Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0D17006g33633114650.0
Kwal_56.2421728960644.5
KLLA0F02706g95664636.5
YDL119C30734626.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D17006g
         (331 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D17006g 1442082..1443092 no similarity, hypothetical start       568   0.0  
Kwal_56.24217                                                          29   4.5  
KLLA0F02706g 245783..248653 gi|14348673|gb|AAK61336.1|AF332582_1...    29   6.5  
YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member o...    28   6.8  

>KLLA0D17006g 1442082..1443092 no similarity, hypothetical start
          Length = 336

 Score =  568 bits (1465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/331 (86%), Positives = 286/331 (86%)

Query: 1   MKNTYCDDYNPQEEVIKLKAFYDKAVKEKQADEALLRRCSIEKEFQSTVESQSNHNKYIL 60
           MKNTYCDDYNPQEEVIKLKAFYDKAVKEKQADEALLRRCSIEKEFQSTVESQSNHNKYIL
Sbjct: 1   MKNTYCDDYNPQEEVIKLKAFYDKAVKEKQADEALLRRCSIEKEFQSTVESQSNHNKYIL 60

Query: 61  KNDSYCLRKGYPKEIFLDIQQLGPANKVFDDRLAKLRNKLAKPSCLDRLKQSLEQKERET 120
           KNDSYCLRKGYPKEIFLDIQQLGPANKVFDDRLAKLRNKLAKPSCLDRLKQSLEQKERET
Sbjct: 61  KNDSYCLRKGYPKEIFLDIQQLGPANKVFDDRLAKLRNKLAKPSCLDRLKQSLEQKERET 120

Query: 121 IPALENGQNIVRSQQESTNVSPSIADKKMENIMNNTTLVKSLLDSFMKXXXXXXXXXXXX 180
           IPALENGQNIVRSQQESTNVSPSIADKKMENIMNNTTLVKSLLDSFMK            
Sbjct: 121 IPALENGQNIVRSQQESTNVSPSIADKKMENIMNNTTLVKSLLDSFMKPSVSIPQNLPPP 180

Query: 181 XXXXXXXXXXXMRNEPQXXXXXXXXXXXXXXXXXXXXXXFSNVVQDLLSVMQPFIQEQKN 240
                      MRNEPQ                      FSNVVQDLLSVMQPFIQEQKN
Sbjct: 181 PIVPIPNDQVDMRNEPQNTLISSENRNNNNSNLINKMENFSNVVQDLLSVMQPFIQEQKN 240

Query: 241 STSIDTAQNNTPIPEAADVQRQPSRFNQRTLPSTTKITHDNVNLNYGFNARKNNKSSQRR 300
           STSIDTAQNNTPIPEAADVQRQPSRFNQRTLPSTTKITHDNVNLNYGFNARKNNKSSQRR
Sbjct: 241 STSIDTAQNNTPIPEAADVQRQPSRFNQRTLPSTTKITHDNVNLNYGFNARKNNKSSQRR 300

Query: 301 RQGQKVQKPRSTENENTKHTPKALKRIQQMA 331
           RQGQKVQKPRSTENENTKHTPKALKRIQQMA
Sbjct: 301 RQGQKVQKPRSTENENTKHTPKALKRIQQMA 331

>Kwal_56.24217
          Length = 289

 Score = 29.3 bits (64), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 30/60 (50%), Gaps = 9/60 (15%)

Query: 272 PSTTKITHDNVNLNYGFNARKNNKSSQRRRQGQKVQKPRSTENENTKHTPKALKRIQQMA 331
           P+   IT+++V+ ++G     N++   R R   K+  P        +H P+ALK   +MA
Sbjct: 89  PTHDDITYESVSSSFGLRCELNSECQDRMR---KISHPE------LRHDPEALKNFYRMA 139

>KLLA0F02706g 245783..248653 gi|14348673|gb|AAK61336.1|AF332582_1
           Kluyveromyces lactis mismatch repair protein Msh2p,
           start by similarity
          Length = 956

 Score = 28.9 bits (63), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 34/64 (53%), Gaps = 6/64 (9%)

Query: 62  NDSYCLRKGYPKEIFLDIQQLGPANKVFDDRLAK--LRNKLAKPS----CLDRLKQSLEQ 115
           NDS    K  P++I L  + L  + KV+   L K  L ++L  PS    C+D+LKQ ++ 
Sbjct: 877 NDSLKKAKLSPEDIVLGTESLKKSLKVWCKELKKNNLIDRLDDPSVQEECVDKLKQQIDN 936

Query: 116 KERE 119
             RE
Sbjct: 937 LARE 940

>YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 28.5 bits (62), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%)

Query: 104 SCLDRLKQSLEQKERETIPALENGQNIVRSQQES 137
           SCL+ ++ SL  K R  +P+L N  NIV ++  S
Sbjct: 79  SCLNLMRSSLA-KRRNAVPSLTNDSNIVYNKSSS 111

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.311    0.126    0.343 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,682,965
Number of extensions: 404569
Number of successful extensions: 1755
Number of sequences better than 10.0: 58
Number of HSP's gapped: 1753
Number of HSP's successfully gapped: 59
Length of query: 331
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 229
Effective length of database: 13,065,073
Effective search space: 2991901717
Effective search space used: 2991901717
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 62 (28.5 bits)