Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0E04389g91904671e-62
YER048W-A94902841e-34
Kwal_47.1814299892667e-32
ADL113C108862591e-30
CAGL0J02794g103772547e-30
Sklu_2174.593902423e-28
Scas_715.28d95892337e-27
ACR206C7959710.015
Scas_711.1979379640.31
Sklu_2218.218054591.4
ADR001C32429591.4
AFR414W27269582.5
CAGL0F04653g29246572.9
YLL032C82527573.1
Scas_673.3329771564.0
Kwal_23.469526747564.4
Scas_478.292047565.0
YKR100C35533555.9
ADR232W85545548.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E04389g
         (90 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E04389g 403312..403587 similar to sgd|S0007237 Saccharomyce...   184   1e-62
YER048W-A (YER048W-A) [1476] chr5 (250717..251001) Protein of un...   114   1e-34
Kwal_47.18142                                                         107   7e-32
ADL113C [1628] [Homologous to ScYER048W-A - SH] (486497..486823)...   104   1e-30
CAGL0J02794g 272273..272584 similar to gi|6320889|sgd|S0007237 S...   102   7e-30
Sklu_2174.5 YER048W-A, Contig c2174 5568-5849 reverse complement       98   3e-28
Scas_715.28d                                                           94   7e-27
ACR206C [1253] [Homologous to ScYDR379C-A - SH] (709048..709287)...    32   0.015
Scas_711.19                                                            29   0.31 
Sklu_2218.2 YGR055W, Contig c2218 1631-2173                            27   1.4  
ADR001C [1742] [Homologous to ScYIR001C (SGN1) - SH] (708437..70...    27   1.4  
AFR414W [3606] [Homologous to ScYJR060W (CBF1) - SH] complement(...    27   2.5  
CAGL0F04653g complement(470517..471395) highly similar to sp|P32...    27   2.9  
YLL032C (YLL032C) [3388] chr12 complement(74269..76746) Protein ...    27   3.1  
Scas_673.33                                                            26   4.0  
Kwal_23.4695                                                           26   4.4  
Scas_478.2                                                             26   5.0  
YKR100C (YKR100C) [3351] chr11 complement(638537..639604) Protei...    26   5.9  
ADR232W [1973] [Homologous to ScYKR090W (PXL1) - SH] complement(...    25   8.0  

>KLLA0E04389g 403312..403587 similar to sgd|S0007237 Saccharomyces
          cerevisiae YER048wa, start by similarity
          Length = 91

 Score =  184 bits (467), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 90/90 (100%), Positives = 90/90 (100%)

Query: 1  MPATGASKTQILHMYKEFIRNASKIQNYNFREYFLRRARESFRANKNVENPEKISELLSE 60
          MPATGASKTQILHMYKEFIRNASKIQNYNFREYFLRRARESFRANKNVENPEKISELLSE
Sbjct: 1  MPATGASKTQILHMYKEFIRNASKIQNYNFREYFLRRARESFRANKNVENPEKISELLSE 60

Query: 61 AEKDLGVLKRQSVISNMYTFDKLVVEPLKK 90
          AEKDLGVLKRQSVISNMYTFDKLVVEPLKK
Sbjct: 61 AEKDLGVLKRQSVISNMYTFDKLVVEPLKK 90

>YER048W-A (YER048W-A) [1476] chr5 (250717..251001) Protein of
          unknown function [285 bp, 94 aa]
          Length = 94

 Score =  114 bits (284), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 53/90 (58%), Positives = 69/90 (76%), Gaps = 1/90 (1%)

Query: 1  MPA-TGASKTQILHMYKEFIRNASKIQNYNFREYFLRRARESFRANKNVENPEKISELLS 59
          MP  T  ++ Q+L +YKEFI+NA++  NYNFREYFL + R +FR N N ++P+ +  L  
Sbjct: 1  MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFK 60

Query: 60 EAEKDLGVLKRQSVISNMYTFDKLVVEPLK 89
          EA+ DLGVLKRQSVIS MYTFD+LVVEPL+
Sbjct: 61 EAKNDLGVLKRQSVISQMYTFDRLVVEPLQ 90

>Kwal_47.18142
          Length = 99

 Score =  107 bits (266), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 66/89 (74%), Gaps = 1/89 (1%)

Query: 2  PATGASKTQILHMYKEFIRNASKIQNYNFREYFLRRARESFRANKNVENPEKISELLSEA 61
          PA G ++ Q+L +YK+FI+NA+   NYN+REYFLR+AR +FR +K + +P  +      A
Sbjct: 4  PA-GPTRAQVLALYKQFIKNANGFNNYNYREYFLRKARTTFREHKTLTDPASVETAWEIA 62

Query: 62 EKDLGVLKRQSVISNMYTFDKLVVEPLKK 90
           K+LGVLKRQSVIS MYTFDK VVEPL +
Sbjct: 63 NKELGVLKRQSVISQMYTFDKQVVEPLDR 91

>ADL113C [1628] [Homologous to ScYER048W-A - SH] (486497..486823)
           [327 bp, 108 aa]
          Length = 108

 Score =  104 bits (259), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 68/86 (79%), Gaps = 1/86 (1%)

Query: 5   GASKTQILHMYKEFIRNASKIQNYNFREYFLRRARESFRANKNVENPEKISELLSEAEKD 64
           G ++  +LH+Y+EF+R+A +  NYNFREYF+R +R++FR ++   + E++ +L   A+++
Sbjct: 24  GPTRAGVLHLYREFVRSARQFNNYNFREYFMRHSRDTFRKHREA-SGEELQQLWERAQQE 82

Query: 65  LGVLKRQSVISNMYTFDKLVVEPLKK 90
           +GVLKRQSVIS MYTFDKLVVE L+K
Sbjct: 83  VGVLKRQSVISQMYTFDKLVVEQLRK 108

>CAGL0J02794g 272273..272584 similar to gi|6320889|sgd|S0007237
          Saccharomyces cerevisiae YER048wa, hypothetical start
          Length = 103

 Score =  102 bits (254), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 60/77 (77%)

Query: 7  SKTQILHMYKEFIRNASKIQNYNFREYFLRRARESFRANKNVENPEKISELLSEAEKDLG 66
          ++ Q+L +YK+ I+NA++  NYNFREYFLR+AR  F+ANK + +  KI  L   A++DLG
Sbjct: 3  ARQQVLQLYKQIIKNANQFSNYNFREYFLRKARTEFKANKALTDAAKIESLFQGAQRDLG 62

Query: 67 VLKRQSVISNMYTFDKL 83
          VLKRQS+IS MYTFDKL
Sbjct: 63 VLKRQSIISQMYTFDKL 79

>Sklu_2174.5 YER048W-A, Contig c2174 5568-5849 reverse complement
          Length = 93

 Score = 97.8 bits (242), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 50/90 (55%), Positives = 72/90 (80%)

Query: 1  MPATGASKTQILHMYKEFIRNASKIQNYNFREYFLRRARESFRANKNVENPEKISELLSE 60
          M AT  ++ Q+L +Y++F++NA+   NYNFREYFLR+AR +F+ +K +++  K++    E
Sbjct: 1  MTATVPTRPQVLALYRQFVKNANNFNNYNFREYFLRKARTTFKESKQLQDSTKVNAAWEE 60

Query: 61 AEKDLGVLKRQSVISNMYTFDKLVVEPLKK 90
          A+++LGVLKRQSVIS MYTFDKLVVEPL+K
Sbjct: 61 AQRELGVLKRQSVISQMYTFDKLVVEPLRK 90

>Scas_715.28d
          Length = 95

 Score = 94.4 bits (233), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 70/89 (78%), Gaps = 1/89 (1%)

Query: 1  MPATGASKTQILHMYKEFIRNASKIQNYNFREYFLRRARESFRANKNVENPEKISELLSE 60
          MPAT  S+ Q+L +YK+FIRN+++  N+NFREYFLR +RE F+ N  +++ EK+++L   
Sbjct: 1  MPAT-PSRLQVLSLYKQFIRNSNQFNNFNFREYFLRISREKFKENAPIQDKEKVAKLYEA 59

Query: 61 AEKDLGVLKRQSVISNMYTFDKLVVEPLK 89
          A++DLGVLKRQ +IS MYTFDKLVVE  K
Sbjct: 60 AQRDLGVLKRQKLISQMYTFDKLVVESAK 88

>ACR206C [1253] [Homologous to ScYDR379C-A - SH] (709048..709287)
          [240 bp, 79 aa]
          Length = 79

 Score = 32.0 bits (71), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 33/59 (55%), Gaps = 3/59 (5%)

Query: 11 ILHMYKEFIRNASKIQNYNFREYFLRRARESFRANKNV--ENPEKISELLSEAEKDLGV 67
          +LH+Y+EFIR A      N R +F+   RE FR +K++  +N   I  LL   +K L +
Sbjct: 12 VLHLYREFIRVAYTKAPEN-RPHFIGYIREEFRRHKDLPRKNFVAIEHLLRVGKKKLAL 69

>Scas_711.19
          Length = 793

 Score = 29.3 bits (64), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 38/79 (48%), Gaps = 7/79 (8%)

Query: 12  LHMYKEFIRNASKIQNYNFREYFLRRARESFRANKNVENPEKISELLSEAEKDLGVLKRQ 71
           + +Y   ++N   + N    + F  +  +  R N N+  PE+I+ L      ++GV+   
Sbjct: 345 VRIYSGILKNGHTVHNTTTGKSF--KIGKLVRMNANI--PEEITHL---NAGEIGVITGS 397

Query: 72  SVISNMYTFDKLVVEPLKK 90
           ++  N+ T D L+   +KK
Sbjct: 398 TISENISTGDTLISHSIKK 416

>Sklu_2218.2 YGR055W, Contig c2218 1631-2173
          Length = 180

 Score = 27.3 bits (59), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 25/54 (46%)

Query: 23 SKIQNYNFREYFLRRARESFRANKNVENPEKISELLSEAEKDLGVLKRQSVISN 76
          S++  +N   YF+  ++E      +VEN E+    L    K LG+     +I N
Sbjct: 9  SQLNVFNKENYFVTSSKEGSAEPTDVENGEQFVTELDRGSKRLGLFSCIGLICN 62

>ADR001C [1742] [Homologous to ScYIR001C (SGN1) - SH]
           (708437..709411) [975 bp, 324 aa]
          Length = 324

 Score = 27.3 bits (59), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 19/29 (65%)

Query: 51  PEKISELLSEAEKDLGVLKRQSVISNMYT 79
           PE  +E+L E  KD+GV+ R +++ N  T
Sbjct: 92  PEATAEMLEEHFKDVGVISRITILYNKKT 120

>AFR414W [3606] [Homologous to ScYJR060W (CBF1) - SH]
           complement(1176842..1177660) [819 bp, 272 aa]
          Length = 272

 Score = 26.9 bits (58), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 35/69 (50%)

Query: 1   MPATGASKTQILHMYKEFIRNASKIQNYNFREYFLRRARESFRANKNVENPEKISELLSE 60
           +P   +SK  IL    E+I+   + +N N  ++ L++     + ++     EK+ E L+ 
Sbjct: 194 LPVKESSKAAILSRAAEYIQELKETENTNIEKWTLQKLLSEQQVSQLTSTNEKLEEELNN 253

Query: 61  AEKDLGVLK 69
           A K++  LK
Sbjct: 254 AFKEIETLK 262

>CAGL0F04653g complement(470517..471395) highly similar to sp|P32602
           Saccharomyces cerevisiae YBL050w SEC17 transport vesicle
           fusion protein, start by similarity
          Length = 292

 Score = 26.6 bits (57), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 11/46 (23%), Positives = 23/46 (50%), Gaps = 2/46 (4%)

Query: 13  HMYKEFIRN--ASKIQNYNFREYFLRRARESFRANKNVENPEKISE 56
            +Y + I+N   +++  ++ +EYFL++      AN  V     + E
Sbjct: 179 DLYTKLIKNSLGNRLSQWSLKEYFLKKGLTQLAANDTVAASRTVQE 224

>YLL032C (YLL032C) [3388] chr12 complement(74269..76746) Protein
           containing a KH domain, which may bind RNA [2478 bp, 825
           aa]
          Length = 825

 Score = 26.6 bits (57), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 17/27 (62%)

Query: 6   ASKTQILHMYKEFIRNASKIQNYNFRE 32
           AS T ILH   +FI  ++++ N N R+
Sbjct: 387 ASDTSILHYLSDFIMGSNQVINPNLRQ 413

>Scas_673.33
          Length = 297

 Score = 26.2 bits (56), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 34/71 (47%)

Query: 1   MPATGASKTQILHMYKEFIRNASKIQNYNFREYFLRRARESFRANKNVENPEKISELLSE 60
           +P   +SK  IL    E+I N  + +  N  ++ L++      A +     EK+ E L  
Sbjct: 222 LPMRESSKAAILMRSAEYIENLKETEKTNIEKFTLQKLLGEQTAARLTSENEKLQEELGN 281

Query: 61  AEKDLGVLKRQ 71
           A K++  LKR+
Sbjct: 282 AYKEIESLKRK 292

>Kwal_23.4695
          Length = 267

 Score = 26.2 bits (56), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 26/47 (55%)

Query: 32  EYFLRRARESFRANKNVENPEKISELLSEAEKDLGVLKRQSVISNMY 78
           E    + +E   A K + +PEKI EL ++ ++    +K +  ISN++
Sbjct: 100 EALEHQCKEMSTAEKPIASPEKIQELTNKLQETWKGVKSKQSISNLF 146

>Scas_478.2
          Length = 920

 Score = 26.2 bits (56), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 26/47 (55%), Gaps = 2/47 (4%)

Query: 11  ILHMYKEFIRNASKIQNYNFREYFLRRARESFRANKNVENPEKISEL 57
           I+  +K F    +K+  YN   YF+R AR +   NK + +P++ S+ 
Sbjct: 744 IVGGFKTFDAKTNKLLAYNEGTYFIRGARVA--PNKQIIDPKRRSKF 788

>YKR100C (YKR100C) [3351] chr11 complement(638537..639604) Protein
           of unknown function [1068 bp, 355 aa]
          Length = 355

 Score = 25.8 bits (55), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 4/33 (12%)

Query: 18  FIRNASKIQNYNFREYFLRRARESFRANKNVEN 50
            IRN   +QN +F  Y+ RRA  SF  N N+ N
Sbjct: 220 LIRN---LQNQDFGSYYPRRASSSF-LNGNISN 248

>ADR232W [1973] [Homologous to ScYKR090W (PXL1) - SH]
           complement(1108261..1110828) [2568 bp, 855 aa]
          Length = 855

 Score = 25.4 bits (54), Expect = 8.0,   Method: Composition-based stats.
 Identities = 14/45 (31%), Positives = 22/45 (48%)

Query: 43  RANKNVENPEKISELLSEAEKDLGVLKRQSVISNMYTFDKLVVEP 87
           R+   + NP K +E LS A K   +  R S I  + T+    ++P
Sbjct: 588 RSLDEIWNPTKPAERLSLAAKRQSIAARNSAIRPVSTYGPNTIQP 632

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.131    0.351 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 2,698,505
Number of extensions: 93149
Number of successful extensions: 452
Number of sequences better than 10.0: 42
Number of HSP's gapped: 451
Number of HSP's successfully gapped: 42
Length of query: 90
Length of database: 16,596,109
Length adjustment: 61
Effective length of query: 29
Effective length of database: 14,484,411
Effective search space: 420047919
Effective search space used: 420047919
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 54 (25.4 bits)