Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0E07733g46946223580.0
Sklu_2411.83823986927e-87
ABR058C3503916472e-80
Kwal_26.82193914036441e-79
Scas_576.54074115502e-65
CAGL0M07590g4564254816e-55
YMR021C (MAC1)4171443772e-40
Scas_668.16291401581e-11
CAGL0L09339g877401353e-08
YGL166W (CUP2)225401303e-08
Scas_710.11743401335e-08
AEL295C544401308e-08
KLLA0A03047g567401309e-08
YPR008W (HAA1)694401301e-07
Kwal_14.1543599401282e-07
CAGL0I04180g265391224e-07
Scas_670.3107496900.008
Kwal_12.67513299627.0
Scas_631.518856629.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E07733g
         (462 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E07733g 694992..696401 weakly similar to sp|P35192 Saccharo...   912   0.0  
Sklu_2411.8 YMR021C, Contig c2411 15729-16877                         271   7e-87
ABR058C [649] [Homologous to ScYMR021C (MAC1) - SH] (501771..502...   253   2e-80
Kwal_26.8219                                                          252   1e-79
Scas_576.5                                                            216   2e-65
CAGL0M07590g 758940..760310 weakly similar to sp|P35192 Saccharo...   189   6e-55
YMR021C (MAC1) [3985] chr13 complement(317164..318417) Transcrip...   149   2e-40
Scas_668.16                                                            65   1e-11
CAGL0L09339g 1012259..1014892 some similarities with sp|Q12753 S...    57   3e-08
YGL166W (CUP2) [1824] chr7 (191133..191810) Copper-dependent tra...    55   3e-08
Scas_710.11                                                            56   5e-08
AEL295C [2210] [Homologous to ScYPR008W (HAA1) - SH; ScYGL166W (...    55   8e-08
KLLA0A03047g 269553..271256 some similarities with sp|Q12753 Sac...    55   9e-08
YPR008W (HAA1) [5444] chr16 (573013..575097) Nuclear protein tha...    55   1e-07
Kwal_14.1543                                                           54   2e-07
CAGL0I04180g 367258..368055 sp|P41772 Candida glabrata metal-act...    52   4e-07
Scas_670.3                                                             39   0.008
Kwal_12.675                                                            28   7.0  
Scas_631.5                                                             28   9.7  

>KLLA0E07733g 694992..696401 weakly similar to sp|P35192
           Saccharomyces cerevisiae YMR021c MAC1 metal binding
           activator singleton, start by similarity
          Length = 469

 Score =  912 bits (2358), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/462 (95%), Positives = 439/462 (95%)

Query: 1   MIIFNGEKYSCVSCIRGHRSSSCKHSERMLVKVRTRGRPSPLDIRKVILVDRASRVEEVD 60
           MIIFNGEKYSCVSCIRGHRSSSCKHSERMLVKVRTRGRPSPLDIRKVILVDRASRVEEVD
Sbjct: 1   MIIFNGEKYSCVSCIRGHRSSSCKHSERMLVKVRTRGRPSPLDIRKVILVDRASRVEEVD 60

Query: 61  GSGQDNGAGDESQLCCGMNKQPVLFLRAIATKKALLINGDLKIMVTSESGTPDYEVARKV 120
           GSGQDNGAGDESQLCCGMNKQPVLFLRAIATKKALLINGDLKIMVTSESGTPDYEVARKV
Sbjct: 61  GSGQDNGAGDESQLCCGMNKQPVLFLRAIATKKALLINGDLKIMVTSESGTPDYEVARKV 120

Query: 121 SDDNKFVTEHEFLLNHVSPPPCKSCNSTVKRENESHSLDATNTTENYAKRVKFERQDMTN 180
           SDDNKFVTEHEFLLNHVSPPPCKSCNSTVKRENESHSLDATNTTENYAKRVKFERQDMTN
Sbjct: 121 SDDNKFVTEHEFLLNHVSPPPCKSCNSTVKRENESHSLDATNTTENYAKRVKFERQDMTN 180

Query: 181 LSNHELLSAGDNVQLNSVGNSTFQDSVVELFTQNGAYLSTTXXXXXXXXXXXXLIHREEA 240
           LSNHELLSAGDNVQLNSVGNSTFQDSVVELFTQNGAYLSTT            LIHREEA
Sbjct: 181 LSNHELLSAGDNVQLNSVGNSTFQDSVVELFTQNGAYLSTTCSCNENCQCNNCLIHREEA 240

Query: 241 ELERYLTELNQPMINLGSAQILTADSSQVEPSKDFFHGETDDQNMSTLCLCEPDFCTCFN 300
           ELERYLTELNQPMINLGSAQILTADSSQVEPSKDFFHGETDDQNMSTLCLCEPDFCTCFN
Sbjct: 241 ELERYLTELNQPMINLGSAQILTADSSQVEPSKDFFHGETDDQNMSTLCLCEPDFCTCFN 300

Query: 301 CEAHPDEVVTLSELLLYGVLNYKWKKKMVIKYRNKVIHSKYWWHYLTVEIPSMNEKQLRS 360
           CEAHPDEVVTLSELLLYGVLNYKWKKKMVIKYRNKVIHSKYWWHYLTVEIPSMNEKQLRS
Sbjct: 301 CEAHPDEVVTLSELLLYGVLNYKWKKKMVIKYRNKVIHSKYWWHYLTVEIPSMNEKQLRS 360

Query: 361 LDLMEWFDNLISSHSAELPEANDLVHFTDSRGNAHHGNQNDNTKNHININKSIQDDMKRL 420
           LDLMEWFDNLISSHSAELPEANDLVHFTDSRGNAHHGNQNDNTKNHININKSIQDDMKRL
Sbjct: 361 LDLMEWFDNLISSHSAELPEANDLVHFTDSRGNAHHGNQNDNTKNHININKSIQDDMKRL 420

Query: 421 MPNFGNNNVTLKKDTHSPKGDNRXXXXXXXXXXXHMNIHDPL 462
           MPNFGNNNVTLKKDTHSPKGDNR           HMNIHDPL
Sbjct: 421 MPNFGNNNVTLKKDTHSPKGDNRTLLTGTTTADTHMNIHDPL 462

>Sklu_2411.8 YMR021C, Contig c2411 15729-16877
          Length = 382

 Score =  271 bits (692), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 157/398 (39%), Positives = 231/398 (58%), Gaps = 36/398 (9%)

Query: 1   MIIFNGEKYSCVSCIRGHRSSSCKHSERMLVKVRTRGRPSPLDIRKVILVDRASRVEEVD 60
           MIIF+G+KYSCV+CIRGHRSS+CKHS+RMLVKVRTRGRPSP+D+RKVI+VD  S+VE   
Sbjct: 1   MIIFDGDKYSCVACIRGHRSSTCKHSDRMLVKVRTRGRPSPMDVRKVIMVDTDSQVEPPV 60

Query: 61  GSGQDNG-----AGDESQLCCGMNKQPVLFLRAIATKKALLINGDLKIMVTSESGTPDYE 115
            + +D+      +   S+ C  MNKQP+LFLRA+ T+KALL++G LKIMV          
Sbjct: 61  HTPEDSNPCCQRSNANSKSCNKMNKQPILFLRAMRTQKALLVDGMLKIMVEDNES----- 115

Query: 116 VARKVSDDNKFVTEHEFLLNHVS--PPPCKSCNSTVKRENESHSLDATNTTENYAKRVKF 173
           V+       K V+E E++L H +   P C SC S           +     EN  ++   
Sbjct: 116 VSIDSKKKFKLVSEREYMLKHSNNRMPDCCSCKS-----------EEAELPENELEQRTA 164

Query: 174 ERQDMTNLSN-HELLSAGDNVQLNSVGNSTFQDSVVELFTQNGAYLST-TXXXXXXXXXX 231
             Q +    N +++LS               ++ +VEL T  G YLST            
Sbjct: 165 SFQSVKTFHNGNDVLSTTATPPPPITD----ENQMVELLTHKGVYLSTQCSCEDDNCQCD 220

Query: 232 XXLIHREEAELERYLTELNQPMINLGSAQILTADSSQVEPSKDFFHGETDDQNMSTLCLC 291
             LIHR+E EL +Y+ +   P+ NLG+ ++   ++     S       T+     ++C C
Sbjct: 221 NCLIHRKEEELNKYIRQSGIPLTNLGNGRVTDDENGHGNGSIKTISCSTE-----SVCRC 275

Query: 292 EPDFCTCFNCEAHPDEVVTLSELLLYGVLNYKWKKKMVIKYRNKVIHSKYWWHYLTVEIP 351
            P  C C +C  HP E++++S LLL+GVLN + K+K +IKYRNK+I SKYWW ++ ++IP
Sbjct: 276 PPQDCICPHCLDHPGEIISMSNLLLHGVLNTQLKRKTIIKYRNKLIPSKYWWDFIKLQIP 335

Query: 352 SMNEKQLRSLDLMEWFDNLISSHSAELPE--ANDLVHF 387
            M+ +QL SLDL+ WFD+++ ++ + L E   +D+++ 
Sbjct: 336 LMSRRQLESLDLLRWFDSIVEAYGSFLLEDHGDDMINL 373

>ABR058C [649] [Homologous to ScYMR021C (MAC1) - SH]
           (501771..502826) [1056 bp, 351 aa]
          Length = 350

 Score =  253 bits (647), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 151/391 (38%), Positives = 209/391 (53%), Gaps = 66/391 (16%)

Query: 1   MIIFNGEKYSCVSCIRGHRSSSCKHSERMLVKVRTRGRPSPLDIRKVILVDRASRVEEVD 60
           MIIF+GEKYSC +CIRGHRS++CKHS+RMLVKVRTRGRPSP+DIRKVILVD  S+V   D
Sbjct: 1   MIIFDGEKYSCAACIRGHRSTTCKHSDRMLVKVRTRGRPSPMDIRKVILVDAGSQVPMED 60

Query: 61  GSGQDNGAGDESQLCCGMNKQPVLFLRAIATKKALLINGDLKIMVTSESGTPDYEVARKV 120
              ++    D  + C  M++QP+LFL+A+ T+KALL++G LKIM+   + +        V
Sbjct: 61  EDTEE--CCDGGKTCGKMDRQPILFLKALKTQKALLVDGALKIMIEDRANSDG------V 112

Query: 121 SDDNKFVTEHEFLLNHVSPPPCKSCNSTVKRENESHSLDATNTTENYAKRVKFERQDMTN 180
               KFVTE EFLL                                              
Sbjct: 113 DKRFKFVTEKEFLLQ--------------------------------------------- 127

Query: 181 LSNHELLSAGDNVQLN-----SVGNSTFQDS--VVELFTQNGAYLST-TXXXXXXXXXXX 232
             N ++L A D           VG ST   S   VE +T  G YLST             
Sbjct: 128 --NADMLKARDGCGCQRPKRARVGCSTGAGSPHAVEPYTYKGVYLSTQCSCDDSACQCAN 185

Query: 233 XLIHREEAELERYLTELNQPM--INLGSAQILTADSSQVEPSKDFFHGETDDQNMSTLCL 290
            LIHR+E EL++++ +   P+  ++L   +   A +   + +     G     N  T C 
Sbjct: 186 CLIHRKEEELDQFIRQSGVPLTSVDLEDRKPAEAGACCGDRASGLL-GYDYAANERTSCA 244

Query: 291 CEPDFCTCFNCEAHPDEVVTLSELLLYGVLNYKWKKKMVIKYRNKVIHSKYWWHYLTVEI 350
           C P  C C +CE H +EVV+++ LLL+G+LN   K+KM I+Y+ K+I+SK+WW  L ++ 
Sbjct: 245 CSPVSCMCKDCEIHAEEVVSMNRLLLHGILNTPLKRKMSIQYKGKLINSKFWWDILYLQC 304

Query: 351 PSMNEKQLRSLDLMEWFDNLISSHSAELPEA 381
               E QL +LDL++WFDN+I +H A LP+A
Sbjct: 305 AVAREPQLEALDLLQWFDNIIETHGAALPDA 335

>Kwal_26.8219
          Length = 391

 Score =  252 bits (644), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 155/403 (38%), Positives = 228/403 (56%), Gaps = 46/403 (11%)

Query: 1   MIIFNGEKYSCVSCIRGHRSSSCKHSERMLVKVRTRGRPSPLDIRKVILVDRASRV---- 56
           MIIF+GEKYSCVSCIRGHRSS+CKHS RMLVKVRTRGRPS   +RKVILVD +S+V    
Sbjct: 1   MIIFDGEKYSCVSCIRGHRSSTCKHSNRMLVKVRTRGRPSAQTVRKVILVDASSQVNSSP 60

Query: 57  --EEVDGSGQDNGAGDESQLCCGMNKQPVLFLRAIATKKALLINGDLKIMVTSESGTPDY 114
             EE D       +   S+ C  MNKQP+LFLR ++T+KALL++G LKIM+  E   P +
Sbjct: 61  HTEEDDQGQSPCCSSSASRSCTKMNKQPILFLRTMSTQKALLVDGALKIMI--EDTDPAF 118

Query: 115 EVARKVSDDNKFVTEHEFLLNHVSPPPCKSCNST-------VKREN------ESHSLDAT 161
                     KFV+E ++LLNH+  P       T       VK  +      +S +L + 
Sbjct: 119 H------GKYKFVSERDYLLNHLQIPLDDYSQETNGLAKNSVKEPSSLGNLLQSDTLLSN 172

Query: 162 NTTENYAKRVKFERQDMTNLSNHELLSAGDNVQLNSVGNSTFQDSVVELFTQNGAYLSTT 221
            + ++    +KFE Q+  +     L +     Q++++ +     S+VELFT  G YLST 
Sbjct: 173 ESQKHEYPDIKFEEQNRPSF----LPTGKHTEQISTLDSEAHNTSMVELFTHKGVYLSTQ 228

Query: 222 -XXXXXXXXXXXXLIHREEAELERYLTELNQPMINLGSAQILTADSSQVEPSKDFFHGET 280
                        LIHR+E ELE Y+ +   P+  +G+ +I        + SKD F    
Sbjct: 229 CSCDEGNCSCVNCLIHRKEEELESYIQQSGVPLSTIGNGRITFPIE---QSSKDAF---- 281

Query: 281 DDQNMSTLCLCEPDFCTCFNCEAHPDEVVTLSELLLYGVLNYKWKKKMVIKYRNKVIHSK 340
                  +C    + C   +C  HP E+++L+ + +YG++N   K+K VIK+++K+I SK
Sbjct: 282 -------VCKYSAEECPIQDCLLHPAEILSLNHIFIYGLINVPIKRKSVIKFKHKLIPSK 334

Query: 341 YWWHYLTVEIPSMNEKQLRSLDLMEWFDNLISSHSAELPEAND 383
           +WWH L  E+P+M  +Q  S D+ +WF+++I + +AE+P  +D
Sbjct: 335 FWWHLLKEELPNMPHEQSASFDIFQWFEHIIETFNAEIPNESD 377

>Scas_576.5
          Length = 407

 Score =  216 bits (550), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 142/411 (34%), Positives = 215/411 (52%), Gaps = 43/411 (10%)

Query: 1   MIIFNGEKYSCVSCIRGHRSSSCKHSERMLVKVRTRGRPSPLDIRKVILVDRASRVEEVD 60
           MII+  EKY+C SCIRGHRSS+CKH+ RMLVKVRTRGRPSP +IR VI+VD +SR++   
Sbjct: 1   MIIYASEKYACASCIRGHRSSTCKHTNRMLVKVRTRGRPSPTEIRDVIMVDSSSRIDAKS 60

Query: 61  GSGQDN-----GAGDESQLCC-GMNKQPVLFLRAIATKKALLINGDLKIMV--TSESGTP 112
                N       GD+S  C   M +QPVLF+R   +KKA L+NG L+I+V  +++S   
Sbjct: 61  SCHSSNHQSKLAEGDDSNSCSQNMERQPVLFVRVKDSKKARLLNGKLQILVDDSADSNEK 120

Query: 113 DYEVARKVSDDNKFVTEHEFL-------------LNHVSPPPCKSCNSTVKRENESHSLD 159
              V+ K + ++KF+ E E+L                 +P     C+      + + +  
Sbjct: 121 GSSVSSKDNGNSKFIPEVEYLKQLSGSSSGSGSNSLGSTPNSNTCCHHHTTCASMAAAAT 180

Query: 160 ATNTTENYAKRVKFERQDMTNLSNHELLSAGD-NVQLNSVGN-STFQDS---VVELFTQN 214
           A  +T++   +        TN++    L  G     LNS+       DS   +V+LFT  
Sbjct: 181 ANTSTQSLLSKNDNNMTTSTNMTEDNNLDIGKIEESLNSMEYFEQVLDSKTPLVDLFTHK 240

Query: 215 GAYLSTTXXXXXXXX-XXXXLIHREEAELERYLTELNQPMINLGSAQILTADSSQVEPSK 273
           G YLS+              LIHR E EL  Y+ +   P+ N+G A          E   
Sbjct: 241 GVYLSSACSCEDGNCPCLNCLIHRNEDELNSYIRQSGIPLTNVGEA----------EYKN 290

Query: 274 DFFHGETDDQNMSTLCLCEPDFCTCFNCEAHPDEVVTLSELLLYGVLNYKWKKKMVIKYR 333
           +     T +      C C    C C +C  HP E++++ ++LL G+L+   ++K VIK++
Sbjct: 291 ELMECTTSN------CACTAVDCLCQDCIVHPTEIISIDKILLNGLLHMTLRRKTVIKFK 344

Query: 334 NKVIHSKYWWHYLTVEIPSMNEKQLRSLDLMEWFDNLISSHSAELPEANDL 384
           NK+I S+YWW +L  +   + E  L S+D++ WFD+LI+ +  EL +A+D+
Sbjct: 345 NKLIPSQYWWDFLIGKTVKLQEGDLESIDIIGWFDSLINKYPMELLDASDM 395

>CAGL0M07590g 758940..760310 weakly similar to sp|P35192
           Saccharomyces cerevisiae YMR021c metal binding
           activator, start by similarity
          Length = 456

 Score =  189 bits (481), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 141/425 (33%), Positives = 193/425 (45%), Gaps = 71/425 (16%)

Query: 1   MIIFNGEKYSCVSCIRGHRSSSCKHSERMLVKVRTRGRPSPLDIRKVILVDRASRVEEVD 60
           MIIF  +KY+CV CIRGHRSS C H+ RMLVKVR RGR   +D+R  I+V    R    +
Sbjct: 1   MIIFKNDKYACVKCIRGHRSSLCVHTGRMLVKVRNRGRKKGIDVRDAIVVGDIHRKRSCE 60

Query: 61  -GSGQDNGAGDESQ-------------------LCCGMNKQPVLFLRAIATKKALLINGD 100
             SG    AGD+S+                    C GMNKQP+LF+RA    KA LI G+
Sbjct: 61  CASGH---AGDDSKQYGAPNADVSRPHESGLNSTCVGMNKQPILFVRAKKVLKAQLIGGE 117

Query: 101 LKIMVTSESGTPDYEVARKVSDDNKFVT-----EHEFLLNHVSPPPCKSCNSTVKRENES 155
           LK M  SE      EV    SDD    T     + E L N+V           V + N  
Sbjct: 118 LKEM--SEVDMSRLEV--DTSDDETVATTTTVPKVEILDNNVL---------NVTQGNID 164

Query: 156 HSLDATNTTENYAKRVKFERQDMTNLSNHELLSAGDNV--------------QLNSVGNS 201
             +   + T+N+A     E  D   LS+  +   G +                + +    
Sbjct: 165 DDMVLVDDTKNFAGASIGELID-EQLSSINVEPTGSHCCGSQPHGIDPMKTTTVTAAATE 223

Query: 202 TFQDSVVELFTQNGAYLST-TXXXXXXXXXXXXLIHREEAELERYLTELNQPMINLGSAQ 260
           T +    +L T+ G YLST              LIHR E E+  Y+     P+ NL S+ 
Sbjct: 224 TEKYPFFQLLTKRGVYLSTQCSCSAANCACSNCLIHRTEEEINNYIEASGVPLTNLDSST 283

Query: 261 ILTADSSQVEPSKDFFHGETDDQNMSTLCLCEPDFCTCFNCEAHPDEVVTLSELLLYGVL 320
            L A      P                 C+C+P+ CTC  C+ H  EVV    ++++G++
Sbjct: 284 SLQATPEIESPRPS--------------CMCKPEECTCDGCDIHTIEVVPFQRIVIHGLI 329

Query: 321 NYKWKKKMVIKYRNKVIHSKYWWHYLTVEIPSMNEKQLRSLDLMEWFDNLISSHSAELPE 380
           N +  KK +I+YR K+I  KYWW Y  V IP +       LD++ +FDN+I  H  EL +
Sbjct: 330 NTRLTKKTLIQYRKKLIGQKYWWDYCMVYIPCLRCNNFDGLDIVGFFDNIIKEHGHELED 389

Query: 381 ANDLV 385
           A + V
Sbjct: 390 AKEKV 394

>YMR021C (MAC1) [3985] chr13 complement(317164..318417)
           Transcription factor involved in induction of genes
           required for the reduction and utilization of iron and
           copper [1254 bp, 417 aa]
          Length = 417

 Score =  149 bits (377), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 76/144 (52%), Positives = 95/144 (65%), Gaps = 10/144 (6%)

Query: 1   MIIFNGEKYSCVSCIRGHRSSSCKHSERMLVKVRTRGRPSPLDIRKVILVDRASRVEEVD 60
           MIIFNG KY+C SCIRGHRSS+C+HS RML+KVRTRGRPSP+ IR  ILVD  S+  E  
Sbjct: 1   MIIFNGNKYACASCIRGHRSSTCRHSHRMLIKVRTRGRPSPMAIRDAILVDSTSQSTEY- 59

Query: 61  GSGQDNGAGDESQLCCGMNKQPVLFLRAIATKKALLINGDLKIMVTSESGTPDYE---VA 117
               +NGA  E   C  MN+QP+LF+RA A +KA +ING L I++  E G   +E   ++
Sbjct: 60  ----ENGAQIEGDCCSAMNQQPILFVRASAVRKARMINGKLHILM--EEGFTAHEPKDIS 113

Query: 118 RKVSDDNKFVTEHEFLLNHVSPPP 141
               D NK++TE EFL  H    P
Sbjct: 114 TFTDDGNKYITETEFLRKHSPKAP 137

 Score =  117 bits (294), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 91/177 (51%), Gaps = 11/177 (6%)

Query: 206 SVVELFTQNGAYLST-TXXXXXXXXXXXXLIHREEAELERYLTELNQPMINLGSAQILTA 264
           S VE+ T  G +LST              LIHR E EL  Y+ +   P+ N+G AQI   
Sbjct: 248 SKVEVLTHKGIFLSTQCSCEDESCPCVNCLIHRSEEELNSYIQQSGVPLTNIGEAQI--- 304

Query: 265 DSSQVEPSKDFFHGETDDQNMSTLCLCEPDFCTCFNCEAHPDEVVTLSELLLYGVLNYKW 324
                +   D+     D +     C+C PD CTC  C +H   ++   +   YG+LN + 
Sbjct: 305 ----TDKMMDYLD---DCKCTDKECICPPDNCTCDGCFSHSTNIIPFEKFFFYGILNARL 357

Query: 325 KKKMVIKYRNKVIHSKYWWHYLTVEIPSMNEKQLRSLDLMEWFDNLISSHSAELPEA 381
            +K  IK++ K++ SKYWW +L +++P M + QL  LD+  WF  L+S+++  L +A
Sbjct: 358 TRKTQIKFKGKLVPSKYWWDFLKLQVPLMTDAQLELLDIHAWFQKLVSNYAPHLSDA 414

>Scas_668.16
          Length = 291

 Score = 65.5 bits (158), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 32/40 (80%)

Query: 1  MIIFNGEKYSCVSCIRGHRSSSCKHSERMLVKVRTRGRPS 40
          MI+ NGEKY+C  CIRGHRSSSC H +R L K++ +GRPS
Sbjct: 1  MIMLNGEKYACDLCIRGHRSSSCNHRDRQLTKLKPKGRPS 40

>CAGL0L09339g 1012259..1014892 some similarities with sp|Q12753
          Saccharomyces cerevisiae YPR008w, hypothetical start
          Length = 877

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 31/40 (77%)

Query: 1  MIIFNGEKYSCVSCIRGHRSSSCKHSERMLVKVRTRGRPS 40
          M++ NG KY+C  CIRGHR ++C HS++ L+ ++ +GRPS
Sbjct: 1  MVLINGVKYACERCIRGHRVTTCNHSDQPLMMIKPKGRPS 40

>YGL166W (CUP2) [1824] chr7 (191133..191810) Copper-dependent
          transcription factor responsible for induction of
          CUP1A, CUP1B, CRS5, and SOD1 [678 bp, 225 aa]
          Length = 225

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 30/40 (75%)

Query: 1  MIIFNGEKYSCVSCIRGHRSSSCKHSERMLVKVRTRGRPS 40
          M++ NG KY+C +CIRGHR++ C H++  L  +R +GRPS
Sbjct: 1  MVVINGVKYACETCIRGHRAAQCTHTDGPLQMIRRKGRPS 40

>Scas_710.11
          Length = 743

 Score = 55.8 bits (133), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 31/40 (77%)

Query: 1  MIIFNGEKYSCVSCIRGHRSSSCKHSERMLVKVRTRGRPS 40
          M++ NG KY+C  CIRGHR ++C H+++ L+ ++ +GRPS
Sbjct: 1  MVLINGVKYACERCIRGHRVTTCNHTDQPLMMIKPKGRPS 40

>AEL295C [2210] [Homologous to ScYPR008W (HAA1) - SH; ScYGL166W
          (CUP2) - SH] (88054..89688) [1635 bp, 544 aa]
          Length = 544

 Score = 54.7 bits (130), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 31/40 (77%)

Query: 1  MIIFNGEKYSCVSCIRGHRSSSCKHSERMLVKVRTRGRPS 40
          M++ NG KY+C  CIRGHR ++C H+++ L+ ++ +GRPS
Sbjct: 1  MVLLNGVKYACERCIRGHRVTTCNHTDQPLMMIKPKGRPS 40

>KLLA0A03047g 269553..271256 some similarities with sp|Q12753
          Saccharomyces cerevisiae YPR008w, hypothetical start
          Length = 567

 Score = 54.7 bits (130), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 30/40 (75%)

Query: 1  MIIFNGEKYSCVSCIRGHRSSSCKHSERMLVKVRTRGRPS 40
          M++ NG KY+C  CIRGHR ++C H+++ L  ++ +GRPS
Sbjct: 1  MVLINGVKYACERCIRGHRVTTCNHTDQPLTMIKPKGRPS 40

>YPR008W (HAA1) [5444] chr16 (573013..575097) Nuclear protein that
          activates transcription of several genes including TPO2
          and YRO2, has homology to the copper-activated
          transcription factor Ace1p [2085 bp, 694 aa]
          Length = 694

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 31/40 (77%)

Query: 1  MIIFNGEKYSCVSCIRGHRSSSCKHSERMLVKVRTRGRPS 40
          M++ NG KY+C  CIRGHR ++C H+++ L+ ++ +GRPS
Sbjct: 1  MVLINGIKYACERCIRGHRVTTCNHTDQPLMMIKPKGRPS 40

>Kwal_14.1543
          Length = 599

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 31/40 (77%)

Query: 1  MIIFNGEKYSCVSCIRGHRSSSCKHSERMLVKVRTRGRPS 40
          M++ NG KY+C  CIRGHR ++C H+++ L+ ++ +GRPS
Sbjct: 1  MVLVNGIKYACERCIRGHRVTTCNHTDQPLMMIKPKGRPS 40

>CAGL0I04180g 367258..368055 sp|P41772 Candida glabrata
          metal-activated transcriptional activator, identified
          start
          Length = 265

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 30/39 (76%)

Query: 1  MIIFNGEKYSCVSCIRGHRSSSCKHSERMLVKVRTRGRP 39
          M++ NG KY+C SCI+ H+++ C+H++R L  ++ RGRP
Sbjct: 1  MVVINGVKYACDSCIKSHKAAQCEHNDRPLKILKPRGRP 39

>Scas_670.3
          Length = 1074

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 52/96 (54%), Gaps = 7/96 (7%)

Query: 112 PDYEVARKVSDDNKFVTEHEFLLNHVSPPPCKSCNSTVKRENESHSLDATNTTENYAKRV 171
           P +   R VSD N F+     L+N V+     +  ST+  +N  ++ D T+ TEN A R+
Sbjct: 289 PSFRPERSVSDFNNFMGTS--LINFVNSNSIITNPSTITTQNHMNNGDITSITENQAARM 346

Query: 172 KFERQDMTNLSNHELLS---AGDNVQLNSVGNSTFQ 204
             ER  + + S ++LLS   A +N+ L+ V NS+ +
Sbjct: 347 SNER--LLSFSTNQLLSIIIASENLPLSFVENSSVK 380

>Kwal_12.675
          Length = 132

 Score = 28.5 bits (62), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 44/99 (44%), Gaps = 11/99 (11%)

Query: 317 YGVLNYKWKKKMVIKYRNKVIHSKYWWHYLTVEIPSMNEKQLRSLDLMEWFDNLISSHSA 376
           Y  L  K K++ +  Y   ++H     +   + IPS      R +D   +  NLI +HS 
Sbjct: 5   YSALKKKLKERSIPGY---ILHKSETSYGSLIYIPSTG----RVVDTQNY--NLIENHSN 55

Query: 377 ELPEANDLVHF--TDSRGNAHHGNQNDNTKNHININKSI 413
           ELPE +  +    +D+       + +DN   HI  N S+
Sbjct: 56  ELPETDSELDIDNSDTETVDTDVSDSDNDDEHIGNNYSV 94

>Scas_631.5
          Length = 188

 Score = 28.5 bits (62), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 31/56 (55%), Gaps = 5/56 (8%)

Query: 367 FDNLISSHSAELPEANDLVHFTDSRGNAHHGNQNDNTKNHININKSI-QDDMKRLM 421
           F  L   H A L +A  ++   D  G+    +Q D +K H NI KSI +D++K+++
Sbjct: 36  FSQLTQDHIARLKDAFQMI---DGNGDGEI-SQQDLSKIHQNIGKSISEDELKKML 87

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.131    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 15,502,545
Number of extensions: 691348
Number of successful extensions: 2805
Number of sequences better than 10.0: 63
Number of HSP's gapped: 2807
Number of HSP's successfully gapped: 66
Length of query: 462
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 357
Effective length of database: 12,961,219
Effective search space: 4627155183
Effective search space used: 4627155183
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 63 (28.9 bits)