Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0D16940g54053225400.0
Kwal_27.113034793724632e-51
AGL166W4342564462e-49
CAGL0M04477g5633033919e-41
Scas_506.54413853083e-30
YLR141W (RRN5)3632942302e-20
Scas_690.1890422657.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D16940g
         (532 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D16940g 1435379..1437001 some similarities with sp|Q02983 S...   983   0.0  
Kwal_27.11303                                                         182   2e-51
AGL166W [4146] [Homologous to ScYLR141W (RRN5) - SH] complement(...   176   2e-49
CAGL0M04477g 491638..493329 some similarities with sp|Q02983 Sac...   155   9e-41
Scas_506.5                                                            123   3e-30
YLR141W (RRN5) [3550] chr12 (423684..424775) Component of the Up...    93   2e-20
Scas_690.18                                                            30   7.9  

>KLLA0D16940g 1435379..1437001 some similarities with sp|Q02983
           Saccharomyces cerevisiae YLR141w RRN5 RNA polymerase I
           specific transcription initiation factor singleton,
           hypothetical start
          Length = 540

 Score =  983 bits (2540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/532 (91%), Positives = 486/532 (91%)

Query: 1   MSHSAADEIDDDTLDPALRSESQELPLEERLQVEEASELPSDNLSEXXXXXXXXXXYVSE 60
           MSHSAADEIDDDTLDPALRSESQELPLEERLQVEEASELPSDNLSE          YVSE
Sbjct: 1   MSHSAADEIDDDTLDPALRSESQELPLEERLQVEEASELPSDNLSEKKISKKKTKKYVSE 60

Query: 61  MRNAYKSWYLDEAYEFFDPYSQNQDLRKSRIHKDGICKYLQNEDPKPRSREELSGIDDGA 120
           MRNAYKSWYLDEAYEFFDPYSQNQDLRKSRIHKDGICKYLQNEDPKPRSREELSGIDDGA
Sbjct: 61  MRNAYKSWYLDEAYEFFDPYSQNQDLRKSRIHKDGICKYLQNEDPKPRSREELSGIDDGA 120

Query: 121 XXXXXXXXXXXXXXXGGYLQNQGLGSLWTGREKQVFFHNLSRHSIHTLDAWSSHIPGKSK 180
                          GGYLQNQGLGSLWTGREKQVFFHNLSRHSIHTLDAWSSHIPGKSK
Sbjct: 121 SDSDLDFSDEEERRSGGYLQNQGLGSLWTGREKQVFFHNLSRHSIHTLDAWSSHIPGKSK 180

Query: 181 YEILIYYQVLRKNLEELRRLQTKRHGGILEYGEFPIAYEMSETWITLEEELSNEVDEQVP 240
           YEILIYYQVLRKNLEELRRLQTKRHGGILEYGEFPIAYEMSETWITLEEELSNEVDEQVP
Sbjct: 181 YEILIYYQVLRKNLEELRRLQTKRHGGILEYGEFPIAYEMSETWITLEEELSNEVDEQVP 240

Query: 241 LNQEEATNTEISDPVAVIDWSNWYKRWDKFYARHRLLEYYPTNRRPNVFTPESMQIMELL 300
           LNQEEATNTEISDPVAVIDWSNWYKRWDKFYARHRLLEYYPTNRRPNVFTPESMQIMELL
Sbjct: 241 LNQEEATNTEISDPVAVIDWSNWYKRWDKFYARHRLLEYYPTNRRPNVFTPESMQIMELL 300

Query: 301 VRRYTSNLLRETIIPSLEKKCVPRDLLMSQKTFKDARMKKLRSTCNITKTIXXXXXXXGS 360
           VRRYTSNLLRETIIPSLEKKCVPRDLLMSQKTFKDARMKKLRSTCNITKTI       GS
Sbjct: 301 VRRYTSNLLRETIIPSLEKKCVPRDLLMSQKTFKDARMKKLRSTCNITKTIQDDQDDDGS 360

Query: 361 LVIQTSNHEFPHIVTENDVISALVRLRLYNKGKLFLTYPESIVDSVDKFQIEMERGKIFR 420
           LVIQTSNHEFPHIVTENDVISALVRLRLYNKGKLFLTYPESIVDSVDKFQIEMERGKIFR
Sbjct: 361 LVIQTSNHEFPHIVTENDVISALVRLRLYNKGKLFLTYPESIVDSVDKFQIEMERGKIFR 420

Query: 421 NKNVLRHLKVLLYLQSSRIHSKQLTFSRTDEKIDWEGDLXXXXXXXXXXXXXXPSLNKKR 480
           NKNVLRHLKVLLYLQSSRIHSKQLTFSRTDEKIDWEGDL              PSLNKKR
Sbjct: 421 NKNVLRHLKVLLYLQSSRIHSKQLTFSRTDEKIDWEGDLNSANNSNNSIDNADPSLNKKR 480

Query: 481 KPLDPIFVDTPEYKKQKLQDESIDKDDELRSIKYTHTLLTWMNLSRDSVAEQ 532
           KPLDPIFVDTPEYKKQKLQDESIDKDDELRSIKYTHTLLTWMNLSRDSVAEQ
Sbjct: 481 KPLDPIFVDTPEYKKQKLQDESIDKDDELRSIKYTHTLLTWMNLSRDSVAEQ 532

>Kwal_27.11303
          Length = 479

 Score =  182 bits (463), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 117/372 (31%), Positives = 187/372 (50%), Gaps = 57/372 (15%)

Query: 65  YKSWYLDEAYEFFDPYSQNQDLRKSRIHKDGICKYLQNEDPKPRSREELSGIDDGAXXXX 124
           Y + + +E   F +P  +N +L  S IH +   ++        R   +L   DD      
Sbjct: 12  YFNVFNNELSTFMEPLGRNSELEGSYIHVNSRVRW-------ARGDSDLDEEDD------ 58

Query: 125 XXXXXXXXXXXGGYLQNQG---------LGSLWTGREKQVFFHNLSRHSIHTLDAWSSHI 175
                        Y+ ++G         LG  W+  EK++FFH LSR SIH L+ W  HI
Sbjct: 59  -------------YMTDEGECQDEEDDELGVYWSIEEKELFFHYLSRSSIHRLEEWCVHI 105

Query: 176 PGKSKYEILIYYQVLRKNLEELRRLQTKRHGGILEYGEFPIAYEMSETWITLEEELSNEV 235
           P KS+YEIL YY+VL+ NL  L+RL +K HG IL  GEFPIAYEM E ++ LEE +S   
Sbjct: 106 PSKSRYEILAYYEVLQANLLSLKRLDSKSHGRILTKGEFPIAYEMDEFFVELEETMSARA 165

Query: 236 DEQVPLNQEEATNTEISDPV---AVIDWSNWYKRWDKFYARHRLLEYYPTNRRPNVFTPE 292
           DE++ + +EE+ N    DP     +ID+ NW KRW+  Y+R  + E+ P +R     +  
Sbjct: 166 DEKLRILEEESFNA--LDPANNDCMIDFGNWEKRWNPIYSRLGVEEFQPASREALPISAH 223

Query: 293 SMQIMELLVRRYTSNLLRETIIPSLEKKCVPRDLLMSQKTFKDARMKKLRSTCNITKTIX 352
           +M+ +  LV +Y   LL  T++P L++K       ++    +D          +I   I 
Sbjct: 224 AMEALNQLVEKYLRRLLWFTVLPRLDQK------FLANGDIQDG-------IVSIKSDIH 270

Query: 353 XXXXXXGSLVIQTSNHEFPHIVTENDVISALVRLRLYNKGKLFLTYPESIVDSVDKFQIE 412
                   ++    + + PH+V  +DV++ L  +R  N     L   E+++D++ KF++ 
Sbjct: 271 DEDDEF--IICTKGDDKLPHVVKRDDVLNGLTLMRQENLAAPALA--ETVLDTLRKFELN 326

Query: 413 MERGKIFRNKNV 424
            E G++FR+  +
Sbjct: 327 YEEGRLFRSTEI 338

>AGL166W [4146] [Homologous to ScYLR141W (RRN5) - SH]
           complement(385345..386649) [1305 bp, 434 aa]
          Length = 434

 Score =  176 bits (446), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 105/256 (41%), Positives = 138/256 (53%), Gaps = 30/256 (11%)

Query: 65  YKSWYLDEAYEFFDPYSQNQDLRKSRIHKDGICKYLQNEDPKPRS-------REELSGID 117
           Y   +  E    FDP+    + R S +H     +YLQ+ D +  S        E  SG D
Sbjct: 25  YSEIFNQEVQRVFDPHWHKNEFRDSVVHLSSKVRYLQDTDEEHDSDARSDSGAESDSGDD 84

Query: 118 DGAXXXXXXXXXXXXXXXGGYLQNQGLGSLWTGREKQVFFHNLSRHSIHTLDAWSSHIPG 177
            G                G  L +  LG+ W+ REKQVFFH L+R SIH LD W+  +P 
Sbjct: 85  SG-------------DVRGQLLSSGELGTFWSAREKQVFFHWLARCSIHRLDEWAPRLPD 131

Query: 178 KSKYEILIYYQVLRKNLEELRRLQTKRHGGILEYGEFPIAYEMSETWITLEEELS----N 233
           KSKYEIL YY VL+ NL++L+R+ TK+ GGIL     PIAYEM   ++ LEEE S    +
Sbjct: 132 KSKYEILAYYHVLKSNLQDLKRMNTKKRGGILTKRALPIAYEMDPFFVQLEEEYSLLIHS 191

Query: 234 EVDEQVPLNQEEATNTEISDPVAVIDWSNWYKRWDKFYARHRLLEYYPTNRRPNVFTPES 293
           E +  V L  E     ++ D   V++W NWYKRWD  Y+ HRL EY P  R+P  F+ +S
Sbjct: 192 ETENVVKLEDE----ADLED--GVVNWENWYKRWDPLYSHHRLGEYQPAARQPLPFSRQS 245

Query: 294 MQIMELLVRRYTSNLL 309
             ++E LVR YT  LL
Sbjct: 246 ELLVERLVRAYTRRLL 261

>CAGL0M04477g 491638..493329 some similarities with sp|Q02983
           Saccharomyces cerevisiae YLR141w RRN5, hypothetical
           start
          Length = 563

 Score =  155 bits (391), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 100/303 (33%), Positives = 168/303 (55%), Gaps = 19/303 (6%)

Query: 140 QNQGLGSLWTGREKQVFFHNLSRHSIHTLDAWSSHIPGKSKYEILIYYQVLRKNLEELRR 199
           ++  +G+ WT  EK+ FF+ +SR+SIH +D W      KSKYEIL+YYQVLR NLE+L+ 
Sbjct: 104 EDDDMGTEWTRYEKEQFFYCMSRYSIHRVDEWCQTFTNKSKYEILVYYQVLRSNLEQLK- 162

Query: 200 LQTKRHGGILEYGEFPIAYEMSETWITLEEELSNEVDEQVPLNQEEATNTEISD-PVAVI 258
             T R+  +L    FPIAYEMS  +I LEE L  +V++ V L++  +    + D   ++I
Sbjct: 163 --TTRYKRLLPRSRFPIAYEMSPEFIRLEEMLCEQVND-VVLHKAGSDEGSVEDNEDSII 219

Query: 259 DWSNWYKRWDKFYARHRLLEYYPTNRRPNVFTPESMQIMELLVRRYTSNLLRETIIPSLE 318
           D   W  RW+  YA   + E  P +  P    PE+++ +  LV+R+T  LL  +++PSLE
Sbjct: 220 DIEKWNARWEPLYANTHIEELRPISIEPLPIAPEAIRYLTELVKRHTRKLLWHSVLPSLE 279

Query: 319 KKCVPRDLLMSQKTFKDARMKKLRSTCNITKTIXXXXXXXGSLVIQTSNHE--FPHIVTE 376
              + +  L+ ++  K    K+  +  +I +              +  +H   +PH +T 
Sbjct: 280 SARISKAALLGRQAEKRQAEKRPLAEEDIIEIQAHP---------RKKHHRDYYPHEITR 330

Query: 377 NDVISALVRLRLYNKGKLF-LTYPESIVDSVDKFQIEME-RGKIFRNKNVLRHLKVLLYL 434
            DV+ A++ L+     + + LT  E ++D++ K++IE   +G++F +K++ +   VL  L
Sbjct: 331 EDVLQAVITLKQEGSTQTYPLTLGECVLDTIKKYEIETSTQGRLFHSKDIAKQ-SVLSNL 389

Query: 435 QSS 437
            SS
Sbjct: 390 VSS 392

>Scas_506.5
          Length = 441

 Score =  123 bits (308), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 111/385 (28%), Positives = 166/385 (43%), Gaps = 79/385 (20%)

Query: 65  YKSWYLDEAYEFFDP-YSQNQDLRKSRIHKDGICKYLQNEDPKPRSREELSGIDDGAXXX 123
           Y   + +E  EFF+  +  + +LR SRIH D   KYL+ E+ K        GI       
Sbjct: 12  YFEQFNNEVDEFFNADFQVDYELRASRIHVDSKIKYLEREEAK-------KGITPDVEDD 64

Query: 124 XXXXXXXXXXXXGGYLQNQGLGSLWTGREKQVFFHNLSRHSIHTLDAWSSHI--PGKSKY 181
                               LG  W+ REK++FFH LSR+SIH LD W   +    KSKY
Sbjct: 65  DDDEAKNKKPI--------PLGVHWSSREKRLFFHYLSRYSIHRLDEWYRKVGSGSKSKY 116

Query: 182 EILIYYQVLRKNLEELRRLQT--KR----HGGILEYGEFPIAYEMSETWITLEEELSNEV 235
           E+L YY+VLR NL  ++R  T  KR      GIL   + PIAYEMSE+++ LEE ++   
Sbjct: 117 EVLTYYRVLRSNLHAIKRRNTIDKRKKGLFAGILRRKDLPIAYEMSESFVQLEETMA--- 173

Query: 236 DEQVPLNQEEATNTEISDPVAVIDWSNWYKRWDKFYARHRLLEYYPTNRRPNVFTPESMQ 295
              +P   +   +   SD   +I    W +RW      H +L   PT        P S++
Sbjct: 174 -ASLPTGIDAVYSETPSDETQLITLQPWERRW------HSVLRRSPTVSTQQSALPVSVE 226

Query: 296 IMELLVR---RYTSNLLRETIIPSLEKKCVPRDLLMSQKTFKDARMKKLRSTCNITKTIX 352
             + L R   R+   ++  T++P LE+K +      + +   D    KL +         
Sbjct: 227 AYDYLTRLAKRHLRQVIYSTVLPQLERKAI------AVRDKDDDNSDKLHTV-------- 272

Query: 353 XXXXXXGSLVIQTSNHEFPHIVTENDVISALVRLRLYNK-GKLFLTYPESIVDSVDKFQI 411
                              H+VT  DV++ + RLRL  +  K      E+ + ++ KF++
Sbjct: 273 -------------------HLVTRRDVLTGIHRLRLMLRDTKRVPLLAETWLQTLSKFEL 313

Query: 412 EMER--------GKIFRNKNVLRHL 428
           ++          G I RN   L  L
Sbjct: 314 QISESKNKSNLSGSIIRNSRTLNDL 338

>YLR141W (RRN5) [3550] chr12 (423684..424775) Component of the
           Upstream Activation Factor (UAF) complex, involved in
           activation of RNA polymerase I [1092 bp, 363 aa]
          Length = 363

 Score = 93.2 bits (230), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 85/294 (28%), Positives = 123/294 (41%), Gaps = 53/294 (18%)

Query: 144 LGSLWTGREKQVFFHNLSRHSIHTLDAWSSHIPGKSKYEILIYYQVLRKNLEELRRLQTK 203
           +G  W   EK  FF  LSR+SIH +D W S +P KS  EIL YY++LR+     R  +  
Sbjct: 58  VGVDWDSEEKNTFFWCLSRYSIHRVDEWRSLLPRKSAMEILGYYRLLRRASASARSRKAG 117

Query: 204 RHGGILEYGEFPIAYEMSETWITLEEELSNEVDEQVPLNQEEATNTEISDPVAVIDWSNW 263
             G        PIAYEMS  W+ LE +LS  V   +     E  + E      +ID+ +W
Sbjct: 118 DDGA-------PIAYEMSAEWVALETKLSETV-MAITEGAAEVADEE-GHCEGLIDYESW 168

Query: 264 YKRWDKFYARHRLLEYYPTNRRPNVFTPESMQIMELLVRRYTSNLLRETIIPSLEKKCVP 323
            +RW   Y+  R+ E  P  R     +  + Q +E  V RYT  LL  T +  +  + V 
Sbjct: 169 KRRWVAIYSHSRIAEIRPLPRHALPLSRSATQTLERCVSRYTRTLLWCTALAGMASRSV- 227

Query: 324 RDLLMSQKTFKDARMKKLRSTCNITKTIXXXXXXXGSLVIQTSNHEFPHIVTENDVISAL 383
                       AR  + R                        +   P +VT   V  AL
Sbjct: 228 -----------SARAAESR-----------------------GHKSLPTVVTRRQVERAL 253

Query: 384 VRLRLYNKGKLFLTYPESIVDSVDKFQIEMER-GKIFRNKNVLRHLKVLLYLQS 436
                  + +     P  IV ++ K++++  R GK+FR K +       L+LQS
Sbjct: 254 C---TEARSRDLHVLPRRIVLTLRKWELDYPREGKLFRTKEMAH-----LFLQS 299

>Scas_690.18
          Length = 904

 Score = 29.6 bits (65), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 18/22 (81%)

Query: 393 KLFLTYPESIVDSVDKFQIEME 414
           K+FL YPE++ D+ DKF +++E
Sbjct: 187 KVFLQYPEALRDNFDKFALKLE 208

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.133    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 17,341,427
Number of extensions: 745329
Number of successful extensions: 2426
Number of sequences better than 10.0: 12
Number of HSP's gapped: 2450
Number of HSP's successfully gapped: 13
Length of query: 532
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 426
Effective length of database: 12,926,601
Effective search space: 5506732026
Effective search space used: 5506732026
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)