVLDKVMTTLQSNKVINGLSANPTEAETNSPILKNLLVTNWNND 485

Query: 465 PFSLGAYSACQPGDDPMDLVIALNVGQ-GNLRFAGEHTIMDGAGCAYGAWESGKREANYI 523
           P+S GAYSAC  GDD ++++IA++ GQ   +RFAGEHTIMDGAG  +G+WESG+RE  YI
Sbjct: 486 PYSRGAYSACFAGDDALEMIIAMSNGQDSRIRFAGEHTIMDGAGAVHGSWESGRREGEYI 545

Query: 524 IE 525
           +E
Sbjct: 546 LE 547

>ABR057W [648] [Homologous to ScYMR020W (FMS1) - SH]
           complement(500154..501716) [1563 bp, 520 aa]
          Length = 520

 Score =  372 bits (954), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 200/509 (39%), Positives = 295/509 (57%), Gaps = 31/509 (6%)

Query: 35  DYSVIVIGAGISGLKATSDLVKSGIESVICIESRDRVGGRL-----NTRQGRNGKYDIGG 89
           +Y+V+V+GAGI+GLKA ++L  +GIE  + +E+R R GGRL     +   GR  +YD+G 
Sbjct: 9   EYTVVVVGAGIAGLKAAAELHSAGIEKCVVLEARARTGGRLLQVESSVFPGR--RYDLGA 66

Query: 90  SWHHDTLSNGLFMEEMSLPESERAGFVFDDEDRACL------VDKKLGVLEVDQLECLAY 143
           SWHHDTLSN LF EE+ LPE+ERAG+VFDD     +      +D   G++    LE L  
Sbjct: 67  SWHHDTLSNELFAEELRLPEAERAGYVFDDVPTMVVSPAGRRLDGDFGLM----LEALQR 122

Query: 144 EFEKWVEMRYYDSLDVEDVSYFQLCIEFCFSRKEFLTDEQLYHLPQLLRYMELWHGVDWY 203
           E E ++E +Y++SL+  D+ +F+L + + + R+  LTD+Q+  LP  +R+ E WH +DW 
Sbjct: 123 EVEHYIEEQYFESLEARDMPFFELVMAYLYERRGVLTDDQIQQLPGTVRFREFWHAIDWK 182

Query: 204 ALSGKWSGIEHNGRNALVLHYDKILARISNPV-KDKIHLSESVNLIKKLSNGKYQVNTDK 262
            LS K S +E+NGRNA VL+YDK+L R+ + V ++ I L   V  I+++ +  +    D 
Sbjct: 183 LLSAKLSEVENNGRNAFVLNYDKLLRRVESGVPREWIRLGTRVTKIERVRDTVHITTADG 242

Query: 263 GKYLCDYCIVTVPQSVLAISCEQEENEFSHMRKARIGFEPPLNGDIFEAITTKASFGSLG 322
             Y+    IVTVPQSVL +S + E          RI F PPLN +I  A   +A + SLG
Sbjct: 243 ACYVSKCAIVTVPQSVLELSLKPERV------PGRIEFRPPLNDNITSAF-ERAHYASLG 295

Query: 323 KVIFEFDSIKWSKTSGRILTVHEQPTDFVESIRSAKDLKTLLKDIE-QKLPRSHEDSWKN 381
           K+ FEFD   W     R+    + P DF   +R A+DL+ LL+    Q   +  +D +  
Sbjct: 296 KIFFEFDKCTWDTQRPRVAIAAKVPDDFSAQVRKAQDLQELLRSASAQTEVKLGQDCFDF 355

Query: 382 PTCFLNLAKHTDTASFVALIQQPVXXXXXXXXXXXXXXFFRPVLNKLLNSLGSSDY-ISD 440
           P  F N+       + +A  Q P+              +F+P +   L +LGS +  + D
Sbjct: 356 PQEFQNMVALAGIPTLIAFTQTPLTEHVERLSKQEIVDYFKPAIVVALRALGSKEECLFD 415

Query: 441 LNDEVKESKT---PILKNILTSNWSSDPFSLGAYSACQPGDDPMDLVIALNVGQ-GNLRF 496
           L +   +  +   PILKN++ + WS D +S G+Y+     DD + L +ALN GQ   +RF
Sbjct: 416 LGNTQPQDDSHPGPILKNVIFNPWSQDTYSRGSYTGSHVDDDQLPLTVALNNGQDSRIRF 475

Query: 497 AGEHTIMDGAGCAYGAWESGKREANYIIE 525
           AGEHT+M+G GC YGAWESG+REA Y++E
Sbjct: 476 AGEHTVMEGNGCTYGAWESGRREAEYVLE 504

>CAGL0M07612g complement(760610..762355) similar to sp|P50264
           Saccharomyces cerevisiae YMR020w FMS1 suppressor of
           fenpropimorph resistance mutation FEN2, hypothetical
           start
          Length = 581

 Score =  332 bits (851), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 207/591 (35%), Positives = 304/591 (51%), Gaps = 118/591 (19%)

Query: 36  YSVIVIGAGISGLKATSDLVKSGIESVICIESRDRVGGRLNTRQGRNG-KYDIGGSWHHD 94
           Y V+V+GAGI+GLKA S L +SG +S + IESRDR+GGRL T  G NG +YD+G SWHHD
Sbjct: 5   YDVVVVGAGIAGLKAASVLTQSG-KSCLVIESRDRIGGRLCTVTGYNGARYDLGASWHHD 63

Query: 95  TLSNGLFMEEMSL---------PESERAG---------------------------FVFD 118
           TL+N LF EE+ L         P+    G                           FVFD
Sbjct: 64  TLTNRLFAEEVQLAAVDGADSTPQMFSGGATHCSASSASSASSASTGGNSAGVYAPFVFD 123

Query: 119 DEDRACLVDKKLGVLEVDQLECLAYEFEKWVEMRYYDSLDVE-----------------D 161
           D+D   +VDK  G L    +  +A E EK++E+ ++     E                 D
Sbjct: 124 DDD-PLIVDKIRGSLGDVTIRLIADEIEKFIELYFHSEYTAELSDDNDSQHSHEGFPRAD 182

Query: 162 VSYFQLCIEFCFSRKEFLTDEQLYHLPQLLRYMELWHGVDWYALSGKWSGIEHNGRNALV 221
           +  F + + +   R  FLTD+Q+++  Q  RYMELWHGV WY LS + S   H GRNA V
Sbjct: 183 MPLFDMLLMYLQQRAPFLTDDQMWYGIQYARYMELWHGVSWYQLSSRDSFFGHQGRNAFV 242

Query: 222 LHYDKILARISNPVKDKIHLSESVNLIKKLSN----------------------GKYQVN 259
           ++YD I  RI   ++ ++   +  + + K+ N                      G++   
Sbjct: 243 MNYDTIYNRIHGQIRTELGTVQLNSTVTKIENAGAHTTVSYTTSSASGAEDTQHGQHGAA 302

Query: 260 TDKGKYLCDYCIVTVPQSVLAISCEQEENEFSHMRKARIGFEPPLNGDIFEAITTKASFG 319
             +    C Y IVT+PQS+L+              +  + F+PPL   I  A+  K  FG
Sbjct: 303 GQQHTVQCSYVIVTIPQSLLS--------------EGAVEFKPPLVPQISAAL-QKMHFG 347

Query: 320 SLGKVIFEFDSIKWSKTSGRILTVHEQPTD----FVESIR--------SAKDLKTLLKDI 367
           SLGKV+FEF+   W   + +I+ V     D    F   +R        +A+ L+ L++D+
Sbjct: 348 SLGKVVFEFEECCWDLHTAKIVAVAHAAADTRAEFTALLRKESREKNYTAQRLQALVQDV 407

Query: 368 EQKLPRS--HEDSWKNPTCFLNLAKHTDTASFVALIQQPVXXXXXXXX-XXXXXXFFRPV 424
           +Q L       D W  P  F+N+AK T   S + L+  P+               FF+PV
Sbjct: 408 KQLLGDDAVRHDCWNQPLLFVNMAKTTGVPSLMMLMAPPLTHYIESLHDSHQVYEFFKPV 467

Query: 425 LNKLLNSLGSSDYISD---------LNDEVKESKTPILKNILTSNWSSDPFSLGAYSACQ 475
           L+++++   +  +I +          +D     K PIL+N++ ++W++DP+S GAYSAC 
Sbjct: 468 LSQIMSVCNAPGHIINGLDIAGGVAGDDANVSDKGPILRNVIVTDWTNDPYSKGAYSACY 527

Query: 476 PGDDPMDLVIALNVGQGN-LRFAGEHTIMDGAGCAYGAWESGKREANYIIE 525
            GDD +D+ +A++ GQ + +RFAGEHTI+DGAGCAYGAWESG+REANYI++
Sbjct: 528 AGDDALDMFLAMSNGQSSRVRFAGEHTILDGAGCAYGAWESGEREANYILK 578

>KLLA0E14806g 1322461..1323663 similar to ca|CA0218|IPF15294
          Candida albicans unknown function, hypothetical start
          Length = 400

 Score = 35.0 bits (79), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 5/63 (7%)

Query: 16 LTTVCWSRSHCASLRIIMTDYSVIVIGAGISGLKATSDLVKSGIESVICIESRDRVGGRL 75
          L    +SR + A +     DYS  VIGAG+ GL   ++L K     VI +E   ++G   
Sbjct: 12 LIRPLFSRFYSAPV-----DYSHAVIGAGVVGLAIANELTKVPGNKVIVLEKNAKIGQET 66

Query: 76 NTR 78
          ++R
Sbjct: 67 SSR 69

>Kwal_26.7237
          Length = 409

 Score = 34.7 bits (78), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 25/109 (22%), Positives = 51/109 (46%), Gaps = 5/109 (4%)

Query: 289 EFSHMRKARIGFEPPL---NGDIFEAITTKASFGSLGKVIFEFDSIKWSKTSGRILTVHE 345
           +F ++ K+ +   PP    NG+ FE + +  +  + GK   ++D    S  +  I T  +
Sbjct: 20  KFQNLEKSVLCTPPPQKSQNGNSFEQLPSPTTPTAPGKFGHQWDPKLSSFATSEIATFVK 79

Query: 346 QPTDFV--ESIRSAKDLKTLLKDIEQKLPRSHEDSWKNPTCFLNLAKHT 392
             T  +  +S +  +DL+TL +++   +   H+ +WK     L    H+
Sbjct: 80  SNTQLISGKSAQCGQDLQTLAQELLSSIDPIHDPTWKVSAAPLGQGSHS 128

>AFR367W [3559] [Homologous to ScYEL047C - SH; ScYJR051W (OSM1) -
           SH] complement(1101019..1102530) [1512 bp, 503 aa]
          Length = 503

 Score = 33.9 bits (76), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 46/90 (51%), Gaps = 14/90 (15%)

Query: 22  SRSHCASLRIIMTD--YSVIVIGAGISGLKATSDLVKSGIESVICIESRDRVGGR-LNTR 78
           SR   ++ RI M+     V+V+G G++GL   + LVK+G+  VI ++    +GG  +   
Sbjct: 28  SRGPESNRRIDMSGKVQPVVVVGLGLAGLSTGAQLVKNGVP-VILMDKASAIGGNSVKAS 86

Query: 79  QGRNGK----------YDIGGSWHHDTLSN 98
            G NG           YD   S++ DT+++
Sbjct: 87  SGINGAGTQVQELLGVYDSADSFYRDTVAS 116

>KLLA0D11154g 952049..953530 highly similar to sp|P09624
          Saccharomyces cerevisiae YFL018c LPD1 dihydrolipoamide
          dehydrogenase precursor, hypothetical start
          Length = 493

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 1/52 (1%)

Query: 22 SRSHCASLRIIMTDYSVIVIGAGISGLKATSDLVKSGIESVICIESRDRVGG 73
          S S  A L+ +   + ++VIG G  G  A     + G + V C+E R R+GG
Sbjct: 9  SFSSSALLKTVTKKHDLVVIGGGPGGYVAAIKAAQLGYD-VACVEKRGRLGG 59

>Kwal_23.3473
          Length = 409

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 22/44 (50%)

Query: 35 DYSVIVIGAGISGLKATSDLVKSGIESVICIESRDRVGGRLNTR 78
          DYS  VIG G+ GL   S+L K     V+ IE     G   ++R
Sbjct: 33 DYSHAVIGGGVVGLAVASELSKIAGNKVVLIEKNPSTGLETSSR 76

>Scas_608.10
          Length = 487

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 32 IMTDYSVIVIGAGISGLKATSDLVKSGIESVICIESRDRVGGR-LNTRQGRNG 83
          I +D  V+VIG+G++GL  ++ LV      ++ +E    +GG  +    G NG
Sbjct: 16 ISSDSPVVVIGSGLAGLATSNQLVNKYQIPIVLVEKEASLGGNSIKASSGING 68

>Kwal_27.10088
          Length = 498

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 35/72 (48%), Gaps = 11/72 (15%)

Query: 38  VIVIGAGISGLKATSDLVKSGIESVICIESRDRVGGR-----------LNTRQGRNGKYD 86
           V++IG+G++GL A + LV      ++ +E    +GG            L + Q   G  D
Sbjct: 40  VVIIGSGLAGLTAANQLVLKHKVPIVMLEKASSLGGNSIKASSGINGALTSTQKTLGVND 99

Query: 87  IGGSWHHDTLSN 98
              +++ DTLS+
Sbjct: 100 SPSAFYQDTLSS 111

>KLLA0F16753g complement(1541959..1543422) similar to sp|P21375
          Saccharomyces cerevisiae YJR051w OSM1 osmotic growth
          protein, start by similarity
          Length = 487

 Score = 31.2 bits (69), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%), Gaps = 2/47 (4%)

Query: 38 VIVIGAGISGLKATSDLVKSGIESVICIESRDRVGGR-LNTRQGRNG 83
          V+VIG+G++GL  ++ LVK  I  ++ +E    +GG  +    G NG
Sbjct: 33 VVVIGSGLAGLTTSTQLVKFNI-PIVLLEKTGSIGGNSIKASSGING 78

>CAGL0D01628g complement(170546..171628) weakly similar to tr|Q99177
           Saccharomyces cerevisiae YPR057w BRR1 involved in snRNP
           biogenesis, hypothetical start
          Length = 360

 Score = 31.2 bits (69), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 74/161 (45%), Gaps = 28/161 (17%)

Query: 116 VFDDEDRACLVDKKLGVLEVDQLECLAYEFEKWVEMRYYDSLDVEDVSYFQLCIEFCFSR 175
           ++DDED +  +     V + DQ+    Y  E W   ++++  ++ D+ +   C  F    
Sbjct: 74  IYDDEDDSTSIPSDTKV-KSDQITEYLYSIENW--YKWFE--NISDIIWHG-CYVF---- 123

Query: 176 KEFLTDEQLYHLPQLLRYMELWHGVDWYALSGKWSGIEHNGRNALVLHYDKILARISNPV 235
            E   DE + HL QLLR+  L   +D      + S  +   R+ + +  D++     +PV
Sbjct: 124 -EGYDDESISHLTQLLRFY-LQKKID----ENRASSFD---RHLVNIFRDQLKCSDPDPV 174

Query: 236 KDKIHLSE--SVNLIKKLSNGKYQ-VNTDKGKYLCDYCIVT 273
              + + E  + NL+K + N K + +NT K      YCI T
Sbjct: 175 NGTLEIDEDWAENLLKTMRNSKIKDLNTVK------YCIRT 209

>Scas_678.4
          Length = 680

 Score = 31.2 bits (69), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 24/35 (68%), Gaps = 1/35 (2%)

Query: 31  IIMTDYSVIVIGAGISGLKATSDLVKSGIESVICI 65
           II  +Y  +V+GAG +GL+AT  L ++G ++  CI
Sbjct: 88  IIDHEYDCVVVGAGGAGLRATFGLAEAGFKTA-CI 121

>KLLA0F02860g 267100..268401 weakly similar to sp|Q9UTM9
          Schizosaccharomyces pombe Putative fructosyl amino acid
          oxidase, start by similarity
          Length = 433

 Score = 30.8 bits (68), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 20/31 (64%)

Query: 33 MTDYSVIVIGAGISGLKATSDLVKSGIESVI 63
          M++Y V+++GAGI GL     L +S  + V+
Sbjct: 1  MSNYDVVIVGAGIFGLSTAVQLARSKYKVVV 31

>YEL047C (YEL047C) [1381] chr5 complement(65385..66797)
          Cytoplasmic soluble fumarate reductase, involved with
          Osm1p in the reoxidation of NADH and the production of
          succinate during anaerobic growth [1413 bp, 470 aa]
          Length = 470

 Score = 30.4 bits (67), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 1/52 (1%)

Query: 33 MTDYSVIVIGAGISGLKATSDLVKSGIESVICIESRDRVGGR-LNTRQGRNG 83
          M+   V+VIG G++GL A ++LV      V  +E    +GG  +    G NG
Sbjct: 1  MSLSPVVVIGTGLAGLAAANELVNKYNIPVTILEKASSIGGNSIKASSGING 52

>KLLA0E22858g 2028791..2032954 similar to sp|P39993 Saccharomyces
           cerevisiae YEL022w GEA2 GDP/GTP exchange factor for ARF,
           start by similarity
          Length = 1387

 Score = 30.4 bits (67), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 32/57 (56%), Gaps = 2/57 (3%)

Query: 240 HLSESVNLIKKLSNGKYQVNTDKGKYLCDYCIVTVPQSVLAISCEQEENEFSHMRKA 296
           HLS+   L+K L   +  + +  G+ L D C+  V Q+V++++C +   +   +RKA
Sbjct: 163 HLSDDSVLLKVLVLIESIIASPSGEILSDSCVYDVLQTVMSLACNKRRTDV--LRKA 217

>AGR055C [4365] [Homologous to NOHBY] (816615..818123) [1509 bp,
          502 aa]
          Length = 502

 Score = 30.0 bits (66), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 22/41 (53%), Gaps = 1/41 (2%)

Query: 37 SVIVIGAGISGLKATSDLVKSG-IESVICIESRDRVGGRLN 76
          SV V+GAG  G   T  LVK G  + +   E R++ GG  N
Sbjct: 17 SVAVVGAGPYGAGVTKALVKEGSFDQIHVFERREQFGGLWN 57

>ADR290W [2031] [Homologous to ScYDL171C (GLT1) - SH]
            complement(1196235..1202822) [6588 bp, 2195 aa]
          Length = 2195

 Score = 30.4 bits (67), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 32   IMTDYSVIVIGAGISGLKATSDLVKSGIESVICIESRDRVGGRL 75
            + T  +V +IG+G +GL     L ++G  SV   E  DR GG L
Sbjct: 1832 VRTGRTVAIIGSGPAGLSCADQLNRAG-HSVTVYERADRCGGLL 1874

>YIL144W (TID3) [2533] chr9 (78074..80149) Component of the
           Tid3p-Nuf2p-Spc24p-Spc25p centromere complex, involved
           in chromosome segregation [2076 bp, 691 aa]
          Length = 691

 Score = 30.0 bits (66), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 31/61 (50%)

Query: 199 GVDWYALSGKWSGIEHNGRNALVLHYDKILARISNPVKDKIHLSESVNLIKKLSNGKYQV 258
           G+ +  L  K SGI  + + +++   D+I  RI    KD I L + +  +K   N K Q+
Sbjct: 504 GISYEQLFPKGSGINESIKKSILKLNDEIQERIKTIEKDNITLEKDIKNLKHDINEKTQI 563

Query: 259 N 259
           N
Sbjct: 564 N 564

>Sklu_2060.2 YER014W, Contig c2060 2550-4130
          Length = 526

 Score = 30.0 bits (66), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 28 SLRIIMTDYSVIVIGAGISGLKATSDLVKSGIE-SVICIESRDRVGGRLNT 77
          SL  +  +  V V+GAG+SGL  T  L K   +  +  I+S +R GG +N+
Sbjct: 4  SLTKLSANAKVAVVGAGVSGLTFTYFLSKLRPDIKISLIDSSNRCGGYINS 54

>Scas_651.9*
          Length = 603

 Score = 29.6 bits (65), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 49/107 (45%), Gaps = 12/107 (11%)

Query: 264 KYLCDYCIVTVPQSVLAISCEQEENE-FSHMR-----KARIGFEPPLNGDIFEAITTKAS 317
           KYLC +C V+V    L +SC    N   +H R     +A++ +  P + +     T K  
Sbjct: 12  KYLCCWCSVSVSVLCLLLSCSVSPNRSIAHSRTMTQDQAQVQYSLPQHKENVVLATGKCQ 71

Query: 318 FGSLGKVI-----FEFDSIKWSKTSGRI-LTVHEQPTDFVESIRSAK 358
           + +   V+     ++  ++K +K  G I +++ EQ   F   ++  K
Sbjct: 72  YSAKDNVLLTDYKYKTSTVKNNKADGSIKVSLEEQDYKFKIDLKVPK 118

>Scas_709.19
          Length = 505

 Score = 29.3 bits (64), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 42/90 (46%), Gaps = 1/90 (1%)

Query: 16  LTTVCWSRSHCASLRIIMTDYSVIVIGAGISGLKATSDLVKSGIESVICIESRDRVGGR- 74
           L T   + +  +S  ++     V+VIG+G++GL A++ LV      V+ ++    +GG  
Sbjct: 20  LLTYRHTTNKMSSKTLLNLKKPVVVIGSGLAGLTASNRLVSKYNIPVVLLDKASSMGGNS 79

Query: 75  LNTRQGRNGKYDIGGSWHHDTLSNGLFMEE 104
           +    G NG   I         S  LF+E+
Sbjct: 80  IKASSGINGAGTITQEHLQVRDSPELFLED 109

>Scas_712.16
          Length = 670

 Score = 29.6 bits (65), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 3/49 (6%)

Query: 27 ASLRIIMTDY---SVIVIGAGISGLKATSDLVKSGIESVICIESRDRVG 72
          ASLR  ++     +VIVIG G +G +A +   +SG  +V+     D++G
Sbjct: 30 ASLRATLSQAPKANVIVIGGGHAGCEAATGSARSGSNTVLVTPFLDKIG 78

>YGR144W (THI4) [2099] chr7 (780402..781382) Thiamine-repressed
           protein essential for growth in the absence of thiamine
           [981 bp, 326 aa]
          Length = 326

 Score = 29.3 bits (64), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 36/87 (41%), Gaps = 22/87 (25%)

Query: 38  VIVIGAGISGLKATSDLVKSGIESVICIESRDRVGGRLNTRQGRNGKYDIGGSWHHDTLS 97
           VI++GAG SGL A   + K+  +  +CI       G              GGSW    L 
Sbjct: 68  VIIVGAGSSGLSAAYVIAKNRPDLKVCIIESSVAPG--------------GGSWLGGQLF 113

Query: 98  NG--------LFMEEMSLPESERAGFV 116
           +         LF++E+ +P  +   +V
Sbjct: 114 SAMVMRKPAHLFLQELEIPYEDEGDYV 140

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.136    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 17,850,613
Number of extensions: 785074
Number of successful extensions: 2155
Number of sequences better than 10.0: 40
Number of HSP's gapped: 2149
Number of HSP's successfully gapped: 41
Length of query: 525
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 419
Effective length of database: 12,926,601
Effective search space: 5416245819
Effective search space used: 5416245819
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)