Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0E04411g60059128430.0
Sklu_2174.463261218600.0
Kwal_47.1814562459318260.0
YER049W64460617930.0
ADL114C61460117580.0
CAGL0J02816g62561216400.0
Scas_715.28*63260915470.0
Sklu_1817.3398124790.14
Scas_699.28*10669710.34
Sklu_932.110660671.1
Sklu_2339.2196654721.3
Kwal_47.1825210559652.0
CAGL0E00429g388129702.0
Kwal_55.196971760125702.5
KLLA0E09482g63557674.8
Scas_607.241762649.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E04411g
         (591 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E04411g 404611..406413 similar to sp|P40032 Saccharomyces c...  1099   0.0  
Sklu_2174.4 YER049W, Contig c2174 3142-5040 reverse complement        721   0.0  
Kwal_47.18145                                                         707   0.0  
YER049W (YER049W) [1477] chr5 (251727..253661) Component of NuA3...   695   0.0  
ADL114C [1627] [Homologous to ScYER049W - SH] (484310..486154) [...   681   0.0  
CAGL0J02816g 272944..274821 highly similar to sp|P40032 Saccharo...   636   0.0  
Scas_715.28*                                                          600   0.0  
Sklu_1817.3 YCR094W, Contig c1817 2558-3754 reverse complement         35   0.14 
Scas_699.28*                                                           32   0.34 
Sklu_932.1 YOR020C, Contig c932 254-574 reverse complement             30   1.1  
Sklu_2339.2 YLR422W, Contig c2339 3447-9347                            32   1.3  
Kwal_47.18252                                                          30   2.0  
CAGL0E00429g complement(35367..36533) similar to sp|P25656 Sacch...    32   2.0  
Kwal_55.19697                                                          32   2.5  
KLLA0E09482g 840647..842554 some similarities with sp|Q07084 Sac...    30   4.8  
Scas_607.2                                                             29   9.9  

>KLLA0E04411g 404611..406413 similar to sp|P40032 Saccharomyces
           cerevisiae YER049w singleton, start by similarity
          Length = 600

 Score = 1099 bits (2843), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 544/591 (92%), Positives = 544/591 (92%)

Query: 1   MTVVESKRPAEETALGSDEKVRLLESSKAVGSFNSKIWDKSFQDDLRQEIKNAQPYNWGT 60
           MTVVESKRPAEETALGSDEKVRLLESSKAVGSFNSKIWDKSFQDDLRQEIKNAQPYNWGT
Sbjct: 1   MTVVESKRPAEETALGSDEKVRLLESSKAVGSFNSKIWDKSFQDDLRQEIKNAQPYNWGT 60

Query: 61  IRDLVDPNLLQEVRREIETSIHFTQKETDIYKVNQSGDLANLSGLDDADLSKLPSLVKLR 120
           IRDLVDPNLLQEVRREIETSIHFTQKETDIYKVNQSGDLANLSGLDDADLSKLPSLVKLR
Sbjct: 61  IRDLVDPNLLQEVRREIETSIHFTQKETDIYKVNQSGDLANLSGLDDADLSKLPSLVKLR 120

Query: 121 ELLYSEKYRDFIAYVTQSGKLSGSKTDISINTYTKGCHLLTHDDVIGSRRVSFILYLPEP 180
           ELLYSEKYRDFIAYVTQSGKLSGSKTDISINTYTKGCHLLTHDDVIGSRRVSFILYLPEP
Sbjct: 121 ELLYSEKYRDFIAYVTQSGKLSGSKTDISINTYTKGCHLLTHDDVIGSRRVSFILYLPEP 180

Query: 181 ERVWKEHYGGGLRLFPSIVPNVPFSDHSAKLVPQFNQIAFFKVQPGFSFHDVEEVKVDKH 240
           ERVWKEHYGGGLRLFPSIVPNVPFSDHSAKLVPQFNQIAFFKVQPGFSFHDVEEVKVDKH
Sbjct: 181 ERVWKEHYGGGLRLFPSIVPNVPFSDHSAKLVPQFNQIAFFKVQPGFSFHDVEEVKVDKH 240

Query: 241 RLSIQGWYHIXXXXXXXXXXXXXXXWIKTNISTLSQLVNSPLQDYEFPKIDRTPLSHYES 300
           RLSIQGWYHI               WIKTNISTLSQLVNSPLQDYEFPKIDRTPLSHYES
Sbjct: 241 RLSIQGWYHIPQEGEPGYTPGEEEEWIKTNISTLSQLVNSPLQDYEFPKIDRTPLSHYES 300

Query: 301 GKXXXXXXXXXXXXXXFLSKFLNPEHLTTESMRKISDKFVEDSFINIESFLNDEYSSLLK 360
           GK              FLSKFLNPEHLTTESMRKISDKFVEDSFINIESFLNDEYSSLLK
Sbjct: 301 GKLDRTDDLLTEDDITFLSKFLNPEHLTTESMRKISDKFVEDSFINIESFLNDEYSSLLK 360

Query: 361 KLIMDKEFNYDCPYESVNVRHPWKTSLPPHKWRYLYIDGKSYTNFRNEEDIKKALNNPEL 420
           KLIMDKEFNYDCPYESVNVRHPWKTSLPPHKWRYLYIDGKSYTNFRNEEDIKKALNNPEL
Sbjct: 361 KLIMDKEFNYDCPYESVNVRHPWKTSLPPHKWRYLYIDGKSYTNFRNEEDIKKALNNPEL 420

Query: 421 PNFHQLLSSFADKEEFNCEAKLCELAIFLQSISFKKWIVQLTKLVILSEQLLIRRFRPGK 480
           PNFHQLLSSFADKEEFNCEAKLCELAIFLQSISFKKWIVQLTKLVILSEQLLIRRFRPGK
Sbjct: 421 PNFHQLLSSFADKEEFNCEAKLCELAIFLQSISFKKWIVQLTKLVILSEQLLIRRFRPGK 480

Query: 481 DFTLATTTEVNELLKTIPGFVEAILECTLCLTPSKGWDSGEVGGYELYMNNQXXXXXXXX 540
           DFTLATTTEVNELLKTIPGFVEAILECTLCLTPSKGWDSGEVGGYELYMNNQ        
Sbjct: 481 DFTLATTTEVNELLKTIPGFVEAILECTLCLTPSKGWDSGEVGGYELYMNNQDDDEDDDA 540

Query: 541 XXXXXXXXXXSVLINKPASWNSLNLVLRDENVLQFIKYVSWAAKSSRWDIS 591
                     SVLINKPASWNSLNLVLRDENVLQFIKYVSWAAKSSRWDIS
Sbjct: 541 AIYRADDDGDSVLINKPASWNSLNLVLRDENVLQFIKYVSWAAKSSRWDIS 591

>Sklu_2174.4 YER049W, Contig c2174 3142-5040 reverse complement
          Length = 632

 Score =  721 bits (1860), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/612 (59%), Positives = 436/612 (71%), Gaps = 28/612 (4%)

Query: 7   KRPAEETALGSDEKVRLLESSKAVGSFNSKIWDKSFQDDLRQEIKNAQPYNWGTIRDLVD 66
           KR A   ++ +  K +  E SK    FNSKIWD  FQ  LRQEI  ++PYNWGTIRDL++
Sbjct: 2   KRSAPSKSVVNPTKQQAGEESKVKPLFNSKIWDPEFQAALRQEIAESKPYNWGTIRDLIN 61

Query: 67  PNLLQEVRREIETSIHFTQKETDIYKVNQSGDLANLSGLDDADLSKLPSLVKLRELLYSE 126
            +LL+ VR+EIET IHFT KETDIYKVNQSGDLANLSGLD  DLS+LP+L KLRE+LYSE
Sbjct: 62  DDLLRAVRKEIETQIHFTNKETDIYKVNQSGDLANLSGLDWNDLSRLPNLFKLREILYSE 121

Query: 127 KYRDFIAYVTQSGKLSGSKTDISINTYTKGCHLLTHDDVIGSRRVSFILYLPEPERVWKE 186
            YRD I+YVT +GKLSGSKTD+SINTYTKGCHLLTHDDVIGSRRVSFILYLP+P++ WK+
Sbjct: 122 IYRDVISYVTGAGKLSGSKTDMSINTYTKGCHLLTHDDVIGSRRVSFILYLPDPDKQWKD 181

Query: 187 HYGGGLRLFPSIVPNVPFSDHSAKLVPQFNQIAFFKVQPGFSFHDVEEVKVDKHRLSIQG 246
           HYGGGLRLFPSIV NVP SDHSAKLVPQFNQIAFF+VQPGFSFHDVEEV+VDKHRLSIQG
Sbjct: 182 HYGGGLRLFPSIVANVPHSDHSAKLVPQFNQIAFFQVQPGFSFHDVEEVRVDKHRLSIQG 241

Query: 247 WYHIXXXXXXXXXXXXXXXWIKTNISTLSQLVNSPLQDYEFPKIDRTPLSHYESG----- 301
           WYHI               W+KTN STL+QL ++ LQDYEFPK +R  L +++       
Sbjct: 242 WYHIPQVGEPGHIPGEEEEWVKTNTSTLAQLESNVLQDYEFPKNERDILPYHQVKHFEKV 301

Query: 302 -----------------KXXXXXXXXXXXXXXFLSKFLNPEHLTTESMRKISDKFVEDSF 344
                                           +LS+F++ E+LT   ++ +  +F+E+SF
Sbjct: 302 LQDSSPDSDSSKEKSPVSAIVDTKNLTEEELHYLSQFVSEEYLTPTGIQSLQSRFLENSF 361

Query: 345 INIESFLNDEYSSLLKKLIMDKEFNYDCPYESVNVRHPWKTSLPPHKWRYLYIDGKSYTN 404
           + I SFLND  S LLK+LI + E N DCPYES  V  PWKT++PPHKWRYLYIDGKS+ N
Sbjct: 362 LQIGSFLNDSKSKLLKRLIKNDELNKDCPYESDKVDAPWKTAIPPHKWRYLYIDGKSHEN 421

Query: 405 FRNEEDIKKALNNPELPNFHQLLSSFADKEEFNCEAKLCELAIFLQSISFKKWIVQLTKL 464
           FR+E DI   LNN ELPN+   L    DKE+ + E +L +L  F QS  FKK++  LT L
Sbjct: 422 FRSEADILAKLNNEELPNY-TFLKQTLDKEKHDTEYELVQLVEFFQSTIFKKYLALLTSL 480

Query: 465 VILSEQLLIRRFRPGKDFTLATTTEVNELLKTIPGFVEAILECTLCLTPSKGWDSGEVGG 524
             LSEQ+L+RRFRPGKDFTLAT    N+LL  + G+V+A+LE TLCLTP+ GWDSGEVGG
Sbjct: 481 CPLSEQILVRRFRPGKDFTLATKINQNKLLSNVEGYVDAVLEGTLCLTPTNGWDSGEVGG 540

Query: 525 YELYMNNQXXXXX-----XXXXXXXXXXXXXSVLINKPASWNSLNLVLRDENVLQFIKYV 579
           YELYMN+Q                       SVLIN P SWNSLNLVLRDE+VLQF+KY+
Sbjct: 541 YELYMNDQDDEEMRDKDLEDAAVYKADDSGDSVLINSPPSWNSLNLVLRDESVLQFVKYI 600

Query: 580 SWAAKSSRWDIS 591
           SW+AKSSRWD+S
Sbjct: 601 SWSAKSSRWDVS 612

>Kwal_47.18145
          Length = 624

 Score =  707 bits (1826), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/593 (60%), Positives = 433/593 (73%), Gaps = 27/593 (4%)

Query: 25  ESSKAVGSFNSKIWDKSFQDDLRQEIKNAQPYNWGTIRDLVDPNLLQEVRREIETSIHFT 84
           E  K    FNSKIWD  FQDDL+QEI +++PYNWGTIRDLVD +LL+ VR+E+ET IHFT
Sbjct: 20  EVGKIKSLFNSKIWDPKFQDDLKQEIADSKPYNWGTIRDLVDDDLLRAVRKEVETQIHFT 79

Query: 85  QKETDIYKVNQSGDLANLSGLDDADLSKLPSLVKLRELLYSEKYRDFIAYVTQSGKLSGS 144
           +KETDIYKVNQSGDLANLSGLD  DLS+LP+L KLRE+LYSE YRD I++VT +GKLSGS
Sbjct: 80  KKETDIYKVNQSGDLANLSGLDWEDLSRLPNLCKLREILYSEVYRDVISHVTGAGKLSGS 139

Query: 145 KTDISINTYTKGCHLLTHDDVIGSRRVSFILYLPEPERVWKEHYGGGLRLFPSIVPNVPF 204
           K D+SINTYTKGCHLLTHDDVIGSRRVSFILYLP+P   WKEHYGGGLRLFPSIV NVP 
Sbjct: 140 KMDMSINTYTKGCHLLTHDDVIGSRRVSFILYLPDPNTRWKEHYGGGLRLFPSIVANVPQ 199

Query: 205 SDHSAKLVPQFNQIAFFKVQPGFSFHDVEEVKVDKHRLSIQGWYHIXXXXXXXXXXXXXX 264
           SDHSAKL+PQFNQIAFF+VQPGFSFHDVEEV+V++HRLSIQGWYHI              
Sbjct: 200 SDHSAKLIPQFNQIAFFQVQPGFSFHDVEEVRVNRHRLSIQGWYHIPQEGEKGYIPGEEE 259

Query: 265 XWIKTNISTLSQLVNSPLQDYEFPKIDRTPL-----SHYE-------SGKXXXXXXXX-- 310
            W+KTN STL+QL ++ LQDYEFPK +R  L      HYE       + K          
Sbjct: 260 EWVKTNTSTLAQLESNVLQDYEFPKGERDILPNHQIKHYEHLLEAQPANKEEESSSDELA 319

Query: 311 -------XXXXXXFLSKFLNPEHLTTESMRKISDKFVEDSFINIESFLNDEYSSLLKKLI 363
                        FLS F++ E+LT E + K+  +F+++S + ++ FL+DE ++LLK+LI
Sbjct: 320 LPDLSFLTDKEMKFLSSFVSAEYLTPEGIAKLQKRFIDNSHLQVDDFLSDERANLLKQLI 379

Query: 364 MDKEFNYDCPYESVNVRHPWKTSLPPHKWRYLYIDGKSYTNFRNEEDIKKALNNPELPNF 423
              E + +CPYESVNV  PWKT++PPHKWRYLYIDGKS+ NF  E+DI   LNN E PN+
Sbjct: 380 KRDELDKECPYESVNVEMPWKTAMPPHKWRYLYIDGKSHENFTTEQDILDKLNNEERPNY 439

Query: 424 HQLLSSFADKEEFNCEAKLCELAIFLQSISFKKWIVQLTKLVILSEQLLIRRFRPGKDFT 483
             LL    DK++++ E +L  +A F QS +FKK++  LT L  LSEQ+LIRRFRPGKDFT
Sbjct: 440 -VLLKQSLDKKKYDTETELISVAEFFQSTAFKKYLALLTLLSPLSEQVLIRRFRPGKDFT 498

Query: 484 LATTTEVNELLKTIPGFVEAILECTLCLTPSKGWDSGEVGGYELYMNNQXXXXXX----- 538
           LAT    N+LL  + G V+A+LE TLCLTP+ GW+SGEVGGYELYM+NQ           
Sbjct: 499 LATQLNKNDLLGHVEGIVDAVLEGTLCLTPTNGWESGEVGGYELYMDNQDESEDMDKDIE 558

Query: 539 XXXXXXXXXXXXSVLINKPASWNSLNLVLRDENVLQFIKYVSWAAKSSRWDIS 591
                       +VLINKP SWNSLNLVLRDE+VLQFIKYVSW+AKSSRWDI+
Sbjct: 559 DAAVYKTDDAGDAVLINKPPSWNSLNLVLRDESVLQFIKYVSWSAKSSRWDIT 611

>YER049W (YER049W) [1477] chr5 (251727..253661) Component of NuA3
           histone acetyltransferase complex [1935 bp, 644 aa]
          Length = 644

 Score =  695 bits (1793), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/606 (57%), Positives = 435/606 (71%), Gaps = 39/606 (6%)

Query: 24  LESSKAVGSFNSKIWDKSFQDDLRQEIKNAQPYNWGTIRDLVDPNLLQEVRREIETSIHF 83
           LE  K  G FN KIWDK+FQD L++EI+++QPYNWGTI +LV+ +LL+ VR+EIET IHF
Sbjct: 21  LEEDKIKGMFNPKIWDKTFQDGLKKEIEDSQPYNWGTIHELVNDDLLRAVRKEIETEIHF 80

Query: 84  TQKETDIYKVNQSGDLANLSGLDDADLSKLPSLVKLRELLYSEKYRDFIAYVTQSGKLSG 143
           T+KETDIY+VNQSGDLANLSGLD  DLS+LP+L KLR++LYS++YRDF  YVT++GKLSG
Sbjct: 81  TKKETDIYRVNQSGDLANLSGLDWDDLSRLPNLFKLRQILYSKQYRDFFGYVTKAGKLSG 140

Query: 144 SKTDISINTYTKGCHLLTHDDVIGSRRVSFILYLPEPERVWKEHYGGGLRLFPSIVPNVP 203
           SKTD+SINTYTKGCHLLTHDDVIGSRR+SFILYLP+P+R WK HYGGGLRLFPSI+PNVP
Sbjct: 141 SKTDMSINTYTKGCHLLTHDDVIGSRRISFILYLPDPDRKWKSHYGGGLRLFPSILPNVP 200

Query: 204 FSDHSAKLVPQFNQIAFFKVQPGFSFHDVEEVKVDKHRLSIQGWYHIXXXXXXXXXXXXX 263
            SD SAKLVPQFNQIAFFKV PGFSFHDVEEVKVDKHRLSIQGWYHI             
Sbjct: 201 HSDPSAKLVPQFNQIAFFKVLPGFSFHDVEEVKVDKHRLSIQGWYHIPQVGEEGYIPGEE 260

Query: 264 XXWIKTNISTLSQLVNSPLQDYEFPKIDRTPLSHYE-----------SGKXXXXXXXXXX 312
             W++ N STL+Q+ ++ L+D+EFPK +R  LS +E           +G           
Sbjct: 261 EAWVRNNTSTLAQIESNVLEDFEFPKDERNILSFHEVKHFEKMLKGDAGAKTDNTPKESM 320

Query: 313 XXX------------XFLSKFLNPEHLTTESMRKISDKFVEDSFINIESFLNDEYSSLLK 360
                           +LS++++PEHL+++ + K+  +FVE+S + IESFLND+ S LLK
Sbjct: 321 TSVISDSVKLSEAEFTYLSQYISPEHLSSKGIEKLQKQFVENSSLQIESFLNDDKSELLK 380

Query: 361 KLIMDKEFNYDCPYESVNVRHPWKTSLPPHKWRYLYIDGKSYTNFRNEEDIKKALNNPEL 420
           K+I  KE   +CPY S +V+ PWKT++PPHK RYLYIDGK Y NF+ E DI +ALNN +L
Sbjct: 381 KVIKQKELEQECPYHSKDVKAPWKTAIPPHKARYLYIDGKEYRNFQTEADILEALNNNDL 440

Query: 421 PNFH------QLLSSFAD---KEEFNCEAKLCELAIFLQSISFKKWIVQLTKLVILSEQL 471
           PNF       +++S  +    +  F+ E  L +LA+F +S  FKK++  LT L  +SEQ+
Sbjct: 441 PNFQFTKDAIKIISDASGNSRENNFDAELALIDLAVFHKSTIFKKYLALLTSLCPVSEQI 500

Query: 472 LIRRFRPGKDFTLATTTEVNELLKTIPGFVEAILECTLCLTPSKGWDSGEVGGYELYM-- 529
           LIRRFRPG DFTLAT    NELLK+ P  ++A+LE TLCLTPS GW+SGE+GGYELYM  
Sbjct: 501 LIRRFRPGMDFTLATKCRFNELLKSNPDIIDAVLEGTLCLTPSAGWESGELGGYELYMMD 560

Query: 530 ----NNQ-XXXXXXXXXXXXXXXXXXSVLINKPASWNSLNLVLRDENVLQFIKYVSWAAK 584
               N Q                   SVLIN P +WN+ NLVLRDE+VL+F+KYVSW+AK
Sbjct: 561 DDEDNKQYLKEDVEDASVYRADDSGDSVLINDPPAWNTFNLVLRDESVLEFVKYVSWSAK 620

Query: 585 SSRWDI 590
           SSRWD+
Sbjct: 621 SSRWDV 626

>ADL114C [1627] [Homologous to ScYER049W - SH] (484310..486154)
           [1845 bp, 614 aa]
          Length = 614

 Score =  681 bits (1758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/601 (57%), Positives = 428/601 (71%), Gaps = 27/601 (4%)

Query: 3   VVESKRPAEETALGSDEKVRLLESSKAVGSFNSKIWDKSFQDDLRQEIKNAQPYNWGTIR 62
           V ESK+P              LE  K   SFNSKIWD S+++ LR+E+ + +PYNWGTI 
Sbjct: 10  VFESKQP-------------FLEIEKVKASFNSKIWDDSYREQLREEVASNKPYNWGTIH 56

Query: 63  DLVDPNLLQEVRREIETSIHFTQKETDIYKVNQSGDLANLSGLDDADLSKLPSLVKLREL 122
           DLVDP+LL+ VRREIE  IHFT KETDIYKVNQSGDLANLSGLD  DLS+LPSL +LR++
Sbjct: 57  DLVDPDLLRSVRREIEKEIHFTNKETDIYKVNQSGDLANLSGLDWKDLSRLPSLCRLRQI 116

Query: 123 LYSEKYRDFIAYVTQSGKLSGSKTDISINTYTKGCHLLTHDDVIGSRRVSFILYLPEPER 182
           LYS+ YRDFI YV  +GKLSG+K D+SINTYTKGCHLLTHDDVIGSRRVSFILYLP+P++
Sbjct: 117 LYSDVYRDFIGYVAGAGKLSGTKMDMSINTYTKGCHLLTHDDVIGSRRVSFILYLPDPDK 176

Query: 183 VWKEHYGGGLRLFPSIVPNVPFSDHSAKLVPQFNQIAFFKVQPGFSFHDVEEVKVDKHRL 242
            WKEHYGG LRLFPSI+PNVP SD SAKLVPQFNQ+AFF V PG+SFHDVEEVKVDKHRL
Sbjct: 177 TWKEHYGGALRLFPSIIPNVPTSDFSAKLVPQFNQLAFFHVHPGYSFHDVEEVKVDKHRL 236

Query: 243 SIQGWYHIXXXXXXXXXXXXXXXWIKTNISTLSQLVNSPLQDYEFPKIDRT--------P 294
           SIQGWYHI               ++ TNISTL+QL +  LQDYEF K +R+         
Sbjct: 237 SIQGWYHIPQEGEEGFVPGEEEQYVNTNISTLAQLESILLQDYEFLKSERSILPLQQLKQ 296

Query: 295 LSHYESGKXXXXXXXXXXXXXXFLSKFLNPEHLTTESMRKISDKFVEDSFINIESFLNDE 354
           L  +   +              +LS +++ EHL+ E ++ +  KF E+S++ I+SFLN++
Sbjct: 297 LEKFLGSESEDTAFYLNADELAYLSMYISEEHLSLEGIKSLQSKFTENSYLQIDSFLNEQ 356

Query: 355 YSSLLKKLIMDKEFNYDCPYESVNVRHPWKTSLPPHKWRYLYIDGKSYTNFRNEEDIKKA 414
            S+LLKKLI  +E   +CPY++  V  PWKT++PP+KWR++YIDGKS+ +F +E+DIK+ 
Sbjct: 357 KSALLKKLIKIEELEKECPYKAAEVEKPWKTAIPPYKWRFMYIDGKSHEHFCSEDDIKRR 416

Query: 415 LNNPELPNFHQLLSSFADKEEFNCEAKLCELAIFLQSISFKKWIVQLTKLVILSEQLLIR 474
           L + ELPNF  L    +D    + E  L EL  F +S +FKK++  LT L  L+EQLLIR
Sbjct: 417 LVHEELPNFTLLKQGLSD--HLSVEPALLELVEFFKSFAFKKYLALLTLLCPLTEQLLIR 474

Query: 475 RFRPGKDFTLATTTEVNELLKTIPGFVEAILECTLCLTPSKGWDSGEVGGYELYMNNQ-- 532
           RFRPG DFTLAT    ++LL+ + GFV+A+LE  LCLTP+ GW+SGE+GGYELYM +Q  
Sbjct: 475 RFRPGHDFTLATKIYPSQLLQHVEGFVDAVLEGVLCLTPTDGWESGELGGYELYMGDQDD 534

Query: 533 --XXXXXXXXXXXXXXXXXXSVLINKPASWNSLNLVLRDENVLQFIKYVSWAAKSSRWDI 590
                               SVLINKPASWNS NLVLRDE+VLQF+KYVSWAAKSSRWDI
Sbjct: 535 EDMNKDVEDAAVYRSDDSGSSVLINKPASWNSFNLVLRDESVLQFVKYVSWAAKSSRWDI 594

Query: 591 S 591
           S
Sbjct: 595 S 595

>CAGL0J02816g 272944..274821 highly similar to sp|P40032
           Saccharomyces cerevisiae YER049w, start by similarity
          Length = 625

 Score =  636 bits (1640), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/612 (53%), Positives = 409/612 (66%), Gaps = 30/612 (4%)

Query: 7   KRPAEETALGSDEKVRLLESSKAVGSFNSKIWDKSFQDDLRQEIKNAQPYNWGTIRDLVD 66
           KR AE    G+  K   LE  K  G FN K+W   F++ L+ +I ++ PYNWG I  LV+
Sbjct: 2   KRKAEAQENGN--KQLDLEEDKVKGLFNQKLWTPEFREGLKNQIDSSAPYNWGNISGLVN 59

Query: 67  PNLLQEVRREIETSIHFTQKETDIYKVNQSGDLANLSGLDDADLSKLPSLVKLRELLYSE 126
            +LL+ VR+EIET IHFT+KETDIYKVNQSGDLANLSGL+  DLS+LP++ KLR++LYS+
Sbjct: 60  DDLLRAVRKEIETEIHFTKKETDIYKVNQSGDLANLSGLNWDDLSRLPNMYKLRQILYSD 119

Query: 127 KYRDFIAYVTQSGKLSGSKTDISINTYTKGCHLLTHDDVIGSRRVSFILYLPEPERVWKE 186
            YRD I YVT +GKLSGSK D+S+NTYTKGCHLLTHDDVIGSRR+SFILYLP+P+R WK 
Sbjct: 120 VYRDLIGYVTGAGKLSGSKMDMSVNTYTKGCHLLTHDDVIGSRRISFILYLPDPDRKWKP 179

Query: 187 HYGGGLRLFPSIVPNVPFSDHSAKLVPQFNQIAFFKVQPGFSFHDVEEVKVDKHRLSIQG 246
            YGGGLRLF SI+PN+P +D  AK VPQFN+IAFFKV PGFSFHDVEEVKVDKHRLSIQG
Sbjct: 180 QYGGGLRLFSSILPNIPETDPCAKFVPQFNEIAFFKVLPGFSFHDVEEVKVDKHRLSIQG 239

Query: 247 WYHIXXXXXXXXXXXXXXXWIKTNISTLSQLVNSPLQDYEFPKIDRTPL-----SHYE-- 299
           WYH                W+K N STL+QL  + LQD+E+PK +R  L      H+E  
Sbjct: 240 WYHFPQPGEPGYTPGQEEAWVKNNTSTLTQLETNVLQDFEYPKQERDILPYHQVKHFEKV 299

Query: 300 ----SGKX---------XXXXXXXXXXXXXFLSKFLNPEHLTTESMRKISDKFVEDSFIN 346
                GK                       +LS++++ EHLT E ++K+ ++F+E+S + 
Sbjct: 300 LYAADGKKIDEDEVKSVVQDTDSLSEKEYKYLSQYISAEHLTKEGIKKLQEQFLENSTLQ 359

Query: 347 IESFLNDEYSSLLKKLIMDKEFNYDCPYESVNVRHPWKTSLPPHKWRYLYIDGKSYTNFR 406
           I+ FLN+E S LLKK+I  +E    CPY + +V  PW+T++P HKWRY+YIDGK+     
Sbjct: 360 IKDFLNEEVSELLKKMIKTEELEKACPYMAKDVETPWQTAMPSHKWRYMYIDGKNPRKLL 419

Query: 407 NEEDIKKALNNPELPNFHQLLSSFADKEEFNCEAKLCELAIFLQSISFKKWIVQLTKLVI 466
              DI +ALNN ELPNF  L  +       + E KL +LAIF +S  FKK++  LT L  
Sbjct: 420 KASDIMEALNNEELPNFELLRETLPKDGSVDVELKLIDLAIFYKSTIFKKYLALLTALCP 479

Query: 467 LSEQLLIRRFRPGKDFTLATTTEVNELLKTIPGFVEAILECTLCLTPSKGWDSGEVGGYE 526
           LSEQ+LIRRFRPG DFTLAT   +NE L+ + G + +IL   LCLTPS GW+SGEVGGYE
Sbjct: 480 LSEQILIRRFRPGNDFTLATQCRLNEFLQDVEGILPSILVGNLCLTPSSGWESGEVGGYE 539

Query: 527 LYMNNQXXXXXXXXXXXXXXXXXX--------SVLINKPASWNSLNLVLRDENVLQFIKY 578
           LYM +                           SVL+N P SWN+ NLVLRD++VL+F+KY
Sbjct: 540 LYMMDDENTEEEERMHKDVEDASVYRTDDNGDSVLVNNPPSWNTFNLVLRDQSVLEFVKY 599

Query: 579 VSWAAKSSRWDI 590
           VS AAKSSRWD+
Sbjct: 600 VSCAAKSSRWDV 611

>Scas_715.28*
          Length = 632

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/609 (50%), Positives = 404/609 (66%), Gaps = 37/609 (6%)

Query: 16  GSDEKVRLLESSKAVGSFNSKIWDKSFQDDLRQEIKNAQPYNWGTIRDLVDPNLLQEVRR 75
            +  K++ LE  K    FN +IW+  +Q +LR EI N++P+NWG+I  L+D +LL+ VR+
Sbjct: 10  AAQAKMQTLEDDKLKALFNPRIWEPDYQKELRDEIANSKPFNWGSIPKLIDDDLLRAVRK 69

Query: 76  EIETSIHFTQKETDIYKVNQSGDLANLSGLDDADLSKLPSLVKLRELLYSEKYRDFIAYV 135
           EIET IHF++KETDIYKVNQSGDLANLS LD  DLS+LP+L KLR+LLYSEKYRDF AY+
Sbjct: 70  EIETEIHFSKKETDIYKVNQSGDLANLSKLDWNDLSRLPNLFKLRQLLYSEKYRDFFAYI 129

Query: 136 TQSGKLSGSKTDISINTYTKGCHLLTHDDVIGSRRVSFILYLPEPERVWKEHYGGGLRLF 195
           TQSG LSG KTD+SINTYTKGCHL+ HDDVIGSRR+SFILYLP+P+R WK HYGGGLRL+
Sbjct: 130 TQSGHLSGKKTDMSINTYTKGCHLVPHDDVIGSRRISFILYLPDPDRKWKSHYGGGLRLY 189

Query: 196 PSIVPNVPFSDHSAKLVPQFNQIAFFKVQPGFSFHDVEEVKVDKHRLSIQGWYHIXXXXX 255
            +I+PNVP +D  AKLVPQFNQIAFFKV PGFSFHDVEEVKVDKHRLSIQGWYHI     
Sbjct: 190 DTIMPNVPENDPCAKLVPQFNQIAFFKVNPGFSFHDVEEVKVDKHRLSIQGWYHIPQEGD 249

Query: 256 XXXXXXXXXXWIKTNISTLSQLVNSPLQDYEFPKIDRTPLSHYE------------SGKX 303
                     +I  NI+ L +L ++ L+D+EFPK +R  L +Y+            SG  
Sbjct: 250 KGYIPNEEATYIDKNITQLGELDSAVLEDFEFPKEERELLPNYQIKHFEKILERSNSGDN 309

Query: 304 XXXXX---------------XXXXXXXXFLSKFLNPEHLTTESMRKISDKFVEDSFINIE 348
                                       +LS+++  EHLT E + K+ + F+E+SF++IE
Sbjct: 310 DSSNVLSIPSGMKVIPSEIPSLTEEEVAYLSEYVALEHLTKEGISKLQESFLENSFLSIE 369

Query: 349 SFLNDEYSSLLKKLIMDKEFNYDCPYESVNVRHPWKTSLPPHKWRYLYIDGKSYTNFRNE 408
           SFLN+E SSLL+  I   E   DCP  S +V +PWKT++P HK +YLYIDGK   +    
Sbjct: 370 SFLNEEKSSLLENQIKRTELEKDCPLFSKDVAYPWKTAMPSHKCKYLYIDGKKQQDLATA 429

Query: 409 EDIKKALNNPELPNFHQLLSSFAD--KEEFNCEAKLCELAIFLQSISFKKWIVQLTKLVI 466
           + +   LNN E  NF +++    +  KE+ + E  L EL+IF +S+ FKK++V LT L +
Sbjct: 430 DGLITTLNNDENSNF-EMVKELVNIGKEDIDTEKSLIELSIFFKSLIFKKYLVLLTSLCL 488

Query: 467 LSEQLLIRRFRPGKDFTLATTTEVNELLKTIPGFVEAILECTLCLTPSKGWDSGEVGGYE 526
           ++EQ+LIRRFRPG DFTLA   ++N   K +   ++ +L         KGW++G+VGGYE
Sbjct: 489 ITEQVLIRRFRPGNDFTLANKCKMN--TKYLNEVLDNVLRRYFMFDSIKGWETGDVGGYE 546

Query: 527 LYMNNQXXXXXX-----XXXXXXXXXXXXSVLINKPASWNSLNLVLRDENVLQFIKYVSW 581
           +YM +                        S+L+N PASWN+ NLVLRDE+VL+F+KY+SW
Sbjct: 547 IYMMDGTKEKAEDEDDVEAERYKNDENGESILLNSPASWNTFNLVLRDESVLEFVKYISW 606

Query: 582 AAKSSRWDI 590
            AKSSRWDI
Sbjct: 607 EAKSSRWDI 615

>Sklu_1817.3 YCR094W, Contig c1817 2558-3754 reverse complement
          Length = 398

 Score = 35.0 bits (79), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 51/124 (41%), Gaps = 25/124 (20%)

Query: 322 LNPEHLTTES--MRKISDKFVEDSFINIESFLNDEYSSLLKKLIMDKEFNYDCPYESVNV 379
           ++P+ L +E   +R   DK +    +   S  ND +S +LK +      N    Y   N 
Sbjct: 171 VDPDDLVSECNPLRSEDDKAIYPCGLIANSLFNDTFSQVLKGV------NDTADYHLTNK 224

Query: 380 RHPWKTS--------------LPPHKWRYLYIDGKSYTN---FRNEEDIKKALNNPELPN 422
           +  WKT               +PP  WR  Y DG +  N     N E+++  +    LP 
Sbjct: 225 KIAWKTDRERYVRTQYNASQIVPPPNWRKKYPDGYTDENIPDISNWEELQVWMRTAGLPK 284

Query: 423 FHQL 426
           F++L
Sbjct: 285 FYKL 288

>Scas_699.28*
          Length = 106

 Score = 32.0 bits (71), Expect = 0.34,   Method: Composition-based stats.
 Identities = 21/69 (30%), Positives = 38/69 (55%)

Query: 60  TIRDLVDPNLLQEVRREIETSIHFTQKETDIYKVNQSGDLANLSGLDDADLSKLPSLVKL 119
           +I  L+D  L+Q V+ E +T+      E ++ K+NQ+  LA   G  DA+ +K+   VK+
Sbjct: 10  SIVPLMDRVLVQRVKAEAKTASGILLPEKNVEKLNQAKVLAVGPGFTDANGNKVVPQVKI 69

Query: 120 RELLYSEKY 128
            + +   +Y
Sbjct: 70  GDQVLIPQY 78

>Sklu_932.1 YOR020C, Contig c932 254-574 reverse complement
          Length = 106

 Score = 30.4 bits (67), Expect = 1.1,   Method: Composition-based stats.
 Identities = 19/60 (31%), Positives = 33/60 (55%)

Query: 60  TIRDLVDPNLLQEVRREIETSIHFTQKETDIYKVNQSGDLANLSGLDDADLSKLPSLVKL 119
           +I  L+D  L+Q ++ E +T+      E ++ K+NQ+  LA   G  DA  +K+   VK+
Sbjct: 10  SIVPLLDRVLVQRIKAEAKTASGLYLPEKNVQKLNQATVLAVGPGFTDASGNKVTPQVKV 69

>Sklu_2339.2 YLR422W, Contig c2339 3447-9347
          Length = 1966

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 30/54 (55%), Gaps = 6/54 (11%)

Query: 389 PHKWRYLY----IDGKSYTNFRNEEDIKKALNNPELPNFHQL--LSSFADKEEF 436
           P  + +LY    I   S+ N   ++D K + +NP+LP+ HQL   SS +D  +F
Sbjct: 94  PKAFAHLYYEQDITSVSFLNMPEKKDFKDSSDNPDLPSLHQLNEESSISDTPQF 147

>Kwal_47.18252
          Length = 105

 Score = 29.6 bits (65), Expect = 2.0,   Method: Composition-based stats.
 Identities = 19/59 (32%), Positives = 33/59 (55%)

Query: 60  TIRDLVDPNLLQEVRREIETSIHFTQKETDIYKVNQSGDLANLSGLDDADLSKLPSLVK 118
           +I  L+D  L+Q V+ E +T+      E ++ K+NQ+  LA   G  DA+ +K+   V+
Sbjct: 10  SIVPLMDRVLVQRVKAEAKTASGLYLPEKNVQKLNQATVLAVGPGFTDANGNKVTPQVQ 68

>CAGL0E00429g complement(35367..36533) similar to sp|P25656
           Saccharomyces cerevisiae YCR094w or sp|P53740
           Saccharomyces cerevisiae YNR048w, start by similarity
          Length = 388

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 53/129 (41%), Gaps = 24/129 (18%)

Query: 317 FLSKFLNPEHLTTES--MRKISDKFVEDSFINIESFLNDEYSSLLKKLIMDKEFNYDCPY 374
            L K L+ + LTT    +R   DK V    +   S  ND +   LK +    + N D  Y
Sbjct: 162 LLGKALSKDELTTACRPLRAEGDKIVYPCGMIANSMFNDTFDQQLKAV---GDSNSD--Y 216

Query: 375 ESVNVRHPW--------KTS------LPPHKWRYLYIDGKSYTNFRNE---EDIKKALNN 417
           E  N +  W        KT+      +PP  WR  + DG +  N  N    E+ +  +  
Sbjct: 217 ELTNKKISWSIDRKRFKKTTYNASQIIPPPNWRERFPDGYTEDNIPNIHEWEEFQVWMRT 276

Query: 418 PELPNFHQL 426
             LP F++L
Sbjct: 277 AALPKFYKL 285

>Kwal_55.19697
          Length = 1760

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 62/125 (49%), Gaps = 9/125 (7%)

Query: 70  LQEVRREIETSIHFTQKETDIYKV--NQSGDLANLSGLDDADL-SKLPSLVKLREL--LY 124
           LQ+  +E+ET I    +E D YK   +Q+    +  GL D +  +   S +K+REL  L 
Sbjct: 586 LQDHIQELETRIDVITRERDAYKAIQSQTSHEGSNGGLRDVNAKASENSDLKIRELEELL 645

Query: 125 SEKYRDFIAYV----TQSGKLSGSKTDISINTYTKGCHLLTHDDVIGSRRVSFILYLPEP 180
           S   R+  A V    T++ +L+ SK+++ +N   +    L  ++ +   + S +L   E 
Sbjct: 646 SAAKREAEANVKLLMTENQELARSKSELVVNVEKEKSSRLLAEERLKISKSSLLLTKQEN 705

Query: 181 ERVWK 185
           E + K
Sbjct: 706 EELNK 710

>KLLA0E09482g 840647..842554 some similarities with sp|Q07084
           Saccharomyces cerevisiae YLR006c SSK1 two-component
           signal transducer singleton, hypothetical start
          Length = 635

 Score = 30.4 bits (67), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 25/57 (43%)

Query: 365 DKEFNYDCPYESVNVRHPWKTSLPPHKWRYLYIDGKSYTNFRNEEDIKKALNNPELP 421
           D E + D PYE  N+      + PPH   Y     K  T       + K +++PELP
Sbjct: 312 DIEGSNDSPYEEANISLDNIETSPPHPESYALTAQKPLTEEEVGISLTKTISSPELP 368

>Scas_607.2
          Length = 417

 Score = 29.3 bits (64), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 28/62 (45%), Gaps = 3/62 (4%)

Query: 380 RHPWKTSLPPHKWRYLYIDGKSYTNFRNEEDIKKALNNPELPNFHQLLSSFADKEEFNCE 439
           R+  K     +++R L     SY  F N++D+K     PE      LL    D E+ N E
Sbjct: 159 RYAQKIQGESNRFRVLQ---NSYLKFLNKDDLKPISAKPESDTSQMLLFEMEDNEQSNVE 215

Query: 440 AK 441
           A+
Sbjct: 216 AQ 217

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.135    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 19,102,228
Number of extensions: 822647
Number of successful extensions: 2485
Number of sequences better than 10.0: 27
Number of HSP's gapped: 2523
Number of HSP's successfully gapped: 30
Length of query: 591
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 484
Effective length of database: 12,891,983
Effective search space: 6239719772
Effective search space used: 6239719772
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)