Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0E02134g53953128560.0
Sklu_2316.348749512081e-162
Kwal_55.2210649543611911e-159
YGR197C (SNG1)54747211021e-145
Scas_617.354151010581e-138
CAGL0G09273g54542010191e-133
Scas_647.94494079421e-122
CAGL0B03949g6324269521e-121
YJR015W5104998931e-114
CAGL0B03971g5435198421e-106
ADL193C4654668351e-106
Scas_434.13573053536e-37
Scas_617.0d46411562e-13
AER444W547146750.41
Scas_699.18650138750.41
AGL085C90953730.84
ACR257C25970701.4
CAGL0A00495g90253711.5
Sklu_1454.138541683.3
YPL036W (PMA2)94753683.3
KLLA0A05643g21858664.2
Scas_684.286488674.7
KLLA0A05456g75977674.8
Scas_688.191353666.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E02134g
         (531 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E02134g complement(200436..202055) similar to sp|P46950 Sac...  1104   0.0  
Sklu_2316.3 , Contig c2316 10494-11957 reverse complement             469   e-162
Kwal_55.22106                                                         463   e-159
YGR197C (SNG1) [2147] chr7 complement(892500..894143) Probable t...   429   e-145
Scas_617.3                                                            412   e-138
CAGL0G09273g 885374..887011 similar to sp|P46950 Saccharomyces c...   397   e-133
Scas_647.9                                                            367   e-122
CAGL0B03949g complement(387861..389759) similar to sp|P46950 Sac...   371   e-121
YJR015W (YJR015W) [2918] chr10 (462635..464167) Protein with sim...   348   e-114
CAGL0B03971g complement(390700..392331) similar to sp|P47090 Sac...   328   e-106
ADL193C [1548] [Homologous to ScYGR197C (SNG1) - NSH] (357909..3...   326   e-106
Scas_434.1                                                            140   6e-37
Scas_617.0d                                                            65   2e-13
AER444W [2944] [Homologous to ScYIL166C - NSH] complement(148785...    33   0.41 
Scas_699.18                                                            33   0.41 
AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W (...    33   0.84 
ACR257C [1304] [Homologous to ScYKR055W (RHO4) - SH] (808667..80...    32   1.4  
CAGL0A00495g complement(55014..57722) highly similar to sp|P0503...    32   1.5  
Sklu_1454.1 YHR004C, Contig c1454 1069-2226 reverse complement         31   3.3  
YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting P...    31   3.3  
KLLA0A05643g 528976..529632 similar to sp|Q00246 Saccharomyces c...    30   4.2  
Scas_684.2                                                             30   4.7  
KLLA0A05456g 500097..502376 similar to sp|P53313 Saccharomyces c...    30   4.8  
Scas_688.1                                                             30   6.4  

>KLLA0E02134g complement(200436..202055) similar to sp|P46950
           Saccharomyces cerevisiae YGR197c SNG1 involved in
           nitroguanidine resistance, start by similarity
          Length = 539

 Score = 1104 bits (2856), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 531/531 (100%), Positives = 531/531 (100%)

Query: 1   MGFNDFDKMSGDDIRLVNETARERFLEGVAFDAAKDGQYMNAESSADEESQGFAGNESGR 60
           MGFNDFDKMSGDDIRLVNETARERFLEGVAFDAAKDGQYMNAESSADEESQGFAGNESGR
Sbjct: 1   MGFNDFDKMSGDDIRLVNETARERFLEGVAFDAAKDGQYMNAESSADEESQGFAGNESGR 60

Query: 61  KSRTPSLAMVGEDNQDQSTSDEQAESVEEFNKESANIDDKNEEQNDGSPAEAGQPALGRV 120
           KSRTPSLAMVGEDNQDQSTSDEQAESVEEFNKESANIDDKNEEQNDGSPAEAGQPALGRV
Sbjct: 61  KSRTPSLAMVGEDNQDQSTSDEQAESVEEFNKESANIDDKNEEQNDGSPAEAGQPALGRV 120

Query: 121 KTRFFSSKLSTHRNIFARRFALNCFLLGSLAIAMFSLYWGALYNHSSDYHNVKFIAVVED 180
           KTRFFSSKLSTHRNIFARRFALNCFLLGSLAIAMFSLYWGALYNHSSDYHNVKFIAVVED
Sbjct: 121 KTRFFSSKLSTHRNIFARRFALNCFLLGSLAIAMFSLYWGALYNHSSDYHNVKFIAVVED 180

Query: 181 DGDMGAGVIPIMDSAIPQFFVYNTSSFRDKYGQDVNISEKVHHLVHTKKFWGSLIVYPGT 240
           DGDMGAGVIPIMDSAIPQFFVYNTSSFRDKYGQDVNISEKVHHLVHTKKFWGSLIVYPGT
Sbjct: 181 DGDMGAGVIPIMDSAIPQFFVYNTSSFRDKYGQDVNISEKVHHLVHTKKFWGSLIVYPGT 240

Query: 241 TDAFVDSLTTDDAPAFNSTDYFEFFYKTARDLSNMRASIVPLLTSIETTYKKTFFYNDYF 300
           TDAFVDSLTTDDAPAFNSTDYFEFFYKTARDLSNMRASIVPLLTSIETTYKKTFFYNDYF
Sbjct: 241 TDAFVDSLTTDDAPAFNSTDYFEFFYKTARDLSNMRASIVPLLTSIETTYKKTFFYNDYF 300

Query: 301 PSVIANITNISGPNLSAAGDMNWKQIDNRPFTDYTLLGPMQVGLIYCILLTFFQLALFGP 360
           PSVIANITNISGPNLSAAGDMNWKQIDNRPFTDYTLLGPMQVGLIYCILLTFFQLALFGP
Sbjct: 301 PSVIANITNISGPNLSAAGDMNWKQIDNRPFTDYTLLGPMQVGLIYCILLTFFQLALFGP 360

Query: 361 FHAMLSPLLKPKHIILYRLVTSWATYFFLSLFFCTVSAIFHVDFTLAFGRGGFVVYWMTT 420
           FHAMLSPLLKPKHIILYRLVTSWATYFFLSLFFCTVSAIFHVDFTLAFGRGGFVVYWMTT
Sbjct: 361 FHAMLSPLLKPKHIILYRLVTSWATYFFLSLFFCTVSAIFHVDFTLAFGRGGFVVYWMTT 420

Query: 421 WILMGAVGGANENVLSILLAYCPQYLGFWLISWIIINISASFVPLVLANRFYRYGYMTPI 480
           WILMGAVGGANENVLSILLAYCPQYLGFWLISWIIINISASFVPLVLANRFYRYGYMTPI
Sbjct: 421 WILMGAVGGANENVLSILLAYCPQYLGFWLISWIIINISASFVPLVLANRFYRYGYMTPI 480

Query: 481 YNAMEIYRVIFTDTYKGDMGRNYGILAAWCVLNTLLFPFVMKIVGQKFMND 531
           YNAMEIYRVIFTDTYKGDMGRNYGILAAWCVLNTLLFPFVMKIVGQKFMND
Sbjct: 481 YNAMEIYRVIFTDTYKGDMGRNYGILAAWCVLNTLLFPFVMKIVGQKFMND 531

>Sklu_2316.3 , Contig c2316 10494-11957 reverse complement
          Length = 487

 Score =  469 bits (1208), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 237/495 (47%), Positives = 321/495 (64%), Gaps = 24/495 (4%)

Query: 40  MNAESSADEESQGFAGNESGRKSRTPSLAMVGEDNQDQSTSDEQAESVEEFNKESANIDD 99
           M++  + + ES GF    +G +            NQ +    +QA+S      +S     
Sbjct: 1   MSSSFATEPESLGFKEVAAGEQQSL---------NQFEQRCLDQAQS----EHDSVRTSL 47

Query: 100 KNEEQNDGSPAEAGQPALGRVKTRFFSSKLSTHRNIFARRFALNCFLLGSLAIAMFSLYW 159
                NDG        +L R+ T FFS +L   R     +F  N   L +L I++FSLYW
Sbjct: 48  SEVASNDGG-------SLQRMATSFFSPRLQAQRKHVWFQFLFNILALAALTISVFSLYW 100

Query: 160 GALYNHSSDYHNVKFIAVVEDDGDMGAGVIPIMDSAIPQFFVYNTSSFRDKYG-QDVNIS 218
           GALYN +S    V+ +AV++DDG +   +  I+D+    + VY +  F+ KY   +  I 
Sbjct: 101 GALYNRNSHLGKVRILAVIQDDGSLPGALPAIIDANPGGWHVYTSEQFQSKYHINETQID 160

Query: 219 EKVHHLVHTKKFWGSLIVYPGTTDAFVDSLTTDDAPAFNSTDYFEFFYKTARDLSNMRAS 278
            K+ HLVHT+KFW SL V P  T+A  +SL    A  F +++YFE  Y++ RD +N R+S
Sbjct: 161 SKIEHLVHTQKFWMSLNVKPNATNALHESLQNPSADPFVASNYFEAIYESGRDPTNFRSS 220

Query: 279 IVPLLTSIETTYKKTFFYNDYFPSVIA--NITNISGPNLSAAGDMNWKQIDNRPFTDYTL 336
           I+PLL  +E +++K +  + Y P +++  N++N S  NL+AAG++ +   D RPF++Y L
Sbjct: 221 ILPLLQEVELSFQKNY-TSSYLPELLSHTNLSNASPANLAAAGNLEFCSEDMRPFSNYVL 279

Query: 337 LGPMQVGLIYCILLTFFQLALFGPFHAMLSPLLKPKHIILYRLVTSWATYFFLSLFFCTV 396
           LGP+QVGLI+C+LLTFFQLA+FGP H M+SP LKP HI++YR   S   YFFLSLFFCTV
Sbjct: 280 LGPLQVGLIFCVLLTFFQLAMFGPLHGMVSPKLKPAHILIYRYCISMTAYFFLSLFFCTV 339

Query: 397 SAIFHVDFTLAFGRGGFVVYWMTTWILMGAVGGANENVLSILLAYCPQYLGFWLISWIII 456
           SAIF VDFT  FGR GF+VYWM+TW++M AVGGANENVLS++L Y  QYLGFWL+ WI+ 
Sbjct: 340 SAIFQVDFTPTFGRAGFMVYWMSTWLIMAAVGGANENVLSLILPYGAQYLGFWLVFWIVS 399

Query: 457 NISASFVPLVLANRFYRYGYMTPIYNAMEIYRVIFTDTYKGDMGRNYGILAAWCVLNTLL 516
           NIS SF PL L N FYRYGYM PI+NAM+IY+VIF +TYKG +GRNYGIL AW V+N++L
Sbjct: 400 NISPSFFPLALMNNFYRYGYMMPIHNAMDIYKVIFLNTYKGTLGRNYGILCAWVVINSIL 459

Query: 517 FPFVMKIVGQKFMND 531
           F  V+KIVG K   +
Sbjct: 460 FVPVLKIVGNKMKQN 474

>Kwal_55.22106
          Length = 495

 Score =  463 bits (1191), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 226/436 (51%), Positives = 297/436 (68%), Gaps = 11/436 (2%)

Query: 97  IDDKNEEQNDGSPAEAGQPALGRVKTRFFSSKLSTHRNIFARRFALNCFLLGSLAIAMFS 156
           +D +NE           +  L RV T FFS ++   R     RF LN FLL  L +++FS
Sbjct: 43  LDPENEAGATEGELRRVESKLSRVVTGFFSDRVKGERRKLIMRFLLNHFLLAMLIMSVFS 102

Query: 157 LYWGALYNHSSDYHNVKFIAVVEDDGDMGAGV---IPIMDSAIP-QFFVYNTSSFRDKYG 212
           LYWGA Y  S   H VK +AVV+D+   G G+   IP +    P  + VYNTSSF+ KYG
Sbjct: 103 LYWGATYQRSKHMHKVKILAVVQDEPGTGTGIASSIPTLAEQAPGTWHVYNTSSFQQKYG 162

Query: 213 --QDVNISEKVHHLVHTKKFWGSLIVYPGTTDAFVDSLTTDDAPAFNSTDYFEFFYKTAR 270
             QD  +  K+  LVH +K+W SL V P  T   ++SL    A  FNS+ +FE FY++ R
Sbjct: 163 VAQD-EVDAKIQQLVHDQKYWVSLNVKPNATSTLIESLQNSRASPFNSSAFFELFYESGR 221

Query: 271 DLSNMRASIVPLLTSIETTYKKTFFYNDYFPSVIANITNISG---PNLSAAGDMNWKQID 327
           D +N+++SI+P+  S+E+ Y+   + +   P +++NIT   G    N++ AG+M + Q+D
Sbjct: 222 DPTNLKSSILPIALSLESRYQ-NIYASTILPGILSNITQRVGDVSRNVAMAGNMVFAQVD 280

Query: 328 NRPFTDYTLLGPMQVGLIYCILLTFFQLALFGPFHAMLSPLLKPKHIILYRLVTSWATYF 387
           NRPF DY LLGP+QVGLIYCILLTFFQLALFGP HA+L   LKP H++LYR V ++  YF
Sbjct: 281 NRPFNDYVLLGPLQVGLIYCILLTFFQLALFGPIHALLGQKLKPVHMLLYRYVIAFVNYF 340

Query: 388 FLSLFFCTVSAIFHVDFTLAFGRGGFVVYWMTTWILMGAVGGANENVLSILLAYCPQYLG 447
           FLSLFFC VS  F VDFT AFGR GF+V WM++W+LM AVGGANEN+L+I++A+ PQYLG
Sbjct: 341 FLSLFFCLVSLAFQVDFTKAFGRAGFMVAWMSSWLLMAAVGGANENMLTIIMAFGPQYLG 400

Query: 448 FWLISWIIINISASFVPLVLANRFYRYGYMTPIYNAMEIYRVIFTDTYKGDMGRNYGILA 507
           FWLI W+++NIS +F P+ L + FYRYGYMTPIYN + I+RV F D Y+G +GRNYGIL 
Sbjct: 401 FWLIFWVVLNISPAFYPMELTHNFYRYGYMTPIYNGVGIFRVTFLDLYRGHLGRNYGILC 460

Query: 508 AWCVLNTLLFPFVMKI 523
           AW VLN  +FPFVMK+
Sbjct: 461 AWIVLNMAIFPFVMKL 476

>YGR197C (SNG1) [2147] chr7 complement(892500..894143) Probable
           transport protein, confers resistance to MNNG and
           nitrosoguanidine [1644 bp, 547 aa]
          Length = 547

 Score =  429 bits (1102), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 214/472 (45%), Positives = 307/472 (65%), Gaps = 25/472 (5%)

Query: 75  QDQSTSDEQAESVEEFNKESANIDDKNEEQNDGSPAEAGQPALGRVKTRFFSSKLSTHRN 134
           +D    DE+  S+    +  AN ++K    NDG P       L R++T  FS +L  HR 
Sbjct: 53  EDYRPPDEKPSSLSSVGEGGANEEEKG--GNDGGP-------LARIQTGLFSPRLRNHRK 103

Query: 135 IFARRFALNCFLLGSLAIAMFSLYWGALYNHSSDYHNVKFIAVVEDDGDMGA-----GVI 189
               +F LN F +  + +++ S+YWGA Y     +  VK I V++D     +      +I
Sbjct: 104 KILSKFVLNNFFIACVCVSLISIYWGACYGTDRYFFKVKNIVVLQDAPSNTSVQSISAII 163

Query: 190 PIMDSAIP-QFFVYNTSSFRDKYG--QDVNISEKVHHLVHTKKFWGSLIVYPGTTDAFVD 246
           P + +++P  + +YN +SF  K+G      I  K+  L++ +++W +L V P  TD   +
Sbjct: 164 PSLLASVPGTWHIYNATSFHRKFGTTNSTEIDRKIVDLIYDERYWLALNVKPNATDTLYN 223

Query: 247 SLTTDDAPA-FNSTDYFEFFYKTARDLSNMRASIVPLLTSIETTYKKTFFYNDYFPSVIA 305
           SL + DA + FNS+ +FE  +++ RD S+++++I+PL+  +E   +K ++  +Y PS+++
Sbjct: 224 SLISQDANSEFNSSIFFESVFESGRDPSSVKSTILPLMQQLEVRLQK-YYVKEYLPSLMS 282

Query: 306 NIT------NISGPNLSAAGDMNWKQIDNRPFTDYTLLGPMQVGLIYCILLTFFQLALFG 359
           NIT      NI+  N + AG + +   D RPF D  L+ P+QVGLIYCILLT  QL+L+G
Sbjct: 283 NITSNDRDLNINMENWAIAGQLLFTYNDYRPFADRILMAPLQVGLIYCILLTVLQLSLYG 342

Query: 360 PFHAMLSPLLKPKHIILYRLVTSWATYFFLSLFFCTVSAIFHVDFTLAFGRGGFVVYWMT 419
             H  ++ +LKPKHI++YRL+ SWATYF LS+ FCTVSAIF +DFT AFGRGGFVVYWM+
Sbjct: 343 KLHGEMARVLKPKHILIYRLLISWATYFLLSIGFCTVSAIFRIDFTPAFGRGGFVVYWMS 402

Query: 420 TWILMGAVGGANENVLSILLAYCPQYLGFWLISWIIINISASFVPLVLANRFYRYGYMTP 479
           TW++M AVGGANENVLS+++AYCP YL  WL++WII+NISASF P+VL N FYRYGY+ P
Sbjct: 403 TWLVMMAVGGANENVLSLVIAYCPPYLSIWLMTWIILNISASFYPMVLNNEFYRYGYIMP 462

Query: 480 IYNAMEIYRVIFTDTYKGDMGRNYGILAAWCVLNTLLFPFVMKIVGQKFMND 531
           I+NA++IY+VIF +  K  MGRNYGIL AW  LNT L PF MK  G+K   +
Sbjct: 463 IHNAVDIYKVIFLNLTKRKMGRNYGILVAWVALNTSLMPFCMKFAGKKMQKN 514

>Scas_617.3
          Length = 541

 Score =  412 bits (1058), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 215/510 (42%), Positives = 317/510 (62%), Gaps = 33/510 (6%)

Query: 38  QYMNAESSADEESQGFAGNESGRKSRTPSLAMVGEDNQDQSTSDEQAESVEEFN--KESA 95
           Q  N  S  DEESQ      S + +   S +         + S  QA + +  N  K + 
Sbjct: 33  QQANMTSVTDEESQ-INDTNSEKDAAKGSNSYAVNSFSSAAGSQPQAYNPDGQNTAKPAV 91

Query: 96  NIDDKNEEQNDGSPAEAGQPALGRVKTRFFSSKLSTHRNIFARRFALNCFLLGSLAIAMF 155
              ++NEE    SP           KTR +S KL++ R     +F ++  LL  + +++ 
Sbjct: 92  TQPEENEENVPISPT----------KTRLYSPKLASQRKKITVKFIISNLLLAGVCLSIL 141

Query: 156 SLYWGALYNHSSDYHNVKFIAVVEDD------GDMGAGVIPI---MDSAIPQFFVYNTSS 206
           SLYWG+LY  +     +  IA+++DD       ++ + V P+   ++ +  ++ VYN S 
Sbjct: 142 SLYWGSLYQTTKHLERISIIAIIQDDYIPPNDLNLTSVVAPVPSFIEQSTGKWHVYNQSY 201

Query: 207 FRDKYG-QDVN-ISEKVHHLVHTKKFWGSLIVYPGTTDAFVDSLTTDDAPAFNSTDYFEF 264
           F++K+  QD   I+E+++ L+H +K+W +L +    T   V+SLTT + P FNST +   
Sbjct: 202 FQEKFNVQDPTMINERLNALIHDEKYWIALNIGANLTMRIVNSLTTPNEPFFNSTQHIRV 261

Query: 265 FYKTARDLSNMRASIVPLLTSIETTYKKTFFYNDYFPSVIANITNISGPNLSAAGDMNWK 324
            Y+T+R+ + + A ++P++  IE  Y+  F++ +Y P +++ + N +   LS  G  N  
Sbjct: 262 VYETSREPTTLEAYMLPIIQEIELAYQD-FYHTEYLPELLSKLQNSTTTPLSNTGAANLA 320

Query: 325 QI--------DNRPFTDYTLLGPMQVGLIYCILLTFFQLALFGPFHAMLSPLLKPKHIIL 376
            I        D   F D  L+ P+QVGLIYC++LT FQL+LFGP HA ++  LKPKHII+
Sbjct: 321 NIGKFQFDYDDILVFPDRILIAPLQVGLIYCLILTVFQLSLFGPLHAEMAKYLKPKHIII 380

Query: 377 YRLVTSWATYFFLSLFFCTVSAIFHVDFTLAFGRGGFVVYWMTTWILMGAVGGANENVLS 436
           YRL  SWATYFFLSLFFCTVSAIF +DFT+ FG+GGFV+YWMTT+++M A+GGANENVLS
Sbjct: 381 YRLSVSWATYFFLSLFFCTVSAIFQIDFTVTFGKGGFVIYWMTTYLVMLALGGANENVLS 440

Query: 437 ILLAYCPQYLGFWLISWIIINISASFVPLVLANRFYRYGYMTPIYNAMEIYRVIFTDTYK 496
           +++ + P+YL  WL+SWII+NIS +F P+VL N FYRYGYM P++ A++I++V+F +  K
Sbjct: 441 LIILFIPEYLPLWLLSWIIMNISPTFNPMVLDNVFYRYGYMMPLHQALDIFKVVFLNVSK 500

Query: 497 GDMGRNYGILAAWCVLNTLLFPFVMKIVGQ 526
             MGRNYGIL AW V+NT LFP VMKIVG+
Sbjct: 501 RHMGRNYGILVAWIVVNTCLFPLVMKIVGK 530

>CAGL0G09273g 885374..887011 similar to sp|P46950 Saccharomyces
           cerevisiae YGR197c SNG1 or sp|P47090 Saccharomyces
           cerevisiae YJR015w, hypothetical start
          Length = 545

 Score =  397 bits (1019), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 188/420 (44%), Positives = 284/420 (67%), Gaps = 18/420 (4%)

Query: 128 KLSTHRNIFARRFALNCFLLGSLAIAMFSLYWGALYNHSSDYHNVKFIAVVEDD-----G 182
           KL +H+++ A +F     LL ++ +++  +YWGA Y        V  ++V++D       
Sbjct: 109 KLESHKSVLAFQFCFTNVLLATVCLSIICIYWGAAYRTEHYLFKVNILSVIQDQDYNNIQ 168

Query: 183 DMGAGVIPIMDSAIPQFFVYNTSSFRDKYGQDVNISE----KVHHLVHTKKFWGSLIVYP 238
            M + +  ++D     + +YN SSF +KYG + N SE    K+  L+  +K+W SL V  
Sbjct: 169 SMASTLPALIDQTPGTWHLYNRSSFVEKYGIE-NTSEAVDKKITDLIFEEKYWMSLNVKT 227

Query: 239 GTTDAFVDSLTTDDAPAFNSTDYFEFFYKTARDLSNMRASIVPLLTSIETTYKKTFFYND 298
           G T+A  +SLT + APAFNS+ YFE  +++ RD +N++++I+P++  ++  Y + ++ + 
Sbjct: 228 GATEALYNSLTDNTAPAFNSSAYFECMFESGRDPTNLKSAILPIMQQLQAAYVQ-YYTST 286

Query: 299 YFPSVIANIT-------NISGPNLSAAGDMNWKQIDNRPFTDYTLLGPMQVGLIYCILLT 351
           Y PS++ N++       +++  +L+ +G+  +  ID RPF D  LL P+QVGLI+ ++LT
Sbjct: 287 YLPSMLRNVSATINSIGDVNPLSLANSGNFEFNYIDYRPFFDRVLLAPLQVGLIFTLILT 346

Query: 352 FFQLALFGPFHAMLSPLLKPKHIILYRLVTSWATYFFLSLFFCTVSAIFHVDFTLAFGRG 411
             QL+L+GP HA +  + KPKH +LYR   SW+TYF LSLFFCTVSAI+ +DFTLAFGRG
Sbjct: 347 VVQLSLYGPMHAKMVRVFKPKHFLLYRYGLSWSTYFILSLFFCTVSAIYQIDFTLAFGRG 406

Query: 412 GFVVYWMTTWILMGAVGGANENVLSILLAYCPQYLGFWLISWIIINISASFVPLVLANRF 471
           GFV+YW+TT+ +M A+G  NENV+S+++AYCPQY+  WLISWII+NIS SF P+VL N+F
Sbjct: 407 GFVIYWITTFYVMLAIGATNENVISLIVAYCPQYMPIWLISWIILNISPSFYPMVLNNQF 466

Query: 472 YRYGYMTPIYNAMEIYRVIFTDTYKGDMGRNYGILAAWCVLNTLLFPFVMKIVGQKFMND 531
           YRYGY  P++NA++IYRVIF D  +  +GRNYGIL AW  +  ++FPFVMKI G K  ++
Sbjct: 467 YRYGYAMPLHNAVDIYRVIFLDLSRNKLGRNYGILTAWVAVTHIIFPFVMKIAGTKMKSN 526

>Scas_647.9
          Length = 449

 Score =  367 bits (942), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 181/407 (44%), Positives = 258/407 (63%), Gaps = 18/407 (4%)

Query: 140 FALNCFLLGSLAIAMFSLYWGALYNHSSDYHNVKFIAVVEDDGDMGAGVIPIMDSAIPQF 199
           FA    +L      +F L+WG  Y  +  YH V+ +AV++D+G   + V+P M S +P  
Sbjct: 12  FAFTNGVLAVFCFTIFVLFWGINYRITDKYHRVQILAVIQDEGINNSTVLP-MASILPTL 70

Query: 200 F--------VYNTSSFRDKYGQDVN--ISEKVHHLVHTKKFWGSLIVYPGTTDAFVDSLT 249
                    +YNT+SF +K+G +    I ++V H V ++ +W +L V P  T A  ++  
Sbjct: 71  MQENPATWHLYNTTSFNEKFGTNSTEAIDKEVIHEVFSEHYWMALNVKPNATQALFETFI 130

Query: 250 TDDAPAFNSTDYFEFFYKTARDLSNMRASIVPLLTSIETTYKKTFFYNDYFP------SV 303
             + P FNST+YF+  + +ARD SN R +++PL+  +ET Y+  ++ N YFP      S+
Sbjct: 131 NPNGPPFNSTEYFQAVFLSARDPSNFRVTLLPLIEFLETAYRN-YYINTYFPQFMSNVSI 189

Query: 304 IANITNISGPNLSAAGDMNWKQIDNRPFTDYTLLGPMQVGLIYCILLTFFQLALFGPFHA 363
             N+T ++  N++ AG MN+   D RPFT+  L+ P+ +G+ YC+LLTFFQ  ++   HA
Sbjct: 190 ANNLTTVNVTNIALAGAMNFDYFDYRPFTERELIAPVMIGVAYCLLLTFFQFLVYSGLHA 249

Query: 364 MLSPLLKPKHIILYRLVTSWATYFFLSLFFCTVSAIFHVDFTLAFGRGGFVVYWMTTWIL 423
             S LLKP  +I YR++  W T F  SLFFCT SAIF VDFT AFG+GGFVVYWMTTW+ 
Sbjct: 250 ETSRLLKPNQVIYYRIIMLWCTMFIASLFFCTTSAIFQVDFTRAFGKGGFVVYWMTTWLF 309

Query: 424 MGAVGGANENVLSILLAYCPQYLGFWLISWIIINISASFVPLVLANRFYRYGYMTPIYNA 483
           M A GG NEN +S+L    P++LG W++S+II+NI+ +F PL+LAN  YRYGYM P++NA
Sbjct: 310 MVACGGTNENAVSLLFLMGPRFLGIWILSFIILNITPTFYPLILANPVYRYGYMMPVHNA 369

Query: 484 MEIYRVIFTDTYKGDMGRNYGILAAWCVLNTLLFPFVMKIVGQKFMN 530
           ++IYRVIF D  K  MGRN+G+L AW  +NT   PFV K V +   N
Sbjct: 370 IDIYRVIFLDLSKHKMGRNFGLLIAWIAMNTAALPFVYKFVSKILTN 416

>CAGL0B03949g complement(387861..389759) similar to sp|P46950
           Saccharomyces cerevisiae YGR197c SNG1 or sp|P47090
           Saccharomyces cerevisiae YJR015w, hypothetical start
          Length = 632

 Score =  371 bits (952), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 183/426 (42%), Positives = 265/426 (62%), Gaps = 19/426 (4%)

Query: 119 RVKTRFFSSKLSTHRNIFARRFALNCFLLGSLAIAMFSLYWGALYNHSSDYHNVKFIAVV 178
           + KT  FS ++  HR     +F     LL    I   SLYWGA+YN+S + + V  IAV+
Sbjct: 166 KKKTSLFSKRMKDHRRRILAKFISTHILLAIFVIGALSLYWGAIYNYSGNLYRVHSIAVI 225

Query: 179 EDDGDMG--AGVIP--------IMDSAIPQFFVYNTSSFRDKYG--QDVNISEKVHHLVH 226
           +D+        VIP        I++S    + + N++ F+  Y       I EKV  L+ 
Sbjct: 226 QDEPYTAPDGTVIPALTRNVTNIINSIPGNWRIMNSTEFKVIYNVTNAQEIDEKVAELIF 285

Query: 227 TKKFWGSLIVYPGTTDAFVDSLTTDDAPAFNSTDYFEFFYKTARDLSNMRASIVPLLTSI 286
            +KFW ++ V  G T+AF  S+T + AP FNST+YF+  Y++ RD +N+++SI P+L   
Sbjct: 286 DEKFWLAVNVREGATEAFYKSVTEEGAPVFNSTNYFQSIYESGRDPTNLKSSIYPILAKF 345

Query: 287 ETTYKKTFFYNDYFPSVIANITN------ISGPNLSAAGDMNWKQIDNRPFTDYTLLGPM 340
           E+ ++  +    Y P  I NIT+      ++  NL   G+      D RPFTD  LLGP+
Sbjct: 346 ESVFRSQYL-KIYVPEFIKNITSPDFNETVNTANLYGLGNFATNSYDLRPFTDRVLLGPL 404

Query: 341 QVGLIYCILLTFFQLALFGPFHAMLSPLLKPKHIILYRLVTSWATYFFLSLFFCTVSAIF 400
            +GL Y I+ + F +++FGP +  ++  LKP+ +  YR++ SW+ +FFLSLF CTVSAIF
Sbjct: 405 SMGLNYNIMFSVFSISIFGPVNKEMAKYLKPRSLFFYRILISWSMFFFLSLFTCTVSAIF 464

Query: 401 HVDFTLAFGRGGFVVYWMTTWILMGAVGGANENVLSILLAYCPQYLGFWLISWIIINISA 460
            +DFT  FG+ GFV+YWMT+W++M AVG ANEN+LSI+L +CPQY+ +W+I W I+NI+ 
Sbjct: 465 QIDFTPGFGKAGFVIYWMTSWLVMTAVGMANENILSIILTFCPQYMSYWMIIWTILNIAP 524

Query: 461 SFVPLVLANRFYRYGYMTPIYNAMEIYRVIFTDTYKGDMGRNYGILAAWCVLNTLLFPFV 520
           S  PLVL +RFYR+GY  PI+N ++IYRVIF D  +  M RNYGILAAW  +NT + PFV
Sbjct: 525 SLYPLVLISRFYRFGYAMPIHNGVQIYRVIFLDISRHQMSRNYGILAAWVAVNTAINPFV 584

Query: 521 MKIVGQ 526
            K + +
Sbjct: 585 NKFISK 590

>YJR015W (YJR015W) [2918] chr10 (462635..464167) Protein with
           similarity to Sng1p and multidrug resistance proteins
           [1533 bp, 510 aa]
          Length = 510

 Score =  348 bits (893), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 201/499 (40%), Positives = 295/499 (59%), Gaps = 41/499 (8%)

Query: 54  AGNESGRKSRTPSLAMVGEDNQDQSTSDEQAESVEEFNKESANIDDKNEEQNDGSPAEAG 113
           A  E  R++    L+ V  D   Q   D   ++ +       N +DK          +A 
Sbjct: 18  ADEEYCRRNDIHDLSSVVGDAVSQGVPDMDGQTTDSSKDPEPNSEDK----------KAF 67

Query: 114 QPALGRVKTRFFSSKLSTHRNIFARRFALNCFLLGSLAIAMFSLYWGALYNHSSDYHNVK 173
            P+ G     FFS  L   R     +F     LL  +   MF L+WGALY+ S   H VK
Sbjct: 68  PPSSGS----FFSPNLQGQRKKVLLKFVFTNCLLAIICFTMFVLFWGALYDTSKYLHKVK 123

Query: 174 FIAVVEDD-----GDMGAGVIPIMDSAIPQFF--------VYNTSSFRDKYGQDVN---- 216
            + V+++       +  + V+P +  A+P F         +YN+ +F+ K+  DVN    
Sbjct: 124 LLVVIQEPPVVILDNNSSMVVPSISYALPTFINKIPCDWDIYNSPTFQAKF--DVNTPQQ 181

Query: 217 ISEKVHHLVHTKKFWGSLIVYPGTTDAFVDSLTTDDAPAFNSTDYFEFFYKTARDLSNMR 276
           +++KV  LV+ +K+W ++ + P  T+   +SL  D AP FNST + +  Y+T RD +N++
Sbjct: 182 VNDKVVDLVYDEKYWFAINIKPNATETLFESLINDTAPLFNSTLFNQVVYETGRDPTNLK 241

Query: 277 ASIVPLLTSIETTYKKTFFYNDYFPSVIANITNI-------SGPNLSAAGDMNWKQIDNR 329
           ++I+P+  +IE  Y  TF+  +Y P ++ NIT +       +   ++AAG  N++  D+R
Sbjct: 242 STILPVAQTIEE-YYHTFYTLNYLPPLLTNITQVYRYALTNNARYIAAAGKYNYEYYDHR 300

Query: 330 PFTDYTLLGPMQVGLIYCILLTFFQLALFGPFHAMLSPLLKPKHIILYRLVTSWATYFFL 389
           PFTD  LL P Q+G++YC+LLTFFQ  L+GP H  ++ +L+P + ++YR+  SW T+FF 
Sbjct: 301 PFTDRILLAPTQIGVVYCLLLTFFQFLLYGPLHVEMAKVLRPANGLIYRIAMSWFTFFFA 360

Query: 390 SLFFCTVSAIFHVDFTLAFGRGGFVVYWMTTWILMGAVGGANENVLSILLAYCPQYLGFW 449
           SLFFCT +AIF VDFT +FGRGGFVVYWM+TW+ M A GGANEN + +++   PQYLGFW
Sbjct: 361 SLFFCTTTAIFQVDFTKSFGRGGFVVYWMSTWLFMLAAGGANENAVMLVITLGPQYLGFW 420

Query: 450 LISWIIINISASFVPLVLANRFYRYGYMTPIYNAMEIYRVIFTDTYKGDMGRNYGILAAW 509
           ++S++I+NI+ SF PL L N  YRYGYM P++N ++IYRVIF D  +  MGRNYGIL A 
Sbjct: 421 ILSFVILNIAPSFFPLALNNNVYRYGYMMPVHNVIDIYRVIFFDVTRRKMGRNYGILVAL 480

Query: 510 CVLNTLLFPFVMKIVGQKF 528
             LNT L PFV K   +K 
Sbjct: 481 IALNTALLPFVGKYASRKL 499

>CAGL0B03971g complement(390700..392331) similar to sp|P47090
           Saccharomyces cerevisiae YJR015w or sp|P46950
           Saccharomyces cerevisiae YGR197c SNG1, hypothetical
           start
          Length = 543

 Score =  328 bits (842), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 188/519 (36%), Positives = 281/519 (54%), Gaps = 38/519 (7%)

Query: 27  EGVAFDAAKDGQYMNAESSADEESQGFAGNESGRKSRTPSLAMVGEDNQDQSTSDEQAES 86
           +G+   A  +  Y + E   DE   G            PS+ +  E++   S  D   E+
Sbjct: 25  DGIYDGALPELNYADREELNDEHYGG-----------APSIPLEDEESIRTSNEDYSEEA 73

Query: 87  VEEFNKESANIDDKNEEQNDGSPAEAGQP----ALGRVKTRFFSSKLSTHRNIFARRFAL 142
                K+        E    G P +   P     L + KTRFFS      R   A R+ L
Sbjct: 74  -----KDPQAYAPGPEGDEKGKPTQNNNPEPTNTLTKTKTRFFSPNFKDQRKRVAYRWLL 128

Query: 143 NCFLLGSLAIAMFSLYWGALYNHSSDYHNVKFIAVVEDDG-----------DMGAGVIPI 191
             FLL      +  L WG LY         K +AV+++D             + + +  I
Sbjct: 129 AVFLLMCFCFTILVLMWGVLYRTPHYVRRAKVLAVIQEDQVYRFNDTVQFPSVSSPLYDI 188

Query: 192 MDSAIPQFFVYNTSSFRDKYGQD--VNISEKVHHLVHTKKFWGSLIVYPGTTDAFVDSLT 249
           +      + +YN +SF+ KY  +    +++KV  LV+ ++FW +L V    TD  V SL 
Sbjct: 189 IAEVPLSWEIYNATSFQIKYNVEGIEAMNQKVIDLVYKEEFWLALNVQGNVTDTLVRSLI 248

Query: 250 TDDAPA-FNSTDYFEFFYKTARDLSNMRASIVPLLTSIETTYKKTFFYNDYFPSVIANIT 308
           + D+   FNST  FE  Y++ RD++N+ + ++P+   IE  ++K + Y  Y P ++ NIT
Sbjct: 249 SADSDVQFNSTSLFEVVYESGRDITNLPSVLLPVFQGIEGVFQKVYTY-QYLPQLLGNIT 307

Query: 309 N---ISGPNLSAAGDMNWKQIDNRPFTDYTLLGPMQVGLIYCILLTFFQLALFGPFHAML 365
           N    +   ++AAG M +   D RP TD   L   Q+G +YC+LLT FQ  +FGP H  +
Sbjct: 308 NGDNFNPARVAAAGRMKFNYNDYRPVTDRVTLLSTQIGAVYCLLLTVFQFLVFGPLHGEM 367

Query: 366 SPLLKPKHIILYRLVTSWATYFFLSLFFCTVSAIFHVDFTLAFGRGGFVVYWMTTWILMG 425
           S ++K  ++ +YRL+  W+  FF+S+F+CTVSA++ VDFT AFGR GFVVYWM+T++ M 
Sbjct: 368 SRMIKFSNLWIYRLIVLWSVLFFVSIFWCTVSAMYQVDFTKAFGRAGFVVYWMSTYLYML 427

Query: 426 AVGGANENVLSILLAYCPQYLGFWLISWIIINISASFVPLVLANRFYRYGYMTPIYNAME 485
           AVGG NENV+ +++   P Y+GFW++S++I+N++ +F  +  AN FYRYGY  P++  + 
Sbjct: 428 AVGGLNENVIMLIILISPSYIGFWILSFVILNLAPAFFAIGYANVFYRYGYAMPLHCIVG 487

Query: 486 IYRVIFTDTYKGDMGRNYGILAAWCVLNTLLFPFVMKIV 524
           I RVIF D  K  +GRNYGIL AW  LNT+  PFV K V
Sbjct: 488 INRVIFFDISKHQLGRNYGILCAWVGLNTISMPFVSKFV 526

>ADL193C [1548] [Homologous to ScYGR197C (SNG1) - NSH]
           (357909..359306) [1398 bp, 465 aa]
          Length = 465

 Score =  326 bits (835), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 182/466 (39%), Positives = 273/466 (58%), Gaps = 16/466 (3%)

Query: 70  VGEDNQDQSTSDEQAESVEEFNKESANIDDKNEEQNDGSPAEAGQPALGRVKTRFFSSKL 129
           V ED       D + ESV+ +  E      KN E+        G+  L R+KTRF S ++
Sbjct: 3   VQEDESTDFEDDSRTESVQMYLGEYP----KNAEREGSGEMLGGK--LARLKTRFMSPRV 56

Query: 130 STHRNIFARRFALNCFLLGSLAIAMFSLYWGALYNHSSDYHNVKFIAVVED-DGDMGAGV 188
              R      F  N   L  L + +FSL+ G L N       +  + VV+D D  M A +
Sbjct: 57  YLARKRLLVLFLSNKLFLACLVLVVFSLHVGVLVNQQQYLGRLPMLMVVQDEDAGMSAEL 116

Query: 189 IPIMDSAIPQFFVYNTSSFRDKYG--QDVNISEKVHHLVHTKKFWGSLIVYPGTTDAFVD 246
           +   + A  ++   + ++    +G  +D ++ E +  L+   ++W +L V PG T+A   
Sbjct: 117 LRAAEHAAGRWTTVHGAAAWSHFGLEEDADLDEYLQSLIRKHRYWMALHVRPGATEALRR 176

Query: 247 SLTTDDAPAFNSTDYFEFFYKTARDLSNMRASIVPLLTSIETTYKKTFFYNDYFPSVI-- 304
           SL    AP FNS+++F+ +Y+T RD + M  S+  L+ ++E  ++  ++ + + P  +  
Sbjct: 177 SLDDPGAPVFNSSEFFKVYYETVRDFNAM-GSVRKLMETLEANFR-AYYLDTWLPGELRE 234

Query: 305 -ANITNIS--GPNLSAAGDMNWKQIDNRPFTDYTLLGPMQVGLIYCILLTFFQLALFGPF 361
            AN  ++S  G N+ AAG M W  +D  PF D +L G +QVG+I C+LLTFFQLA+    
Sbjct: 235 RANTIDLSSTGSNIVAAGSMRWSYVDLGPFYDPSLYGILQVGMIICLLLTFFQLAMISAL 294

Query: 362 HAMLSPLLKPKHIILYRLVTSWATYFFLSLFFCTVSAIFHVDFTLAFGRGGFVVYWMTTW 421
           H  LS LL+  H++LYR + S+A+Y  LSLF+  V  I+H+D   A+GR GF+V+WMTTW
Sbjct: 295 HTELSLLLRTSHLLLYRYIVSYASYLLLSLFYSIVPIIYHLDMEKAYGRAGFLVFWMTTW 354

Query: 422 ILMGAVGGANENVLSILLAYCPQYLGFWLISWIIINISASFVPLVLANRFYRYGYMTPIY 481
           + M A+GGANENV+S++  YCP+++GFWL+ WI+ NI+ +F  L LAN FY+YGY+TPIY
Sbjct: 355 LFMTALGGANENVISVIFEYCPRFVGFWLMFWIVFNITPTFYSLHLANDFYKYGYITPIY 414

Query: 482 NAMEIYRVIFTDTYKGDMGRNYGILAAWCVLNTLLFPFVMKIVGQK 527
           NA E Y+V+  DT +G +   Y +L AW VLN  LFP  +KIV  K
Sbjct: 415 NARECYKVLLFDTDRGYLKVAYVVLVAWTVLNAALFPLALKIVNIK 460

>Scas_434.1
          Length = 357

 Score =  140 bits (353), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 89/305 (29%), Positives = 165/305 (54%), Gaps = 28/305 (9%)

Query: 78  STSDEQAESVEEFNKESANIDDKNEEQNDGSPAEAGQPALGRVKTRFFSSKLSTHRN-IF 136
           +TSDE+ ++  +  + S +         D +   A  P L   KT  FS  L+ HR  IF
Sbjct: 59  TTSDEEKQNPLKERRTSLS----QHPGEDEAITIASLPELAPAKTTLFSPHLTQHRKKIF 114

Query: 137 ARRFALNCFLLGSLAIAMFSLYWGALYNHSSDYHNVKFIAVVEDDG-DMGAGVIPIMDSA 195
            +  ++N  ++G     +  ++WG LY  +  +H V ++ VV+D+   +G   +P M S 
Sbjct: 115 WKFISINA-IIGLFCCTVLPIFWGCLYGTNQYFHKVHYLMVVQDEPLQLGGLSVPSMASF 173

Query: 196 IPQ--------FFVYNTSSFRDKY--GQDVNISEKVHHLVHTKKFWGSLIVYPGTTDAFV 245
           +P+        + VYNTS+F D Y      +I+ KV  L+  ++FW ++ V P  T + +
Sbjct: 174 LPEIVPSLPGTWHVYNTSTFMDHYHLTNASDINNKVVDLIFQERFWVAVNVKPNATASLM 233

Query: 246 DSL----TTDDAPAFNSTDYFEFFYKTARDLSNMRASIVPLLTSIETTYKKTFFYNDYFP 301
            SL    +T     FN+T++F+  Y+TARD+++++A++V ++  +E+ Y++  +   Y P
Sbjct: 234 QSLVQPQSTTPETLFNATNFFQVIYETARDVTSVQAAMVLVVQEMESAYRE-IYMEQYLP 292

Query: 302 SVIA------NITNISGPNLSAAGDMNWKQIDNRPFTDYTLLGPMQVGLIYCILLTFFQL 355
           +++A       I++++  +LS A ++N++  D R F +  L+GP+  G IY + +T FQ 
Sbjct: 293 TILAQMDPTNQISSLAPTSLSRATNINFQYWDYRSFYNRALMGPLLAGTIYSLTITVFQF 352

Query: 356 ALFGP 360
            +F P
Sbjct: 353 LIFTP 357

>Scas_617.0d
          Length = 46

 Score = 64.7 bits (156), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 27/41 (65%), Positives = 32/41 (78%)

Query: 486 IYRVIFTDTYKGDMGRNYGILAAWCVLNTLLFPFVMKIVGQ 526
           +Y+VIF D  +  MGRNYGIL AW VLNT LFPF+MK VG+
Sbjct: 2   VYKVIFCDLERSKMGRNYGILVAWIVLNTCLFPFIMKFVGK 42

>AER444W [2944] [Homologous to ScYIL166C - NSH]
           complement(1487859..1489502) [1644 bp, 547 aa]
          Length = 547

 Score = 33.5 bits (75), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 64/146 (43%), Gaps = 29/146 (19%)

Query: 380 VTSWATYFF--------LSLFFCTVSAIFHVDFTLAFGRGGFVVYWMTTWILMGAVGGAN 431
           +T W +YF+        +SLFF T+S   H+  +L    G F ++ M    L    G   
Sbjct: 196 LTLWLSYFYTSRELAVRVSLFFATMSTA-HMMTSL----GAFGIFRMRG--LCNLAGWQW 248

Query: 432 ENVLSILLAYCPQYLGFWLISWIIINISASFVPLVL--ANRFYRYGYMTPIYNAMEIYRV 489
             +L  L+  C   +G+ L+           VP ++   N+ YR G+ +     + + RV
Sbjct: 249 MFLLEGLITLCIGMIGYMLV-----------VPSIVQTKNKLYRKGWFSESEMLIAVNRV 297

Query: 490 IFTDTYKGDMGRNYGILAAWCVLNTL 515
           +  D  KGDM    G L+    LNTL
Sbjct: 298 LRDDPSKGDMHNRQG-LSLGAFLNTL 322

>Scas_699.18
          Length = 650

 Score = 33.5 bits (75), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 64/138 (46%), Gaps = 25/138 (18%)

Query: 58  SGRK-SRTPSLAMVGEDNQDQSTSDEQA-ESVEEFNKESANIDDKNEEQNDGSPAEAGQP 115
           S RK SR  SL+ V ++ ++++ S+ QA +SV+EF  +    +   E Q +     AG  
Sbjct: 3   SRRKVSRRQSLSRVHDEKREKNGSEGQATDSVKEFQDQDNGDEQYVEHQRNKIIRHAG-- 60

Query: 116 ALGRVKTRFFSSKLSTHRNIFARRFALNCFLLGSLAIAMFSLYWGALYNHSSD---YHNV 172
                K R+  S          RRF    F+LG+    M   Y+GA + HS++   + N+
Sbjct: 61  -----KKRWRDS----------RRF---IFMLGAFLGLMIPFYFGASHVHSNNKDYFDNL 102

Query: 173 KFIAVVEDDGDMGAGVIP 190
                V+D  D    ++P
Sbjct: 103 MNFGSVKDYIDDWKEILP 120

>AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W
           (PMA2) - NSH] (546285..549014) [2730 bp, 909 aa]
          Length = 909

 Score = 32.7 bits (73), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 129 LSTHRNIFARRFALNCFLLG-SLAIAMFSLYWGALYNHSSDYHNVKFIAVVED 180
           L T R IF R ++   + +  SL + +F   W A+ N S + H V FIA+  D
Sbjct: 659 LKTSRQIFHRMYSYVVYRIALSLHLEIFLGLWIAILNQSLNVHLVVFIAIFAD 711

>ACR257C [1304] [Homologous to ScYKR055W (RHO4) - SH]
           (808667..809446) [780 bp, 259 aa]
          Length = 259

 Score = 31.6 bits (70), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 33/70 (47%), Gaps = 4/70 (5%)

Query: 284 TSIETTYKKTFFYNDYFPSVIAN-ITNISGPNLSAAGDMNWKQIDNRPFTDYTLLGPMQV 342
           TS+  +Y +  F  DY P++  N +TNI GP         W   D     +Y+ L P+  
Sbjct: 66  TSLLMSYTQGQFPEDYVPTIFENYVTNIEGPRGKVIELALW---DTAGQEEYSRLRPLSY 122

Query: 343 GLIYCILLTF 352
           G +  +++ +
Sbjct: 123 GDVDIVMVCY 132

>CAGL0A00495g complement(55014..57722) highly similar to sp|P05030
           Saccharomyces cerevisiae YGL008c PMA1 or sp|P19657
           Saccharomyces cerevisiae YPL036w PMA2, hypothetical
           start
          Length = 902

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 1/53 (1%)

Query: 129 LSTHRNIFARRFALNCFLLG-SLAIAMFSLYWGALYNHSSDYHNVKFIAVVED 180
           L T R IF R ++   + +  SL + +F   W  + NHS D   + FIA+  D
Sbjct: 662 LKTSRQIFHRMYSYVVYRIALSLHLELFLGLWIIILNHSLDIELIVFIAIFAD 714

>Sklu_1454.1 YHR004C, Contig c1454 1069-2226 reverse complement
          Length = 385

 Score = 30.8 bits (68), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 2/41 (4%)

Query: 44  SSADEESQ--GFAGNESGRKSRTPSLAMVGEDNQDQSTSDE 82
           S AD+E +  G  GN +G + +TPS+ ++ E++++    DE
Sbjct: 94  SPADDEDERNGEEGNSTGDEEKTPSINIIVEEDEEDLAGDE 134

>YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting
           P-type ATPase of the plasma membrane, expression not
           detected under normal growth conditions [2844 bp, 947
           aa]
          Length = 947

 Score = 30.8 bits (68), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 129 LSTHRNIFARRFALNCFLLG-SLAIAMFSLYWGALYNHSSDYHNVKFIAVVED 180
           L T R IF R ++   + +  SL + +F   W A+ N+S D + + FIA+  D
Sbjct: 707 LKTSRQIFHRMYSYVVYRIALSLHLEIFLGLWIAILNNSLDINLIVFIAIFAD 759

>KLLA0A05643g 528976..529632 similar to sp|Q00246 Saccharomyces
           cerevisiae YKR055w RHO4 GTP-binding protein of the rho
           family, hypothetical start
          Length = 218

 Score = 30.0 bits (66), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 4/58 (6%)

Query: 284 TSIETTYKKTFFYNDYFPSVIAN-ITNISGPNLSAAGDMNWKQIDNRPFTDYTLLGPM 340
           TS+  +Y +  F  DY P++  N +TN+ GPN        W   D     +Y+ L P+
Sbjct: 45  TSLLISYTQGKFPEDYVPTIFENYVTNLEGPNGKIVELALW---DTAGQEEYSRLRPL 99

>Scas_684.2
          Length = 864

 Score = 30.4 bits (67), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 38/88 (43%), Gaps = 11/88 (12%)

Query: 261 YFEFFYKTARDLSNMRASIVPLLTSIETTYKKTFF-------YNDYFPSVIANITNISGP 313
           Y  +F KT      M+ S+  L++ +E  Y            YN   P  I  +  ++ P
Sbjct: 206 YLFYFNKTDEP---MKESVEELISYLEANYNSKIADISLLREYNSNSPYEITELIQVALP 262

Query: 314 NLSAAGDMNWKQIDNRPFTDYTLLGPMQ 341
           N+  A   N +Q+ N  F DY+ L P Q
Sbjct: 263 NIKRALANNMEQL-NDLFIDYSHLLPTQ 289

>KLLA0A05456g 500097..502376 similar to sp|P53313 Saccharomyces
           cerevisiae YGR245c SDA1 required for normal organization
           of the actin cytoskeleton; required for passage through
           Start singleton, start by similarity
          Length = 759

 Score = 30.4 bits (67), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 34/77 (44%)

Query: 26  LEGVAFDAAKDGQYMNAESSADEESQGFAGNESGRKSRTPSLAMVGEDNQDQSTSDEQAE 85
           +EG       D +Y     S DEES+   G++  ++S        GED+  + + DE+  
Sbjct: 549 VEGEWVTIESDKEYEVDMDSDDEESKNKTGHKGKKRSHDEVEPEAGEDSDLELSGDEEEP 608

Query: 86  SVEEFNKESANIDDKNE 102
            V E  KE +   D  E
Sbjct: 609 KVGEEQKEESESADPEE 625

>Scas_688.1
          Length = 913

 Score = 30.0 bits (66), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 129 LSTHRNIFARRFALNCFLLG-SLAIAMFSLYWGALYNHSSDYHNVKFIAVVED 180
           L T R IF R ++   + +  S+ + +F   W A+ N+S D + + FIA+  D
Sbjct: 673 LKTSRQIFHRMYSYVVYRIALSIHLEIFLGLWIAILNNSLDINLIVFIAIFAD 725

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.323    0.138    0.423 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 18,192,088
Number of extensions: 829658
Number of successful extensions: 4195
Number of sequences better than 10.0: 154
Number of HSP's gapped: 4190
Number of HSP's successfully gapped: 174
Length of query: 531
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 425
Effective length of database: 12,926,601
Effective search space: 5493805425
Effective search space used: 5493805425
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 64 (29.3 bits)