Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0E04455g42141519770.0
Kwal_47.1815141436211631e-158
ADL116C43536111431e-155
Sklu_2174.241336311181e-151
CAGL0L00869g41936810061e-134
YIL042C3943638411e-110
Scas_704.444433908321e-107
AER270W4892782419e-22
KLLA0F27423g5122882108e-18
CAGL0F07007g4853541813e-14
Kwal_14.18254923501743e-13
AAR157C5033521582e-11
KLLA0C05654g4732481547e-11
Scas_563.94923571476e-10
Sklu_2299.65302581342e-08
YGL059W4912691333e-08
Scas_698.14118381950.002
YIL147C (SLN1)122081880.009
KLLA0A00638g115582870.016
CAGL0H06567g116980860.019
AFR284W110379820.061
Kwal_55.19707114381790.13
Scas_599.1055174720.79
YIL061C (SNP1)30055672.6
YMR265C46155672.7
YLR265C (NEJ1)34224663.3
YIL126W (STH1)135957655.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E04455g
         (415 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E04455g 408415..409680 similar to sp|P40530 Saccharomyces c...   766   0.0  
Kwal_47.18151                                                         452   e-158
ADL116C [1625] [Homologous to ScYIL042C - SH] (481045..482352) [...   444   e-155
Sklu_2174.2 YIL042C, Contig c2174 576-1817 reverse complement         435   e-151
CAGL0L00869g complement(105236..106495) similar to sp|P40530 Sac...   392   e-134
YIL042C (YIL042C) [2625] chr9 complement(275107..276291) Protein...   328   e-110
Scas_704.44                                                           325   e-107
AER270W [2772] [Homologous to NOHBY] complement(1131292..1132761...    97   9e-22
KLLA0F27423g complement(2537353..2538891) similar to ca|CA5524|I...    86   8e-18
CAGL0F07007g 687174..688631 highly similar to sp|P53170 Saccharo...    74   3e-14
Kwal_14.1825                                                           72   3e-13
AAR157C [345] [Homologous to ScYGL059W - SH] (627130..628641) [1...    65   2e-11
KLLA0C05654g complement(504568..505989) similar to sp|P53170 Sac...    64   7e-11
Scas_563.9                                                             61   6e-10
Sklu_2299.6 YGL059W, Contig c2299 10909-12501 reverse complement       56   2e-08
YGL059W (YGL059W) [1920] chr7 (392226..393701) Protein with simi...    56   3e-08
Scas_698.14                                                            41   0.002
YIL147C (SLN1) [2530] chr9 complement(69791..73453) Two-componen...    39   0.009
KLLA0A00638g complement(60378..63845) gi|5531277|emb|CAB50891.1 ...    38   0.016
CAGL0H06567g 645707..649216 similar to sp|P39928 Saccharomyces c...    38   0.019
AFR284W [3476] [Homologous to ScYIL147C (SLN1) - SH] complement(...    36   0.061
Kwal_55.19707                                                          35   0.13 
Scas_599.10                                                            32   0.79 
YIL061C (SNP1) [2610] chr9 complement(244654..245556) U1 snRNA-a...    30   2.6  
YMR265C (YMR265C) [4219] chr13 complement(796539..797924) Protei...    30   2.7  
YLR265C (NEJ1) [3659] chr12 complement(674429..675457) Protein i...    30   3.3  
YIL126W (STH1) [2550] chr9 (117992..122071) Component of abundan...    30   5.5  

>KLLA0E04455g 408415..409680 similar to sp|P40530 Saccharomyces
           cerevisiae YIL042c, hypothetical start
          Length = 421

 Score =  766 bits (1977), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/415 (91%), Positives = 378/415 (91%)

Query: 1   MTVCGILRKQASITARNRCRFFSVHRSPLFNTHIKNDEKTVXXXXXXXXXXXXXXXXXEM 60
           MTVCGILRKQASITARNRCRFFSVHRSPLFNTHIKNDEKTV                 EM
Sbjct: 1   MTVCGILRKQASITARNRCRFFSVHRSPLFNTHIKNDEKTVSSHNRLHRRNNHRKRSKEM 60

Query: 61  TELNFQELYHIRSNIQHLIQDYSSYEIPKIDWAFLLQYRGPLQDNEKYFXXXXXXXXXXX 120
           TELNFQELYHIRSNIQHLIQDYSSYEIPKIDWAFLLQYRGPLQDNEKYF           
Sbjct: 61  TELNFQELYHIRSNIQHLIQDYSSYEIPKIDWAFLLQYRGPLQDNEKYFLTIKTLNLLLT 120

Query: 121 XXXXXXXXXQELPYIALVNPNIEQSNRLYLKTLESLLSIEYPYDLYDTDKIQNLTEEFLN 180
                    QELPYIALVNPNIEQSNRLYLKTLESLLSIEYPYDLYDTDKIQNLTEEFLN
Sbjct: 121 LTCHRLASLQELPYIALVNPNIEQSNRLYLKTLESLLSIEYPYDLYDTDKIQNLTEEFLN 180

Query: 181 DHQDTLLTLSNGLQEVSRFYDPENIFKFLNKHLHDRILMKLLTTNYLKLLEQTSSDEVIG 240
           DHQDTLLTLSNGLQEVSRFYDPENIFKFLNKHLHDRILMKLLTTNYLKLLEQTSSDEVIG
Sbjct: 181 DHQDTLLTLSNGLQEVSRFYDPENIFKFLNKHLHDRILMKLLTTNYLKLLEQTSSDEVIG 240

Query: 241 VIHKDLHISDLVTRTNEFVNDLTFIKYDKTVPVKIMEGSDVKFSYIPTDLEYVLQELLKN 300
           VIHKDLHISDLVTRTNEFVNDLTFIKYDKTVPVKIMEGSDVKFSYIPTDLEYVLQELLKN
Sbjct: 241 VIHKDLHISDLVTRTNEFVNDLTFIKYDKTVPVKIMEGSDVKFSYIPTDLEYVLQELLKN 300

Query: 301 SSRAHIENNVDKDVEVTIVKNDDQLEIRIRDFGGGIDPQVEDRVFDYSFSTTVKEEKDSG 360
           SSRAHIENNVDKDVEVTIVKNDDQLEIRIRDFGGGIDPQVEDRVFDYSFSTTVKEEKDSG
Sbjct: 301 SSRAHIENNVDKDVEVTIVKNDDQLEIRIRDFGGGIDPQVEDRVFDYSFSTTVKEEKDSG 360

Query: 361 MSDYVLPGQEVQNVAGMGFGLPMCKAYLELFNGTLDIQSLWGWGTDVYIRLHGPS 415
           MSDYVLPGQEVQNVAGMGFGLPMCKAYLELFNGTLDIQSLWGWGTDVYIRLHGPS
Sbjct: 361 MSDYVLPGQEVQNVAGMGFGLPMCKAYLELFNGTLDIQSLWGWGTDVYIRLHGPS 415

>Kwal_47.18151
          Length = 414

 Score =  452 bits (1163), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 219/362 (60%), Positives = 269/362 (74%), Gaps = 7/362 (1%)

Query: 60  MTELNFQELYHIRSNIQHLIQDYSSYEIPKIDWAFLLQYRGPLQDNEKYFXXXXXXXXXX 119
           + E+ F+ELY IRSN + LIQD++   IP I + FL QY+ PL DNEKY           
Sbjct: 47  LREVGFEELYRIRSNTELLIQDFAKKPIPAISYEFLTQYKVPLTDNEKYMLTIQTVNLLL 106

Query: 120 XXXXXXXXXXQELPYIALVNPNIEQSNRLYLKTLESLLSIEYPYDLYDTDKIQNLTEEFL 179
                     Q+LPYIA++NPNIE++NRLYL+TLESLLS+ YPY L+D + +     EFL
Sbjct: 107 TYTCRRLVAIQKLPYIAVLNPNIEETNRLYLRTLESLLSLNYPYGLHDQEVMAKKLTEFL 166

Query: 180 NDHQDTLLTLSNGLQEVSRFYDPENIFKFLNKHLHDRILMKLLTTNYLKLLEQTSSDE-V 238
           +DHQDTLLTLS G QE+  F+  E++F+FLN HL DRI MKLL T+YL ++ QTS D+ V
Sbjct: 167 DDHQDTLLTLSRGFQEIMEFFPKESVFEFLNSHLRDRISMKLLATHYLAIVSQTSRDDRV 226

Query: 239 IGVIHKDLHISDLVTRTNEFVNDLTFIKYDKTVPVKIMEGSDVKFSYIPTDLEYVLQELL 298
           IGV+H+++ IS+LV R  EFV DL ++KYD+ VP+KI+EG DV F  IPTDLEYVL ELL
Sbjct: 227 IGVLHREMKISELVCRVEEFVGDLCYVKYDQQVPIKILEGEDVTFPCIPTDLEYVLTELL 286

Query: 299 KNSSRAHIE------NNVDKDVEVTIVKNDDQLEIRIRDFGGGIDPQVEDRVFDYSFSTT 352
           KNSSRAHIE      N  +K VEVTIV+ D+ L+IRIRDFGGGI P VEDR+FDYS+ST 
Sbjct: 287 KNSSRAHIEGSTSDNNTAEKPVEVTIVRKDNDLKIRIRDFGGGIPPVVEDRMFDYSYSTV 346

Query: 353 VKEEKDSGMSDYVLPGQEVQNVAGMGFGLPMCKAYLELFNGTLDIQSLWGWGTDVYIRLH 412
             + KDSGMS YV+PG +V NV+GMGFGLPMCKAY+E+FNGTLDIQSLWGWGTD YI L 
Sbjct: 347 NTDAKDSGMSAYVIPGADVCNVSGMGFGLPMCKAYMEMFNGTLDIQSLWGWGTDAYIYLK 406

Query: 413 GP 414
           GP
Sbjct: 407 GP 408

>ADL116C [1625] [Homologous to ScYIL042C - SH] (481045..482352)
           [1308 bp, 435 aa]
          Length = 435

 Score =  444 bits (1143), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 210/361 (58%), Positives = 273/361 (75%), Gaps = 6/361 (1%)

Query: 60  MTELNFQELYHIRSNIQHLIQDYSSYEIPKIDWAFLLQYRGPLQDNEKYFXXXXXXXXXX 119
           +++L+F++LY +RSN++ LIQDY+  EIP+I + FL +Y  PL DNE++           
Sbjct: 66  LSQLSFEQLYQLRSNLEMLIQDYAKREIPRITYEFLTEYVPPLSDNERFMLSIKVLNMLL 125

Query: 120 XXXXXXXXXXQELPYIALVNPNIEQSNRLYLKTLESLLSIEYPYDLYDTDKIQNLTEEFL 179
                     Q LPYIA++NPNIE+SNRLYLKTLESLL+IE PY L+D   ++     FL
Sbjct: 126 TYTCRRLLALQRLPYIAVINPNIEESNRLYLKTLESLLAIELPYGLHDHAAMREKLITFL 185

Query: 180 NDHQDTLLTLSNGLQEVSRFYDPENIFKFLNKHLHDRILMKLLTTNYLKLLEQTSSDEVI 239
           +DH DTL+TLS G +E+  FY  + +F FLN HL DR+ MKLL T+YL+L+EQ+S  + I
Sbjct: 186 DDHGDTLVTLSKGFEEIMDFYPQQKVFDFLNIHLRDRLSMKLLVTHYLRLVEQSSGADCI 245

Query: 240 GVIHKDLHISDLVTRTNEFVNDLTFIKYDKTVPVKIMEGSDVKFSYIPTDLEYVLQELLK 299
           GV+ K L+I++LV RT EFV DLTF+KYD+ VPV I+EG DV F+ IP DLEYVLQE+LK
Sbjct: 246 GVLDKRLNIAELVKRTEEFVGDLTFVKYDRIVPVNILEGHDVTFACIPQDLEYVLQEILK 305

Query: 300 NSSRAHIEN------NVDKDVEVTIVKNDDQLEIRIRDFGGGIDPQVEDRVFDYSFSTTV 353
           NS+RAHIEN      + +K +EVTIV++ + LEIRIRDFGGGI P VEDR+FDYS++T+ 
Sbjct: 306 NSARAHIENHTPSNYSAEKPIEVTIVRSYEDLEIRIRDFGGGIPPDVEDRMFDYSYTTSE 365

Query: 354 KEEKDSGMSDYVLPGQEVQNVAGMGFGLPMCKAYLELFNGTLDIQSLWGWGTDVYIRLHG 413
           K+ KD+GMS Y++PGQ+V NV+GMGFGLP+CKAY+E+FNG LDI SLWGWGTDVYIRL G
Sbjct: 366 KDAKDTGMSAYIIPGQDVSNVSGMGFGLPLCKAYVEMFNGELDIVSLWGWGTDVYIRLKG 425

Query: 414 P 414
           P
Sbjct: 426 P 426

>Sklu_2174.2 YIL042C, Contig c2174 576-1817 reverse complement
          Length = 413

 Score =  435 bits (1118), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 213/363 (58%), Positives = 271/363 (74%), Gaps = 8/363 (2%)

Query: 60  MTELNFQELYHIRSNIQHLIQDYSSYEIPKIDWAFLLQYRGPLQDNEKYFXXXXXXXXXX 119
           ++ L F++LY IRS+I+ LIQDY++  IP I + +L  Y+ PL DNEKY           
Sbjct: 45  LSGLGFEQLYQIRSSIELLIQDYANKPIPAISYEYLSMYKPPLTDNEKYVLVIKTVNLLL 104

Query: 120 XXXXXXXXXXQELP-YIALVNPNIEQSNRLYLKTLESLLSIEYPYDLYDTDKIQNLTEEF 178
                     Q+L  YIA+VNPN+E+SNRLYLKTLESLLSI++PY L+D + +     +F
Sbjct: 105 AYTCRRLAAIQKLSXYIAVVNPNVEESNRLYLKTLESLLSIDFPYGLHDQEAMVTKLTKF 164

Query: 179 LNDHQDTLLTLSNGLQEVSRFYDPENIFKFLNKHLHDRILMKLLTTNYLKLLEQTSSDE- 237
           L+DHQDTL+TLS G +EV  FY  E +F+FLN+HL DRI MKLL T+YL L++Q   +  
Sbjct: 165 LDDHQDTLITLSRGFEEVMEFYQQEAVFEFLNQHLRDRISMKLLVTHYLALVQQQDKNSP 224

Query: 238 VIGVIHKDLHISDLVTRTNEFVNDLTFIKYDKTVPVKIMEGSDVKFSYIPTDLEYVLQEL 297
            IGV+HK+L IS+L+ R  EFV DL F+KYD+ VPVKI+ G+DV F  IPTDLEYVL E+
Sbjct: 225 AIGVLHKNLKISELIHRVEEFVGDLCFVKYDRQVPVKILYGADVTFPCIPTDLEYVLTEI 284

Query: 298 LKNSSRAHIENNV------DKDVEVTIVKNDDQLEIRIRDFGGGIDPQVEDRVFDYSFST 351
           LKNSSRAHIEN+       +K +EVTIV++D  LEIRIRDFGGGI P+VEDR+F+YS+ST
Sbjct: 285 LKNSSRAHIENSTKERDLTEKPIEVTIVRSDCDLEIRIRDFGGGIPPEVEDRMFEYSYST 344

Query: 352 TVKEEKDSGMSDYVLPGQEVQNVAGMGFGLPMCKAYLELFNGTLDIQSLWGWGTDVYIRL 411
                KD+GMS YV+PG+EV NV+GMGFGLPMCKAYLE+F+G+LDIQSL+GWGTDVYI+L
Sbjct: 345 VQANTKDTGMSAYVIPGEEVNNVSGMGFGLPMCKAYLEMFDGSLDIQSLYGWGTDVYIKL 404

Query: 412 HGP 414
            GP
Sbjct: 405 KGP 407

>CAGL0L00869g complement(105236..106495) similar to sp|P40530
           Saccharomyces cerevisiae YIL042c, hypothetical start
          Length = 419

 Score =  392 bits (1006), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 200/368 (54%), Positives = 258/368 (70%), Gaps = 12/368 (3%)

Query: 60  MTELNFQELYHIRSNIQHLIQDYSSYEIPKIDWAFLLQYRGPLQDNEKYFXXXXXXXXXX 119
           +  L F + Y IRSNI+ LIQ+Y+S  IP + + +L  Y+ PL  NE+Y           
Sbjct: 42  LKHLEFDKHYKIRSNIELLIQEYASKPIPPLTYDYLTHYKPPLSANEEYMLTIKTINLLL 101

Query: 120 XXXXXXXXXXQELPYIALVNPNIEQSNRLYLKTLESLLSIEYPYDLYDTDKIQNLTEEFL 179
                     Q+LPY+A VNP+IE+S  LYLKTLESLLSIE+PY L+D D I  L  EFL
Sbjct: 102 SYTCRRLNAIQKLPYVAAVNPSIEKSYSLYLKTLESLLSIEFPYALHDKDIIHGLLIEFL 161

Query: 180 NDHQDTLLTLSNGLQEVSRFYDPENIFKFLNKHLHDRILMKLLTTNYLKLLEQT--SSDE 237
           +DHQDT+ TLS GL+E+  F + + IFKFL++HL DRI MK+L TN+L +      S   
Sbjct: 162 DDHQDTVETLSRGLEEIMDFLEKDTIFKFLDEHLRDRIAMKILATNHLAVSNHNRDSDPN 221

Query: 238 VIGVIHKDLHISDLVTRTNEFVNDLTFIKYDKTV-PVKIMEGSDVKFSYIPTDLEYVLQE 296
           +IG IHK L ++D+V + +EFV+DL F+KYD+ V PVKI  G DV F  IPT LEYVL E
Sbjct: 222 MIGTIHKALPVADMVKKVSEFVSDLCFVKYDQLVAPVKIYGGHDVTFPCIPTILEYVLTE 281

Query: 297 LLKNSSRAHIENN------VDKDVEVTIVKN---DDQLEIRIRDFGGGIDPQVEDRVFDY 347
           +LKNS RAHIEN       V+K VEV IVK+   D++LEIRIRDFGGGI P VE  +F+Y
Sbjct: 282 ILKNSYRAHIENTTSHNCLVEKPVEVQIVKDEKYDEELEIRIRDFGGGIPPNVESHIFEY 341

Query: 348 SFSTTVKEEKDSGMSDYVLPGQEVQNVAGMGFGLPMCKAYLELFNGTLDIQSLWGWGTDV 407
           S++T   ++K+SG S YV+PG+++  V+GMGFGLPMCKAY+E+F+G LDIQSLWGWGTDV
Sbjct: 342 SYTTVESDKKESGASAYVIPGEDINIVSGMGFGLPMCKAYIEMFDGKLDIQSLWGWGTDV 401

Query: 408 YIRLHGPS 415
           YI+L GP+
Sbjct: 402 YIKLKGPT 409

>YIL042C (YIL042C) [2625] chr9 complement(275107..276291) Protein
           with similarity to mitochondrial branched chain
           alpha-ketoacid and pyruvate dehydrogenase protein
           kinases [1185 bp, 394 aa]
          Length = 394

 Score =  328 bits (841), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 167/363 (46%), Positives = 242/363 (66%), Gaps = 9/363 (2%)

Query: 60  MTELNFQELYHIRSNIQHLIQDYSSYEIPKIDWAFLLQYRGPLQDNEKYFXXXXXXXXXX 119
           +++L+F + Y IRSNI+ LIQDY+S  I  +++ + LQYR PL   E+Y           
Sbjct: 26  LSQLSFDQHYKIRSNIELLIQDYASKPIAPLNYEYFLQYRPPLTKKEEYMLTIKTINLLL 85

Query: 120 XXXXXXXXXXQELPYIALVNPNIEQSNRLYLKTLESLLSIEYPYDLYDTDKIQNLTEEFL 179
                     Q LPY A++NP+IE++N LYLK+L++LLSI YPY+L++  KIQ    E L
Sbjct: 86  SLTCKRLNAIQRLPYNAVINPHIERTNSLYLKSLQTLLSIAYPYELHNPPKIQAKFTELL 145

Query: 180 NDHQDTLLTLSNGLQEVSRFYDPENIFKFLNKHLHDRILMKLLTTNYLKLLEQTSSD--- 236
           +DH+D ++ L+ GLQE+   Y    I +FLN HL +RI MKLL T+YL L+ Q   D   
Sbjct: 146 DDHEDAIVVLAKGLQEIQSCYPKFQISQFLNFHLKERITMKLLVTHYLSLMAQNKGDTNK 205

Query: 237 EVIGVIHKDLHISDLVTRTNEFVNDLTFIKYD-KTVPVKIMEGS-DVKFSYIPTDLEYVL 294
            +IG++H+DL I+ L+   +++VND+ F+K++ +  PV I   S D+ F+ IP  LEY++
Sbjct: 206 RMIGILHRDLPIAQLIKHVSDYVNDICFVKFNTQRTPVLIHPPSQDITFTCIPPILEYIM 265

Query: 295 QELLKNSSRAHIENNVDK-DVEVTIVK-NDDQLEIRIRDFGGGIDPQVEDRVFDYSFSTT 352
            E+ KN+  A I    +   +E+ ++K +DD+L +RIRD GGGI P+VE  +F+YS+ST 
Sbjct: 266 TEVFKNAFEAQIALGKEHMPIEINLLKPDDDELYLRIRDHGGGITPEVEALMFNYSYSTH 325

Query: 353 VKEEKDSGMSDYVLPGQEVQNVAGMGFGLPMCKAYLELFNGTLDIQSLWGWGTDVYIRLH 412
            ++  DS  +D  LPG+++ NV+GMGFGLPMCK YLELF G +D+QSL GWGTDVYI+L 
Sbjct: 326 TQQSADSESTD--LPGEQINNVSGMGFGLPMCKTYLELFGGKIDVQSLLGWGTDVYIKLK 383

Query: 413 GPS 415
           GPS
Sbjct: 384 GPS 386

>Scas_704.44
          Length = 443

 Score =  325 bits (832), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 175/390 (44%), Positives = 241/390 (61%), Gaps = 35/390 (8%)

Query: 60  MTELNFQELYHIRSNIQHLIQDYSSYEIPKIDWAFLLQYRGPLQDNEKYFXXXXXXXXXX 119
           ++ L+FQ  Y IRSNI+ LIQDYS   IP + + FL +Y+ PL   EKY           
Sbjct: 47  LSHLDFQAYYKIRSNIELLIQDYSRKPIPPLSYKFLTEYQKPLSQTEKYNLAIKTINQLI 106

Query: 120 XXXXXXXXXXQELPYIALVNPNIEQSNRLYLKTLESLLSIEYPYDLYDTDKIQNLTEEFL 179
                     Q LPYI L+NP I Q N LYLKTLESLLSI +PYDLY  D I +L     
Sbjct: 107 SLTCRQLSLIQNLPYIVLLNPKINQINSLYLKTLESLLSITFPYDLYKNDLILSLLNHLN 166

Query: 180 NDHQDTLLTLSNGLQEV-SRFYDPENIFKFLNKHLHDRILMKLLTTNYLKLLEQTSSDEV 238
            +H DTLL LS+GL+E+ +     E I KFL+ H+ DRI MKL+  N+L LL   +  ++
Sbjct: 167 EEHNDTLLVLSDGLKEINNELLSNEAISKFLDVHIRDRITMKLIILNHLALLSPKTEPDM 226

Query: 239 IGVIHKDLHISDLVTRTNEFVNDLTFIKYD-------KTVPVKIMEGSDVKFSYIPTDLE 291
           IG+IHK + IS  + +T EFVNDL  +K++        +  +  + G +++F  IP  LE
Sbjct: 227 IGIIHKRVKISQFINQTFEFVNDLCQLKFNLPMSTTGNSSMITYITGEEIEFPCIPVILE 286

Query: 292 YVLQELLKNSSRAHIENNVDKDVEVTIVKND-DQLEIRIRDFGGGIDPQVEDRVFDYSFS 350
           YVL E+LKNS +AHIEN+V K +E++I + D D+L +RIRD+GGGIDP++E ++F YSFS
Sbjct: 287 YVLTEILKNSMKAHIENDVTKPIEISIFETDSDELTVRIRDYGGGIDPKIEPKIFQYSFS 346

Query: 351 TTVKE-----------------------EKDSGMSDYVLPGQEVQN--VAGMGFGLPMCK 385
           TT+                         + DS +   ++PG EV+N  ++GMG+GLP+CK
Sbjct: 347 TTLDSTFSKIHEENNGNQRETDSVIGSCQNDSSVPQLMMPG-EVENNTISGMGYGLPLCK 405

Query: 386 AYLELFNGTLDIQSLWGWGTDVYIRLHGPS 415
            YLELF+G + IQ+LWG GTDVYI++ GP+
Sbjct: 406 NYLELFDGDITIQNLWGLGTDVYIKVKGPN 435

>AER270W [2772] [Homologous to NOHBY] complement(1131292..1132761)
           [1470 bp, 489 aa]
          Length = 489

 Score = 97.4 bits (241), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 79/278 (28%), Positives = 136/278 (48%), Gaps = 50/278 (17%)

Query: 182 HQDTLLTLSNGLQEVSRFYD----PENIFKFLNKHLHDRILMKLLTTNYLKLLEQT---- 233
           H  T++TL+ GL    R         +I  +L++    RI +++L   +L LLEQ     
Sbjct: 205 HDATVVTLARGLLRWKRTQKNNVVDASIKGYLDRFYMGRIGIRMLIGQHLSLLEQAMHSD 264

Query: 234 -SSDEVIGVIHKDL-HISDLVTRTNEFVNDLTFIKYDK--------------------TV 271
            + + V G +  D  ++  + TRT   V  +  I  D+                    T+
Sbjct: 265 LACEHVPGAVGSDADYVGIVCTRTK--VAQVADIAIDRARHICAEYYNLYEAPKVELHTI 322

Query: 272 PVKIMEGS---DVKFSYIPTDLEYVLQELLKNSSRAHIENNVDKD-------------VE 315
           P+K  + S   +++F+Y+P+ L ++L E+LKN+ RA +E+ + K+             V+
Sbjct: 323 PIKRDDSSGLREIEFTYVPSHLVHMLFEVLKNALRATVESTIQKNPGVTDYDSLRFPPVK 382

Query: 316 VTIVKNDDQLEIRIRDFGGGIDPQVEDRVFDYSFSTTVKEEKDSGM-SDYVLPGQEVQNV 374
           V I +  ++L ++I D GGGI       V+ Y ++T   +E+DS +  D  L G     +
Sbjct: 383 VIISEGTEELAVKISDEGGGIARSNLPLVWTYLYTTMTDDEQDSLIDGDSTLSGS-CPPM 441

Query: 375 AGMGFGLPMCKAYLELFNGTLDIQSLWGWGTDVYIRLH 412
           AG G+GL + + Y   F G L + S+ G+GTDVY+ L+
Sbjct: 442 AGYGYGLALSRLYARHFGGDLRLLSMDGYGTDVYLHLN 479

>KLLA0F27423g complement(2537353..2538891) similar to
           ca|CA5524|IPF2861 Candida albicans putative pyruvate
           dehydrogenase kinase, hypothetical start
          Length = 512

 Score = 85.5 bits (210), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 74/288 (25%), Positives = 128/288 (44%), Gaps = 51/288 (17%)

Query: 171 IQNLTEEFLNDHQDTLLTLSNGLQEVSRFYDP----ENIFKFLNKHLHDRILMKLLTTNY 226
           +QN+ E     H  T++TL+ G+ +  + +      ++I  FL++    RI +++L    
Sbjct: 220 LQNIKER----HDATVITLAKGVLKWKKTHQQNVVDDSIQSFLDRFYLSRIGIRMLIGQQ 275

Query: 227 LKLLEQTSS----------DEVIGVIHKDLHISDLVTRTNEFVNDLTFIKYDKTVPVKIM 276
           L LLE              ++ +G+I    +I+ L     +    +    Y      K+ 
Sbjct: 276 LALLESARQPAEGPFDEDDEDWVGIICTKTNITQLSKTAIDNARHICAEHYGLYEAPKVQ 335

Query: 277 --------------------EGSDVKFSYIPTDLEYVLQELLKNSSRAHIENNVDK---- 312
                               E  D++F Y+P  L ++L E LKN+ RA +E  ++K    
Sbjct: 336 LLTFPLDYRPSTEEKSGCPNESPDIEFMYVPGHLIHMLFETLKNALRATVEKTIEKNPSV 395

Query: 313 --------DVEVTIVKNDDQLEIRIRDFGGGIDPQVEDRVFDYSFSTTVKEEKDSGMSDY 364
                   DV+V I +  + L ++I D GGGI       V+ Y + TT+ E +  G+ D 
Sbjct: 396 DKYDLKFPDVKVIITEGTEDLTVKISDEGGGIARSNLPLVWTYLY-TTMPENEQIGLMDE 454

Query: 365 VLPGQEVQNVAGMGFGLPMCKAYLELFNGTLDIQSLWGWGTDVYIRLH 412
            +       +AG G+GL + + Y   F G L + S+ G+GTDVY+ L+
Sbjct: 455 EMSQNFRIPMAGYGYGLALSRLYARYFGGDLKLMSMEGFGTDVYLHLN 502

>CAGL0F07007g 687174..688631 highly similar to sp|P53170
           Saccharomyces cerevisiae YGL059w, hypothetical start
          Length = 485

 Score = 74.3 bits (181), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 83/354 (23%), Positives = 144/354 (40%), Gaps = 77/354 (21%)

Query: 130 QELPYIALVNPNIEQSNRLYLKTLESLLSIEYPYDLYDTDKIQNLTEEFLNDHQD-TLLT 188
           Q LP+  + N +  Q    Y    E          L D+ +      + L D     L  
Sbjct: 122 QLLPFNVINNFHFVQVYESYYNIFERFRKFPAVRTLDDSIRFTKFARDILKDFNTLNLPH 181

Query: 189 LSNGLQEVSRF--YDPENIFKFLNKHLHDRILMKLLTTNYLKLLEQTSSDE-----VIGV 241
           L  G  E +    Y  + + K L+  L  RI  +L+   ++ + +   S +     V+G 
Sbjct: 182 LIMGALECTTLDLYPTDKMDKLLSDLLRARISRRLIVEEHISIADNYFSGKKKNTLVLGD 241

Query: 242 IHKDL----HISDLVTRTNEFVNDLTFIKYDKTVPV---KIMEGSDVKFSYIPTDLEYVL 294
           I ++     HI        +F+ D+ F    +++P+   KI   +D+KF ++P+ L+Y+L
Sbjct: 242 IFQECSAKEHILGASKICEKFIQDMYF----ESIPMPELKINGETDLKFYFLPSHLKYLL 297

Query: 295 QELLKNSSRAHIENNVDKD------VEVTIVKNDDQLEIRIRDFGGGIDPQVEDRVFDYS 348
            E+L+N+  A I++ + K       + +TI+KN++    RI D  GG+    +D    +S
Sbjct: 298 GEILRNTYEATIKDYIRKGLPKPEPIVITIIKNEESYLFRICDRAGGLAHHHDDNNI-WS 356

Query: 349 FSTTVKEEKDSGMSDYVLPGQEV------------------------------QNVAG-- 376
           F  T ++   S  + + LPG +                                N+A   
Sbjct: 357 FGKTKEQAAQSISNFHKLPGLQTVSLYDHLYNNTEDRQVNRAYINTSLEPMAHSNIASAV 416

Query: 377 -------------------MGFGLPMCKAYLELFNGTLDIQSLWGWGTDVYIRL 411
                              +G GL MCK Y E +NG L + S+ G+GTD  ++L
Sbjct: 417 ATGYEVPLLKLLKRSFRYKLGIGLAMCKVYAEYWNGDLTLHSIHGFGTDTVLKL 470

>Kwal_14.1825
          Length = 492

 Score = 71.6 bits (174), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 85/350 (24%), Positives = 141/350 (40%), Gaps = 72/350 (20%)

Query: 130 QELPYIALVNPNIEQSNRLYLKTLESLLSIEYPYDLYDTDKIQNLTEEFLNDHQD-TLLT 188
           Q LP+  + N +  Q    Y    E          L D ++        L+D     L  
Sbjct: 132 QTLPFNVVNNFHFSQVYESYYNIFERFRRYPSIKTLEDNERFAKFLHTILSDFNSLNLPH 191

Query: 189 LSNGLQEVSRFYD---PENIFKFLNKHLHDRILMKLLTTNYLKLLEQTSSDE-----VIG 240
           L  G  E  R  D   PE + + ++  L  RI  +L+   +L +     S +     V+G
Sbjct: 192 LIMGALEC-RILDLCPPEKMDEVISSLLRARISRRLIVEEHLSITSNYHSGKKENTLVLG 250

Query: 241 VIHKDLHISDLV----TRTNEFVNDLTFIKYDKTVPVKIMEG-SDVKFSYIPTDLEYVLQ 295
            I ++    + +    +   +F+ D+ ++     +P  I++G +D+KF ++P  L+Y+L 
Sbjct: 251 DIFQECSAREFLLGAKSMCEKFIQDMYYVGIK--LPEFIIDGKTDLKFYFLPLHLKYLLG 308

Query: 296 ELLKNSSRAHIENNVD---KDVE---VTIVKNDDQLEIRIRDFGGGIDPQVEDRVFDYSF 349
           E+L+NS  A ++  +    KD E   VT+V N+     RI D  GGI P  E  ++ +  
Sbjct: 309 EVLRNSYEATMQEYIRLGLKDPEPITVTVVSNESSFIFRISDRAGGI-PHDEKTIWSFGK 367

Query: 350 STTVKEEKDS-----------GMSDYVL---PGQ-------------------------- 369
           S  +  +  S            + D+V    PG                           
Sbjct: 368 SKELARKSLSNFHKLPGLQTVSLYDHVTDHHPGHSSTFPYKFTSLEPINASNLPTGLHKF 427

Query: 370 --------EVQNVAGMGFGLPMCKAYLELFNGTLDIQSLWGWGTDVYIRL 411
                   E  +   +G GL MCK Y E +NG L + SL G+GTD  ++L
Sbjct: 428 EKPLLGLLERSSRYKLGIGLAMCKVYAEYWNGDLTVHSLQGYGTDTVLKL 477

>AAR157C [345] [Homologous to ScYGL059W - SH] (627130..628641) [1512
           bp, 503 aa]
          Length = 503

 Score = 65.5 bits (158), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 73/352 (20%), Positives = 138/352 (39%), Gaps = 73/352 (20%)

Query: 130 QELPYIALVNPNIEQSNRLYLKTLESLLSIEYPYDLYDTDKIQNLTEEFLNDHQD-TLLT 188
           Q+LP+  + N +  Q    Y    E          L D ++   L  + ++D     L  
Sbjct: 140 QDLPFNVVNNFHFVQVYESYYNIFERFRRFPAIRTLEDNERFAELLHQIMSDFNSLNLPH 199

Query: 189 LSNGLQE--VSRFYDPENIFKFLNKHLHDRILMKLLTTNYLKLLEQTSSDE-----VIGV 241
           L  G  E  +   Y  + + + ++  L  RI  +L+   +L +     S +     V+G 
Sbjct: 200 LIMGALESCILDLYPQDAMDRLMSSFLRARISRRLIVEEHLSVTSNYMSGKSENTLVLGD 259

Query: 242 IHKDLHISDLVTRTNEFVNDLTFIKYDKTVPVK--IMEG-SDVKFSYIPTDLEYVLQELL 298
           I ++    + +        +     +   +P+   I++G +D++F ++P+ L Y+  E L
Sbjct: 260 IFQECSAREYLLHAARICENAIRDMFYPDIPLPDFIIDGCADLRFYFLPSQLHYLFGETL 319

Query: 299 KNSSRAHIENNVDKD------VEVTIVKNDDQLEIRIRDFGGGIDPQVEDRVFDYSFSTT 352
           +NS  A ++  + +       + VT+V+N +    RI D GGGI P  +  ++ +  S  
Sbjct: 320 RNSYEATVKEAIRRGLPKPDPITVTVVQNPESYLFRISDRGGGI-PHPDRTIWSFGKSKL 378

Query: 353 VKEEKDSGMSDYVLPGQE--------------------------VQNVA----------- 375
           + ++       + LPG +                          +Q++A           
Sbjct: 379 LAQQALDNF--HKLPGAQTVSLYDHMYDADARRVAAACKLSNTSLQSMAETNLTKGRYKF 436

Query: 376 ----------------GMGFGLPMCKAYLELFNGTLDIQSLWGWGTDVYIRL 411
                            +G GL MCK Y E +NG L + S+ G GTD  ++L
Sbjct: 437 DFPRPLVGLLERPFRYKLGIGLAMCKVYAEYWNGDLTVHSIHGHGTDTVLKL 488

>KLLA0C05654g complement(504568..505989) similar to sp|P53170
           Saccharomyces cerevisiae YGL059w, start by similarity
          Length = 473

 Score = 63.9 bits (154), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 57/248 (22%), Positives = 110/248 (44%), Gaps = 65/248 (26%)

Query: 222 LTTNYLKLLEQTSSDEVIGVIHKDLHISDLVTRTNE----FVNDLTFIKYDKTVPVKIME 277
           +T+NYL   ++ +   V+G I +  +  + +    E    ++N++ F      +P  I+ 
Sbjct: 218 ITSNYLSGKKENTL--VLGDIFQKCNAKEYLNGAREVCEAYINNMYFAGI--KMPELIIN 273

Query: 278 G-SDVKFSYIPTDLEYVLQELLKNSSRAHIENNVDKDVE------VTIVKNDDQLEIRIR 330
           G ++++F ++P+ L+++L E+L+NS    ++  +   +E      VTI+ ND     RI 
Sbjct: 274 GDTELEFYFLPSHLKFLLGEILRNSYEVTVKETIRLGLEKAPPVTVTIISNDQSYLFRIS 333

Query: 331 DFGGGIDPQVEDRVFDYSFSTTVKEEKDSGMSDYVLPGQEVQNV---------------- 374
           D GGG+ P  + ++  +SF  + +  K S  + + LPG +  ++                
Sbjct: 334 DRGGGV-PHSDKQI--WSFGKSKELAKQSLDNFHHLPGLQTLSLYDSSNGAHLKSDRYRQ 390

Query: 375 -------------------------------AGMGFGLPMCKAYLELFNGTLDIQSLWGW 403
                                            +G GL +CK Y E +NG L + S+ G+
Sbjct: 391 TSLDRMSENNLTKGKFKVGQPLMELLKRSPRYKLGIGLALCKVYAEYWNGDLTVHSIQGY 450

Query: 404 GTDVYIRL 411
           GTD  ++L
Sbjct: 451 GTDTVLKL 458

>Scas_563.9
          Length = 492

 Score = 61.2 bits (147), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 87/357 (24%), Positives = 135/357 (37%), Gaps = 80/357 (22%)

Query: 130 QELPYIALVNPNIEQSNRLYLKTLESLLSIEYPYDLYDTDKIQNLTEEFLNDHQD-TLLT 188
           Q+LP+  + N +  Q    Y    E          + D  +    T   L D     L  
Sbjct: 126 QQLPFNVVNNFHFVQVYESYYNIFERFRKFPRIKTIEDNSRFVEFTRRILQDFNSLNLPH 185

Query: 189 LSNGLQEVS--RFYDPENIFKFLNKHLHDRILMKLLTTNYLKLLEQTSSDE-----VIGV 241
           L  G  E +       + I   L+  L  RI  +L+   +L +     S +     V+G 
Sbjct: 186 LVMGALECNILELLPRDEIDALLSSLLRARISRRLIVEEHLSISANYLSGKKENTLVLGD 245

Query: 242 IHKDLHISDL---VTRTNE-FVNDLTFIKYDKTVPVKIMEG-SDVKFSYIPTDLEYVLQE 296
           I ++    D     +RT E FV  + F   D  +P  I+EG  D+ F ++PT L+Y+L E
Sbjct: 246 IFQECQALDYFMEASRTCEKFVKAMYFD--DIPIPELIIEGQKDLTFYFLPTHLQYILGE 303

Query: 297 LLKNSSRAHIENNVDKDVE------VTIVKNDDQLEIRIRDFGGGIDPQVEDRVFDYSFS 350
           +L+N   A I++ + K +       +TIVKND     R  D  GGI    ED    +SF 
Sbjct: 304 ILRNIYEATIKDYIRKGLAKPEPIVITIVKNDSSFIFRFSDKAGGILHHEED---IWSFG 360

Query: 351 TTVKEEKDSGMSDYVLPGQEV----------------------------QNVAGMG---- 378
            + +   +S  + + LPG +                              ++  MG    
Sbjct: 361 KSKERAAESLNNFHKLPGLQTVSLYDHLYNGEEHDMNTRTLMANRPYMHTSLEAMGHSNL 420

Query: 379 ------FGLP------------------MCKAYLELFNGTLDIQSLWGWGTDVYIRL 411
                 F +P                  MCK Y E +NG L + ++ G GTD  + L
Sbjct: 421 KKGPYKFEMPLIEMLERAPRYKLGIGLAMCKIYAEYWNGDLSLTTIPGHGTDTVLTL 477

>Sklu_2299.6 YGL059W, Contig c2299 10909-12501 reverse complement
          Length = 530

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 64/258 (24%), Positives = 116/258 (44%), Gaps = 24/258 (9%)

Query: 130 QELPYIALVNPNIEQSNRLYLKTLESLLSIEYPYDLYDTDKIQNLTEEFLNDHQD-TLLT 188
           Q LP+  + N +  Q    Y    E      +  ++ D  K      + L+D     L  
Sbjct: 160 QNLPFNVVNNFHFVQVYESYYNIFERFRKFPHIKNIEDNYKFAEFLYQILSDFNSLNLPH 219

Query: 189 LSNGLQE--VSRFYDPENIFKFLNKHLHDRILMKLLTTNYLKLLEQTSSDE-----VIGV 241
           L  G  E  +   Y  E + + ++  L  RI  +L+   +L +    +S +     V+G 
Sbjct: 220 LIMGALECRILDLYKQEQMDELISTLLRARISRRLIVEEHLSITSNFASGKKENTLVLGD 279

Query: 242 IHKDLHISDLVTRTNE----FVNDLTFIKYDKTVPVKIMEG-SDVKFSYIPTDLEYVLQE 296
           I ++    D +   ++    F+ D+ F      +P  +++G +D+KF ++P+ L+Y+L E
Sbjct: 280 IFQECCARDYLLEASQMCEAFIKDMFFDGI--PLPKFVIDGDTDLKFYFLPSHLKYLLGE 337

Query: 297 LLKNSSRAHIENNV------DKDVEVTIVKNDDQLEIRIRDFGGGIDPQVEDRVFDYSFS 350
            L+NS  A ++  +         + VTI+ N+     RI D GGGI P  +  +  +SF 
Sbjct: 338 TLRNSYEATVKEYIRLGLDNPHPITVTIISNNHSFLFRISDRGGGI-PHDDKTI--WSFG 394

Query: 351 TTVKEEKDSGMSDYVLPG 368
            + K  K+S  + + LPG
Sbjct: 395 KSKKLAKESLDNFHKLPG 412

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 24/35 (68%)

Query: 377 MGFGLPMCKAYLELFNGTLDIQSLWGWGTDVYIRL 411
           +G GL +CK Y E +NG L + S+ G+GTD  ++L
Sbjct: 481 LGIGLAVCKVYAEYWNGDLTVHSIHGYGTDTVLKL 515

>YGL059W (YGL059W) [1920] chr7 (392226..393701) Protein with
           similarity to human branched-chain alpha-ketoacid
           dehydrogenase kinase, transcription is induced by the
           drug FK506 in a GCN4-dependent manner [1476 bp, 491 aa]
          Length = 491

 Score = 55.8 bits (133), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 71/269 (26%), Positives = 123/269 (45%), Gaps = 34/269 (12%)

Query: 130 QELPYIALVNPNIEQSNRLYLKTLESLLSIEYPYDLYDT----DKIQNLTEEFLNDHQDT 185
           Q+LP+  + N +  Q    Y    ES         L D     D I+N+ E F   +   
Sbjct: 123 QQLPFNVVNNFHFVQVYESYYNIFESFRKYPTIRTLEDASQFADFIKNMLEGF---NTLN 179

Query: 186 LLTLSNGLQEVS--RFYDPENIFKFLNKHLHDRILMKLL-------TTNYLKLLEQTSSD 236
           L  L  G  E +    Y  E + + L+  L  RI  +L+       T NY    E+ +  
Sbjct: 180 LPHLIMGALECTILDLYPREKMDQLLSDLLRARISRRLIVEEHVVYTANYTSGKEENTL- 238

Query: 237 EVIGVIHKDLHISDLVTRTNE----FVNDLTFIKYDKTVPVKIMEG-SDVKFSYIPTDLE 291
            V+G I ++      +   +E    F+ D+ F   D  +P  I+EG + + F ++PT L+
Sbjct: 239 -VLGDIFQECSAKKYLLEASEESQKFIQDMYF--KDIPMPEFIIEGDTQLSFYFLPTHLK 295

Query: 292 YVLQELLKNSSRAHIENNVDKDVE------VTIVKNDDQLEIRIRDFGGGIDPQVEDRVF 345
           Y+L E+L+N+  A +++ + K +E      VT+V ND+    RI D  GG+   + D   
Sbjct: 296 YLLGEILRNTYEATMKHYIRKGLEKPEPIIVTVVSNDESYLFRISDKAGGV---LHDDEN 352

Query: 346 DYSFSTTVKEEKDSGMSDYVLPGQEVQNV 374
            +SF  + +  ++S  + + LPG +  ++
Sbjct: 353 LWSFGKSKERAQESLNNFHKLPGLQTVSI 381

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 25/35 (71%)

Query: 377 MGFGLPMCKAYLELFNGTLDIQSLWGWGTDVYIRL 411
           +G GL MCK Y E +NG L + S+ G+GTDV ++L
Sbjct: 442 LGIGLAMCKVYAEYWNGDLSLHSMPGYGTDVVLKL 476

>Scas_698.14
          Length = 1183

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 37/81 (45%), Gaps = 15/81 (18%)

Query: 325 LEIRIRDFGGGIDPQVEDRVFDYSFSTTVKEEKDSGMSDYVLPGQEVQNVAGMGFGLPMC 384
           + I ++D G GIDP ++  VF+                D  L  Q      G G GL +C
Sbjct: 839 IAIEVQDTGPGIDPSLQKSVFEPFV-----------QGDQTLSRQ----YGGTGLGLSIC 883

Query: 385 KAYLELFNGTLDIQSLWGWGT 405
           +    + NGT++++S  G G+
Sbjct: 884 RQLANMMNGTMELKSEVGVGS 904

>YIL147C (SLN1) [2530] chr9 complement(69791..73453) Two-component
           signal transducer involved in the osmotic stress signal
           transduction pathway that initiates a phosphorelay from
           Sln1p to Ypd1p to the response regulators Ssk1p and
           Skn7p [3663 bp, 1220 aa]
          Length = 1220

 Score = 38.5 bits (88), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 37/81 (45%), Gaps = 15/81 (18%)

Query: 325 LEIRIRDFGGGIDPQVEDRVFDYSFSTTVKEEKDSGMSDYVLPGQEVQNVAGMGFGLPMC 384
           + I + D G GIDP +++ VF + F             D  L  Q      G G GL +C
Sbjct: 853 ISIEVEDTGPGIDPSLQESVF-HPFV----------QGDQTLSRQ----YGGTGLGLSIC 897

Query: 385 KAYLELFNGTLDIQSLWGWGT 405
           +    + +GT+ ++S  G G+
Sbjct: 898 RQLANMMHGTMKLESKVGVGS 918

>KLLA0A00638g complement(60378..63845) gi|5531277|emb|CAB50891.1
           Kluyveromyces lactis SLN1 homologue, start by similarity
          Length = 1155

 Score = 38.1 bits (87), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 37/82 (45%), Gaps = 17/82 (20%)

Query: 325 LEIRIRDFGGGIDPQVEDRVFDYSFSTTVKEEKDSGMSDYVLPGQEV-QNVAGMGFGLPM 383
           + + + D G GIDP +++ VF+                 +V   Q + +   G G GL +
Sbjct: 849 ISMEVEDTGSGIDPSLQESVFE----------------PFVQGDQTLSRQYGGTGLGLSI 892

Query: 384 CKAYLELFNGTLDIQSLWGWGT 405
           C+   ++  GT+ + S  G G+
Sbjct: 893 CRQLAKMMKGTMKLDSKVGVGS 914

>CAGL0H06567g 645707..649216 similar to sp|P39928 Saccharomyces
           cerevisiae YIL147c SLN1, hypothetical start
          Length = 1169

 Score = 37.7 bits (86), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 37/80 (46%), Gaps = 17/80 (21%)

Query: 327 IRIRDFGGGIDPQVEDRVFDYSFSTTVKEEKDSGMSDYVLPGQEV-QNVAGMGFGLPMCK 385
           I + D G GIDP++ + VF+                 +V   Q + +   G G GL +C+
Sbjct: 806 IEVEDTGPGIDPKLHESVFE----------------PFVQGDQTLSRQYGGTGLGLSICR 849

Query: 386 AYLELFNGTLDIQSLWGWGT 405
               + +GT+ ++S  G G+
Sbjct: 850 QLATMMHGTMKLESKVGVGS 869

>AFR284W [3476] [Homologous to ScYIL147C (SLN1) - SH]
           complement(947124..950435) [3312 bp, 1103 aa]
          Length = 1103

 Score = 36.2 bits (82), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 34/79 (43%), Gaps = 15/79 (18%)

Query: 327 IRIRDFGGGIDPQVEDRVFDYSFSTTVKEEKDSGMSDYVLPGQEVQNVAGMGFGLPMCKA 386
           I ++D G GI+P + + VF           K     D  L  Q      G G GL +C+ 
Sbjct: 803 IEVQDTGPGIEPSLHESVF-----------KPFVQGDQTLSRQ----YGGTGLGLSICRQ 847

Query: 387 YLELFNGTLDIQSLWGWGT 405
              +  GT+ ++S  G G+
Sbjct: 848 LATMMKGTMKLESKVGSGS 866

>Kwal_55.19707
          Length = 1143

 Score = 35.0 bits (79), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 34/81 (41%), Gaps = 15/81 (18%)

Query: 325 LEIRIRDFGGGIDPQVEDRVFDYSFSTTVKEEKDSGMSDYVLPGQEVQNVAGMGFGLPMC 384
           + + + D G GIDP + + VF+                D  L  Q      G G GL +C
Sbjct: 825 ISMEVHDTGPGIDPALHESVFEPFV-----------QGDQTLSRQ----YGGTGLGLSIC 869

Query: 385 KAYLELFNGTLDIQSLWGWGT 405
           +    + +GT+ + S  G G+
Sbjct: 870 RQLATMMHGTMKLDSQVGVGS 890

>Scas_599.10
          Length = 551

 Score = 32.3 bits (72), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 38/74 (51%), Gaps = 2/74 (2%)

Query: 303 RAHIENNVDKDVEVTIVKNDDQLEIRIRDFGGGIDPQVEDRVFDYSFSTTVKEEKDSGMS 362
           R  ++N  +    +  +K + + +IRI + GG I P +E R +D +   TVK     G+ 
Sbjct: 247 RIELKNLPNTSSIIHAIKFEYERQIRIIETGGTI-PSMETRGWDANKMETVKLRSKEGIM 305

Query: 363 DY-VLPGQEVQNVA 375
           DY  +P  E+ NV 
Sbjct: 306 DYRYMPDPELPNVT 319

>YIL061C (SNP1) [2610] chr9 complement(244654..245556) U1
           snRNA-associated protein with RNA recognition (RRM)
           domain, homologous to human 70 kDa U1 snRNP protein [903
           bp, 300 aa]
          Length = 300

 Score = 30.4 bits (67), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 13/55 (23%), Positives = 34/55 (61%), Gaps = 2/55 (3%)

Query: 288 TDLEYVLQELLKNSSRAHIENNVDKDVEVTIVKNDDQLEIRIRDFGGGIDPQVED 342
           T L++ ++E  + S   H++    +D++++ +KN   L+ R++++   +DP ++D
Sbjct: 50  TSLKHYMEEFPEGSPNNHLQRY--EDIKLSKIKNAQLLDRRLQNWNPNVDPHIKD 102

>YMR265C (YMR265C) [4219] chr13 complement(796539..797924) Protein
           of unknown function [1386 bp, 461 aa]
          Length = 461

 Score = 30.4 bits (67), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 25/55 (45%), Gaps = 3/55 (5%)

Query: 238 VIGVIHKDLHISDLVTRTNEFVN---DLTFIKYDKTVPVKIMEGSDVKFSYIPTD 289
           V G  +K   I DL   T   +N   D+ ++  D T+P+K   G   K + IP  
Sbjct: 405 VTGHFYKRDRIEDLEVVTERLINCKEDIHWVPLDNTIPIKAFFGRFAKLAAIPCS 459

>YLR265C (NEJ1) [3659] chr12 complement(674429..675457) Protein
           involved in nonhomologous end-joining (NHEJ) pathway for
           repair of DNA double-strand breaks [1029 bp, 342 aa]
          Length = 342

 Score = 30.0 bits (66), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 17/24 (70%)

Query: 176 EEFLNDHQDTLLTLSNGLQEVSRF 199
           +EFL D   TLL+L N  Q+VSRF
Sbjct: 218 QEFLADSLKTLLSLRNKFQDVSRF 241

>YIL126W (STH1) [2550] chr9 (117992..122071) Component of abundant
           chromatin remodeling complex (RSC), involved in the
           response to DNA damage, DNA helicase of the Snf2p
           family, has a bromodomain [4080 bp, 1359 aa]
          Length = 1359

 Score = 29.6 bits (65), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 10/57 (17%)

Query: 226 YLKLLEQTSSDEVIGVIHKDLHISDLVTRTNEFVNDLTFIKYDKTVPVKIMEGSDVK 282
           YLKLL+QT          KD  I+ L+ +TN F++ L+     +    KI+ G +V+
Sbjct: 389 YLKLLDQT----------KDTRITQLLRQTNSFLDSLSEAVRAQQNEAKILHGEEVQ 435

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.138    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,416,382
Number of extensions: 595475
Number of successful extensions: 2087
Number of sequences better than 10.0: 60
Number of HSP's gapped: 2082
Number of HSP's successfully gapped: 67
Length of query: 415
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 311
Effective length of database: 12,995,837
Effective search space: 4041705307
Effective search space used: 4041705307
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 63 (28.9 bits)