Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0E04477g1551538071e-112
Kwal_47.181531711254343e-55
Scas_715.27d1741283631e-44
ADL117W1731103622e-44
CAGL0J02838g1601113309e-40
YER050C (RSM18)2021083043e-35
Kwal_55.21582284121596.1
CAGL0J01980g105262589.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E04477g
         (153 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E04477g complement(409814..410281) some similarities with s...   315   e-112
Kwal_47.18153                                                         171   3e-55
Scas_715.27d                                                          144   1e-44
ADL117W [1624] [Homologous to ScYER050C (RSM18) - SH] complement...   144   2e-44
CAGL0J02838g complement(275124..275606) similar to sp|P40033 Sac...   131   9e-40
YER050C (RSM18) [1478] chr5 complement(253970..254578) Component...   121   3e-35
Kwal_55.21582                                                          27   6.1  
CAGL0J01980g 194209..197367 similar to sp|P40562 Saccharomyces c...    27   9.6  

>KLLA0E04477g complement(409814..410281) some similarities with
           sp|P40033 Saccharomyces cerevisiae YER050c RSM18
           component of the mitochondrial ribosomal small subunit
           singleton, hypothetical start
          Length = 155

 Score =  315 bits (807), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 153/153 (100%), Positives = 153/153 (100%)

Query: 1   MFSRSCARFFSTTRYVCNSLDQKLLKEGMSEANSKPTIKKLESKLIKNFQPGSVYNPFDF 60
           MFSRSCARFFSTTRYVCNSLDQKLLKEGMSEANSKPTIKKLESKLIKNFQPGSVYNPFDF
Sbjct: 1   MFSRSCARFFSTTRYVCNSLDQKLLKEGMSEANSKPTIKKLESKLIKNFQPGSVYNPFDF 60

Query: 61  SLERIHLDKKFGVRPGSFDPFNKLKINPLDLYTNPEFLSRFVTSTGKILHRDVTGLSAKN 120
           SLERIHLDKKFGVRPGSFDPFNKLKINPLDLYTNPEFLSRFVTSTGKILHRDVTGLSAKN
Sbjct: 61  SLERIHLDKKFGVRPGSFDPFNKLKINPLDLYTNPEFLSRFVTSTGKILHRDVTGLSAKN 120

Query: 121 QRRLTKAIKRCQAIGLMSKVHKDISVLPQRTAN 153
           QRRLTKAIKRCQAIGLMSKVHKDISVLPQRTAN
Sbjct: 121 QRRLTKAIKRCQAIGLMSKVHKDISVLPQRTAN 153

>Kwal_47.18153
          Length = 171

 Score =  171 bits (434), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 100/125 (80%), Gaps = 3/125 (2%)

Query: 26  KEGMSEANSKPTIKKLESKLIKNFQPGSVYNPFDFSLERIHLDKKFGVRPGSFDPFNKLK 85
           KE  S A+     KK++ +L+K FQ G+ Y+PFDFSL R+HLDKKF  +  S D F K  
Sbjct: 45  KESGSSASQN---KKIDPRLVKKFQSGTTYDPFDFSLARLHLDKKFSSKNSSNDLFEKNG 101

Query: 86  INPLDLYTNPEFLSRFVTSTGKILHRDVTGLSAKNQRRLTKAIKRCQAIGLMSKVHKDIS 145
           ++PLDLYTNPEFLS+FVTS+GKILHRDVTGLSAKNQRRL+KAI+RCQAIGLMSK H+D+S
Sbjct: 102 VDPLDLYTNPEFLSQFVTSSGKILHRDVTGLSAKNQRRLSKAIRRCQAIGLMSKTHRDVS 161

Query: 146 VLPQR 150
            LP R
Sbjct: 162 FLPSR 166

>Scas_715.27d
          Length = 174

 Score =  144 bits (363), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 66/128 (51%), Positives = 97/128 (75%), Gaps = 1/128 (0%)

Query: 25  LKEGMSEANSKPTIKKLESKLIKNFQPGSVYNPFDFSLERIHLDKKFGVRPGSFDPFN-K 83
           L+E  +++ +  ++K ++   +K FQ GS+Y+PFDFS+ +++LD+K     G+   +N  
Sbjct: 46  LRESQAKSKTNSSVKAIDEVFVKKFQQGSIYDPFDFSMAKVNLDRKTKSLIGTSKTYNIS 105

Query: 84  LKINPLDLYTNPEFLSRFVTSTGKILHRDVTGLSAKNQRRLTKAIKRCQAIGLMSKVHKD 143
             INPLDLY++P  L++F++STGKILHRDVTGLSAKNQRRL+KAIKR Q+IGL+SK HK 
Sbjct: 106 YNINPLDLYSSPSELNKFISSTGKILHRDVTGLSAKNQRRLSKAIKRAQSIGLLSKTHKH 165

Query: 144 ISVLPQRT 151
           +  LP+R+
Sbjct: 166 VDALPRRS 173

>ADL117W [1624] [Homologous to ScYER050C (RSM18) - SH]
           complement(480459..480980) [522 bp, 173 aa]
          Length = 173

 Score =  144 bits (362), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 88/110 (80%)

Query: 38  IKKLESKLIKNFQPGSVYNPFDFSLERIHLDKKFGVRPGSFDPFNKLKINPLDLYTNPEF 97
           +KK+  +++K F  GS+Y+PFDFS+ R+HL+KK        D F +L ++PLDLYT+P  
Sbjct: 56  VKKVPPEMMKKFATGSLYDPFDFSMARLHLEKKHRKNARKVDIFEELNLDPLDLYTSPAI 115

Query: 98  LSRFVTSTGKILHRDVTGLSAKNQRRLTKAIKRCQAIGLMSKVHKDISVL 147
           LSRFV +TGKILHRDVTGLS ++Q+R+++A++RCQAIGLMSK HKD+S+L
Sbjct: 116 LSRFVGNTGKILHRDVTGLSVRSQKRMSRAVRRCQAIGLMSKTHKDVSLL 165

>CAGL0J02838g complement(275124..275606) similar to sp|P40033
           Saccharomyces cerevisiae YER050c RSM18, hypothetical
           start
          Length = 160

 Score =  131 bits (330), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 65/111 (58%), Positives = 80/111 (72%), Gaps = 3/111 (2%)

Query: 34  SKPTIKKLESKLIKNFQPGSVYNPFDFSLERIHLDKKFGVRP--GSFDPFNKLKINPLDL 91
           S+  IK + +  +  FQ  +VY+PFDFSL R++LD+K   RP     D F K  +NPL+ 
Sbjct: 45  SRENIKTINANFVPQFQRSAVYDPFDFSLSRLNLDRKMN-RPKIQHHDLFEKYGLNPLNF 103

Query: 92  YTNPEFLSRFVTSTGKILHRDVTGLSAKNQRRLTKAIKRCQAIGLMSKVHK 142
           Y  PE LS +V STGKILHRDVTGLSAKNQRR+ KAI+RCQAIGLMSK H+
Sbjct: 104 YARPEILSYYVGSTGKILHRDVTGLSAKNQRRMAKAIRRCQAIGLMSKTHR 154

>YER050C (RSM18) [1478] chr5 complement(253970..254578) Component of
           the mitochondrial ribosomal small subunit [609 bp, 202
           aa]
          Length = 202

 Score =  121 bits (304), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 59/108 (54%), Positives = 74/108 (68%), Gaps = 1/108 (0%)

Query: 31  EANSKPTIKKLESKLIKNFQPGSVYNPFDFSLERIHLDKKFGVRPGS-FDPFNKLKINPL 89
           E       KK++  L K    G++Y+PFDFS+ RIHLD+K+     S  +   K   NPL
Sbjct: 95  EMGRTQQTKKIDQSLSKKLPKGTIYDPFDFSMGRIHLDRKYQANKNSNRNDIMKSGANPL 154

Query: 90  DLYTNPEFLSRFVTSTGKILHRDVTGLSAKNQRRLTKAIKRCQAIGLM 137
           + Y  P  LSR+VTSTG+I HRD+TGLSAKNQRRL+KAI+RCQAIGLM
Sbjct: 155 EFYARPRILSRYVTSTGRIQHRDITGLSAKNQRRLSKAIRRCQAIGLM 202

>Kwal_55.21582
          Length = 284

 Score = 27.3 bits (59), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 28/121 (23%), Positives = 47/121 (38%), Gaps = 20/121 (16%)

Query: 1   MFSRSCARFFSTTRYVCNSLDQKLLKEGMSEAN------------SKPTIKKLESKLIKN 48
           +F+  C RFF  T    +    + + +G+ E N            +K  +K +   + K 
Sbjct: 155 LFTAGCGRFFEGTGEEMDVALNRSILDGVGEPNWDITKVYPGHEYTKSNVKFVRKAVYKT 214

Query: 49  FQPGSVYNPFDFSLERI-HLDKKFGVRPGSFDPFNKLKINPLDLYTNPEFLSRFVTSTGK 107
             PG      + SL+R+ H+  K  V  G F   ++L  NP     +P        S G 
Sbjct: 215 --PGE-----NSSLDRLEHVCNKHDVTTGMFTIHDELAYNPFMRLDDPTVRDAIKDSNGS 267

Query: 108 I 108
           +
Sbjct: 268 L 268

>CAGL0J01980g 194209..197367 similar to sp|P40562 Saccharomyces
            cerevisiae YIR002c SJH1, hypothetical start
          Length = 1052

 Score = 26.9 bits (58), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 28/62 (45%), Gaps = 5/62 (8%)

Query: 85   KINPLDLYTNPEFLSRFVTSTGKILHRD-----VTGLSAKNQRRLTKAIKRCQAIGLMSK 139
            K NP D     E + RFV + G++ H       +T     N  R+ + I+  +  G+  +
Sbjct: 941  KYNPEDATVTIEPVPRFVRAHGRVKHSKRTEQLITLFEDMNHNRVARTIEMNKLRGIARR 1000

Query: 140  VH 141
            +H
Sbjct: 1001 LH 1002

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.135    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,992,647
Number of extensions: 213748
Number of successful extensions: 630
Number of sequences better than 10.0: 15
Number of HSP's gapped: 627
Number of HSP's successfully gapped: 15
Length of query: 153
Length of database: 16,596,109
Length adjustment: 93
Effective length of query: 60
Effective length of database: 13,376,635
Effective search space: 802598100
Effective search space used: 802598100
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 57 (26.6 bits)