Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0D16918g68267135110.0
Sklu_1665.169966011231e-144
Kwal_27.113017006269891e-124
CAGL0M04455g7116038361e-101
AGL167C7276377401e-87
Scas_506.67426095623e-62
YLR139C (SLS1)6436494112e-42
Kwal_27.1209039473790.19
Scas_704.343873770.32
YDL131W (LYS21)440117770.34
YDL182W (LYS20)42873770.37
KLLA0F05489g44173760.49
CAGL0J06402g43173750.49
CAGL0J09240g43773750.63
Scas_701.3543073730.87
KLLA0E23782g39373711.9
Kwal_56.2440144173693.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D16918g
         (671 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D16918g complement(1432797..1434845) weakly similar to sp|P...  1357   0.0  
Sklu_1665.1 YLR139C, Contig c1665 672-2771                            437   e-144
Kwal_27.11301                                                         385   e-124
CAGL0M04455g complement(489048..491183) weakly similar to sp|P42...   326   e-101
AGL167C [4145] [Homologous to ScYLR139C (SLS1) - SH] (382880..38...   289   1e-87
Scas_506.6                                                            221   3e-62
YLR139C (SLS1) [3549] chr12 complement(421543..423474) Protein i...   162   2e-42
Kwal_27.12090                                                          35   0.19 
Scas_704.3                                                             34   0.32 
YDL131W (LYS21) [738] chr4 (227393..228715) Homocitrate synthase...    34   0.34 
YDL182W (LYS20) [690] chr4 (133438..134724) Homocitrate synthase...    34   0.37 
KLLA0F05489g 541146..542471 highly similar to sp|Q12122 Saccharo...    34   0.49 
CAGL0J06402g complement(608851..610146) highly similar to sp|Q12...    33   0.49 
CAGL0J09240g 911669..912982 highly similar to sp|Q12122 Saccharo...    33   0.63 
Scas_701.35                                                            33   0.87 
KLLA0E23782g complement(2105401..2106582) highly similar to sp|Q...    32   1.9  
Kwal_56.24401                                                          31   3.4  

>KLLA0D16918g complement(1432797..1434845) weakly similar to
           sp|P42900 Saccharomyces cerevisiae YLR139c SLS1
           suppresses lethality of SSM4 deletion singleton,
           hypothetical start
          Length = 682

 Score = 1357 bits (3511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 658/671 (98%), Positives = 658/671 (98%)

Query: 1   MALMAHLRFSLVVPFRLVGVTRHLHCTARALAQEGSENEISXXXXXXXXXXXXXQDHFLV 60
           MALMAHLRFSLVVPFRLVGVTRHLHCTARALAQEGSENEIS             QDHFLV
Sbjct: 1   MALMAHLRFSLVVPFRLVGVTRHLHCTARALAQEGSENEISLLLSKHGKKLKPKQDHFLV 60

Query: 61  LTPHQTGVMRLPRKSKTLQSNSHLSILEGFDFKRHTENGTNHSQVRDVDILSNIQDTTSK 120
           LTPHQTGVMRLPRKSKTLQSNSHLSILEGFDFKRHTENGTNHSQVRDVDILSNIQDTTSK
Sbjct: 61  LTPHQTGVMRLPRKSKTLQSNSHLSILEGFDFKRHTENGTNHSQVRDVDILSNIQDTTSK 120

Query: 121 LMKFKEQEDNEQMAKAIDSCKPSSEAISEKRYLQLEKVLDEQFTLQQLRNYCYLKHGVRK 180
           LMKFKEQEDNEQMAKAIDSCKPSSEAISEKRYLQLEKVLDEQFTLQQLRNYCYLKHGVRK
Sbjct: 121 LMKFKEQEDNEQMAKAIDSCKPSSEAISEKRYLQLEKVLDEQFTLQQLRNYCYLKHGVRK 180

Query: 181 ARIPKKNLIPTIITKLWNCSIDYNKSEHDDLIVENEISLETRDIYLLLLTKNGRILQNLA 240
           ARIPKKNLIPTIITKLWNCSIDYNKSEHDDLIVENEISLETRDIYLLLLTKNGRILQNLA
Sbjct: 181 ARIPKKNLIPTIITKLWNCSIDYNKSEHDDLIVENEISLETRDIYLLLLTKNGRILQNLA 240

Query: 241 RIGATIAVVIDENKLVVRATSHIFKYVEVSISRILENVVSDDFSIEEFIKDHSQIDGVHH 300
           RIGATIAVVIDENKLVVRATSHIFKYVEVSISRILENVVSDDFSIEEFIKDHSQIDGVHH
Sbjct: 241 RIGATIAVVIDENKLVVRATSHIFKYVEVSISRILENVVSDDFSIEEFIKDHSQIDGVHH 300

Query: 301 MTPEEIIALMQTQSSSYVEITDDSKYKISTIGRKNMNIINSLLLWVLNYNPQTTEILVPY 360
           MTPEEIIALMQTQSSSYVEITDDSKYKISTIGRKNMNIINSLLLWVLNYNPQTTEILVPY
Sbjct: 301 MTPEEIIALMQTQSSSYVEITDDSKYKISTIGRKNMNIINSLLLWVLNYNPQTTEILVPY 360

Query: 361 DGGEKTEQYPLTNYEWINWVARKQSWHRIQQPVAINQEIKDTKIDLSEKIDKIWDILEIN 420
           DGGEKTEQYPLTNYEWINWVARKQSWHRIQQPVAINQEIKDTKIDLSEKIDKIWDILEIN
Sbjct: 361 DGGEKTEQYPLTNYEWINWVARKQSWHRIQQPVAINQEIKDTKIDLSEKIDKIWDILEIN 420

Query: 421 KTKCAKPLAFTETKSLSIAFGHILENAQNKILFQSKIPEVVPKVLRLPLWDKDGYVEDDL 480
           KTKCAKPLAFTETKSLSIAFGHILENAQNKILFQSKIPEVVPKVLRLPLWDKDGYVEDDL
Sbjct: 421 KTKCAKPLAFTETKSLSIAFGHILENAQNKILFQSKIPEVVPKVLRLPLWDKDGYVEDDL 480

Query: 481 FSVDQHLYLVQMKFVPNLADVSHKVNVSPLEVWFTLDENNNADTSTVRCIHTYSDNSACI 540
           FSVDQHLYLVQMKFVPNLADVSHKVNVSPLEVWFTLDENNNADTSTVRCIHTYSDNSACI
Sbjct: 481 FSVDQHLYLVQMKFVPNLADVSHKVNVSPLEVWFTLDENNNADTSTVRCIHTYSDNSACI 540

Query: 541 QTPTLSHDFKITVTDTVDALPEDLESSEFFDWLQREQPSFRKFLQESNFSFGGLKKPRIA 600
           QTPTLSHDFKITVTDTVDALPEDLESSEFFDWLQREQPSFRKFLQESNFSFGGLKKPRIA
Sbjct: 541 QTPTLSHDFKITVTDTVDALPEDLESSEFFDWLQREQPSFRKFLQESNFSFGGLKKPRIA 600

Query: 601 PSFELNVKLEGMEEPQKIRYNYLHRYEHRLLRFKYKEDCLVQLSEIEGGSLGGKASSIDF 660
           PSFELNVKLEGMEEPQKIRYNYLHRYEHRLLRFKYKEDCLVQLSEIEGGSLGGKASSIDF
Sbjct: 601 PSFELNVKLEGMEEPQKIRYNYLHRYEHRLLRFKYKEDCLVQLSEIEGGSLGGKASSIDF 660

Query: 661 ISTNGSINKDI 671
           ISTNGSINKDI
Sbjct: 661 ISTNGSINKDI 671

>Sklu_1665.1 YLR139C, Contig c1665 672-2771
          Length = 699

 Score =  437 bits (1123), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 251/660 (38%), Positives = 394/660 (59%), Gaps = 30/660 (4%)

Query: 22  RHLHCTARALA-QEGSENEISXXXXXXXXXXXXXQDHFLVLTPHQTGVMRLPRKSKTLQS 80
           R L+ T   +  QE S  + S             +   +VL+P Q G+ +  R     + 
Sbjct: 31  RRLYSTQDDIEDQENSTPDGSKLTSTRGKKLKPTKAKIVVLSPKQAGLFKKKRTPGYFKQ 90

Query: 81  NS----HLSILEGFDFKRHTENGTNHSQVRDVDILSNIQDTTSKLMKFKEQEDNEQMAKA 136
           N      L++LEG +  +   N TN S     DIL  I++   KL+ FK     EQ+ ++
Sbjct: 91  NEKRNERLTVLEGVELGKSVSNSTNSS-----DILQQIENQRRKLLVFKGSVPKEQVIQS 145

Query: 137 IDSCKPSSEAISEKRYLQLEKVLDEQFTLQQLRNYC--YLKHGVRKARIPKKNLIPTIIT 194
           I   +P+   +S KRY QL+ +L+  +TL QLR+Y   Y K  V K+  PKK LIP I+ 
Sbjct: 146 IHDLRPTGTQVSSKRYEQLKSLLESAYTLPQLRDYVAQYYKTSVVKS-APKKVLIPRIMN 204

Query: 195 KLWNCSIDYNKSEHDDLIVENEISLETRDIYLLLLTKNGRILQNLARIGATIAVVIDENK 254
           +LW C ID + SE +DLIVE  I LET+DIYLLLLT NG+IL N AR+GAT+AVV++ENK
Sbjct: 205 RLWGCQIDESISEAEDLIVERIIDLETKDIYLLLLTNNGKILYNFARVGATLAVVLNENK 264

Query: 255 LVVRATSHIFKYVEVSISRILENVVSDDFSIEEFIKDHSQIDGVHHMTPEEIIALMQTQS 314
           ++VRATS + KYVEVS+ +IL N+ S+   + + I +H+ ++    +TP E+I+L+Q +S
Sbjct: 265 IIVRATSAMVKYVEVSLRKILSNMQSEVLPVRDIISNHTSLNSNATLTPGEVISLVQKES 324

Query: 315 SSYVE--ITDDSKYKISTIGRKNMNIINSLLLWVLNYNPQTTEILVPYDGGEKTEQ---Y 369
           ++Y E  + +D  Y ++  G K +N   +LLLW +NYNPQ  E  V + G E+      Y
Sbjct: 325 AAYFEEMLDEDGTYTLTAFGDKRVNHAKNLLLWAMNYNPQRVEEHV-FCGNEERSSYKLY 383

Query: 370 PLTNYEWINWVARKQSWHRIQQPV----AINQEIKDTKIDLSE-KIDKIWDIL-EINKTK 423
           P TN E ++W+   + W+R Q+PV    A + + K  K ++S+ K+D++++   + N+  
Sbjct: 384 PFTNIECLDWLESAKEWYRFQRPVSKKMAKDFDEKINKFEMSDKKVDELYNFFTKENRNN 443

Query: 424 CAKPLAFTETKSLSIAFGHILENAQNK-ILFQSKIPEVVPKVLRLPLWDKDGYVEDDLFS 482
            A   +  ++K LSI  G +L  A NK  +FQ KIP++ P++L LPL+D    + D+L++
Sbjct: 444 IATIDSLGDSKVLSITLGQVLITATNKESIFQPKIPQITPRLLELPLYDSMATM-DELYT 502

Query: 483 VDQHLYLVQMKFVPNLADVSHKVNVSPLEVWFTLDENNNADTSTVRCIHTYSDNSACIQT 542
           VDQH Y +Q+KF+P+L+  +   N+ PLE+WF LD+ + A TS+VR +    + +  +QT
Sbjct: 503 VDQHEYYIQLKFIPDLSTTNSGKNIPPLELWFELDDYDKAITSSVRSVVHLEERNVYLQT 562

Query: 543 PTLSHDFKITVTDTVDALPEDLESSEFFDWLQREQPSFRKFLQESNFSFGGLKKPRIAPS 602
           P LSHDFKI + D +  L    E +   +WLQ +QP  ++FL +SN +F G KK  I   
Sbjct: 563 PQLSHDFKINM-DRIGELVRPYEENP-ENWLQ-DQPGLKEFLLKSNLTFQGRKKLVIPKK 619

Query: 603 FELNVKLEGMEEPQKIRYNYLHRYEHRLLRFKYKEDCLVQLSEIEGGSLGGKASSIDFIS 662
             +N+ +EG   P++I ++Y++    R+L+ KY +  LVQ +++ GG  GG+ + +D ++
Sbjct: 620 LVMNLNVEGSNTPEQISFDYVNVKYRRVLKLKYMDKYLVQFTDVNGGPGGGRYTQVDLVN 679

>Kwal_27.11301
          Length = 700

 Score =  385 bits (989), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 235/626 (37%), Positives = 363/626 (57%), Gaps = 36/626 (5%)

Query: 59  LVLTPHQTGVMRLPRKSKTLQSNS----HLSILEGFDFKRHTENGTNHSQVRDVDILSNI 114
           +VL P + G+ +  +       ++     LS LEG ++          SQ  D  IL  I
Sbjct: 67  VVLNPREAGLFKQRQAPGFFNDHTKPRERLSALEGVEYDLRRGQIARQSQTSD-SILQEI 125

Query: 115 QDTTSKLMKFKEQEDNEQMAKAIDSCKPS--SEAISEKRYLQLEKVLDEQFTLQQLRNYC 172
           +    KL+ FK     EQ+ K+I   +PS  S  IS KRY QL+ +L+  +TL QL+ Y 
Sbjct: 126 ESQRRKLLIFKSSVPKEQVVKSIHDLRPSKNSNLISSKRYEQLKSLLEMAYTLPQLKAYA 185

Query: 173 YLKHGVRKARIPK----KNLIPTIITKLWNCSIDYNKSEHDDLIVENEISLETRDIYLLL 228
              +   K ++PK    K +I TI+   W C ID + +   DLI+E  I ++TRDIYLLL
Sbjct: 186 ---NEFYKLKLPKSTTKKAVIKTILQDFWQCEIDESINAGQDLIIERIIDVQTRDIYLLL 242

Query: 229 LTKNGRILQNLARIGATIAVVIDENKLVVRATSHIFKYVEVSISRILENVVSDDFSIEEF 288
           LT NG+IL N AR+GAT+AV + ENK++VRATS + KYVEVS+ +IL+N   +   + E 
Sbjct: 243 LTNNGKILHNFARLGATVAVALSENKIIVRATSALVKYVEVSLRKILDNAQREVIPVCEI 302

Query: 289 IKDHSQIDGVHHMTPEEIIALMQTQSSSYVE--ITDDS-KYKISTIGRKNMNIINSLLLW 345
           I+ H+  D +  ++P+EI+ L+Q +S++Y E  + DDS  Y ++ +G K +     LLLW
Sbjct: 303 IRSHTSYDSI-PVSPKEIVPLVQKESATYFEKMLEDDSDSYVVTGLGEKRLTNAKVLLLW 361

Query: 346 VLNYNPQTTE--ILVPYDGGEKTEQYPLTNYEWINWVARKQSWHRIQQPVAINQ-EIKDT 402
            LNY PQ +E    V  +      ++P T+ + ++W+  K++W+R+QQPV  NQ      
Sbjct: 362 ALNYCPQRSERTRFVSNEDFSAYHRFPFTDVQCLDWIQAKENWYRLQQPVLKNQPPTAAL 421

Query: 403 KIDLSEK-IDKIWDIL--EINKTKCAKPLAFTETKSLSIAFGHILENA-QNKILFQSKIP 458
            ++L E  ID+++  L    N T  AK  A  + K +SI  G +L +  + K  FQSK+P
Sbjct: 422 PVNLPEHIIDELYTELLGSANTTAIAK--AEHDFKIMSITLGQVLHSENEEKTTFQSKVP 479

Query: 459 EVVPKVLRLPLWDKDGY-VEDDLFSVDQHLYLVQMKFVPNLADVSHKVNVSPLEVWFTLD 517
            V  K+L+LPL+  +G+   D+L+SVDQH Y +Q+KF+P L D + K ++ PLE+WF LD
Sbjct: 480 GVTKKLLQLPLY--EGFDTPDELYSVDQHEYFIQLKFIPRL-DGTEKKHIPPLELWFELD 536

Query: 518 ENNNADTSTVRCIHTYSDNSACIQTPTLSHDFKITVTDTVDAL-PEDLESSEFFDWLQRE 576
           +N+ A  ++VR +    D S  +QTP +SHD+KI +  T++ + P D +      WL  +
Sbjct: 537 DNDRAINTSVRALLHAEDTSVYLQTPQISHDYKINIDRTLEVVKPYDQDPQ---TWLH-D 592

Query: 577 QPSFRKFLQESNFSFGGLKKPRIAPSFELNVKLEGMEEPQKIRYNYLHRYEHRLLRFKYK 636
           Q   + +L ++   FGG +K  +  +  LN+  EG  EPQ + ++Y+     R+L+ KY 
Sbjct: 593 QEGLKNYLLQARLDFGGKEKLHMPKTLNLNLHFEGSAEPQSVTFDYVSVMYRRVLKLKYL 652

Query: 637 EDCLVQLSEIEGGSLGGKASSIDFIS 662
           +  LVQ S++ GG+ GGK + IDFI 
Sbjct: 653 DKYLVQFSDLNGGTRGGKYTQIDFIG 678

>CAGL0M04455g complement(489048..491183) weakly similar to sp|P42900
           Saccharomyces cerevisiae YLR139c SLS1 suppresses
           lethality of SSM4 deletion, hypothetical start
          Length = 711

 Score =  326 bits (836), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 208/603 (34%), Positives = 334/603 (55%), Gaps = 31/603 (5%)

Query: 82  SHLSILEGFDFKRHTENGTNHSQVRDVD-ILSNIQDTTSKLMKFKEQEDNEQMAKAIDSC 140
           + LSILEG D    T       + +  D +L  I     KLM F+     EQ  KAI   
Sbjct: 92  TKLSILEGVDLGISTNGSKEEDKEKLTDTVLEEIDQKRRKLMVFRSTVSEEQAVKAIGYQ 151

Query: 141 KPSSEAISEKRYLQLEKVLDEQFTLQQLRNYCYLKHGVRKARIPKKNLIPTIITKLWNCS 200
           KP    +S+KRY QLE +L   +T+ QLR Y     G    +  K  +I  I+ + W C 
Sbjct: 152 KPVKPIMSQKRYEQLENLLKSAYTVNQLRAYSKKMFGPSLFKKSKAFIIKKIMNEYWQCQ 211

Query: 201 IDYNKSEHDDLIVENEISLETRDIYLLLLTKNGRILQNLARIGATIAVVIDENKLVVRAT 260
           +D N +E DDLI+E E+ ++TRD YLLLLT NG+IL NLARIGA +AV  +ENK+++RA+
Sbjct: 212 VDENINEKDDLIIERELDIKTRDTYLLLLTDNGKILHNLARIGAILAVAPEENKIIIRAS 271

Query: 261 SHIFKYVEVSISRILENVVSDDFSIEEFIKDHSQIDGV--HHMTPEEIIALMQTQSSSYV 318
           +++ +YVE+S++RILENV ++   IE+ I+DHS IDG     M  E+II L+Q Q+S Y+
Sbjct: 272 ANVIRYVEISLNRILENVKTEIVPIEKLIRDHS-IDGKLDGDMNVEQIIDLVQKQASVYI 330

Query: 319 EITDDS----KYKISTIGRKNMNIINSLLLWVLNYNPQTTEILVPYDG---GEKTEQYPL 371
           ++  DS    +Y IS  G+K ++     L W   Y P   E  +        EK ++YP 
Sbjct: 331 DLISDSSEEKQYNISAFGKKRIDTAKLYLTWASKYTPHVQEEYITTGDKCMKEKCKEYPY 390

Query: 372 TNYEWINWVARKQSWHRIQQPVAINQEIKDT-KIDLSEKID-----KIWDIL---EINKT 422
           T+ +  NW+ + + W+R+Q P   N+ +  T K++    I+     +I+D L    I+  
Sbjct: 391 TDMDSFNWLDKNKLWYRLQLPE--NKLLGKTDKLEYPPTIEMLDVKRIYDFLTDKNISLK 448

Query: 423 KCAKPLAFTETKSLSIAFGHILENAQNKI-LFQSKIPEVVPKVLRLPLWDKDGYVEDDLF 481
           +   P+  T    +S+  G +L+   + I  F  +IP +   ++ LP +++    E DL 
Sbjct: 449 QKLLPVKGTRQHVISVTMGQLLKAGNSMIRTFLPRIPTISNFLMDLPYFEETH--EGDLS 506

Query: 482 SVDQH-LYLVQMKFVPNLADVSHKVNVSP--LEVWFTLDENNNADTSTVRCIHTYSDNSA 538
            + ++  Y VQ+KF P+L+ +   +   P  +E+WF LD+ +NA  +++ CI + S+ + 
Sbjct: 507 VLGENDDYYVQLKFKPDLSSIPPGIKSYPPNMELWFELDDRDNAIKASMDCIFSVSEKAV 566

Query: 539 CIQTPTLSHDFKITVTDTVDALPEDLESSEFFDWLQREQPSFRKFLQESNFSFGGLKKPR 598
            ++ P    DFKI V+D V +L   LE+ +   WL+  Q   + ++ ++   FG   K  
Sbjct: 567 MLEAPQHPFDFKI-VSDAVVSLNPSLENDDPGQWLE-GQDELKHYVDQAKLDFGQGNKML 624

Query: 599 IAPSFELNVKLEGMEEPQKIRYNYLHRYEHRLLRFKYKEDCLVQLSEIEGGSLGGKASSI 658
           +  S  +N+  E  E   ++RY++++ Y HR+ R K+++  LVQ S I GG+ GG+ + I
Sbjct: 625 LGNSVCVNIPTEE-EGTVQVRYDFVNTYRHRITRLKFRDRFLVQYSNINGGARGGQTNRI 683

Query: 659 DFI 661
           D I
Sbjct: 684 DLI 686

>AGL167C [4145] [Homologous to ScYLR139C (SLS1) - SH]
           (382880..385063) [2184 bp, 727 aa]
          Length = 727

 Score =  289 bits (740), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 186/637 (29%), Positives = 321/637 (50%), Gaps = 39/637 (6%)

Query: 57  HFLVLTPHQTGVMRLPRKSKTLQS-------NSHLSILEGFDFKRHTENGTNHSQVRDVD 109
           HF+VL P QTG+  LP++ +T +S        S  ++    D         +  +V   D
Sbjct: 77  HFIVLDPEQTGL--LPKRGETGRSWRKDREHGSRRNLKTRDDLSEKPAKKQDKEKVTARD 134

Query: 110 ILSNIQDTTSKLMKF-KEQEDNEQMAKAIDSCKPSSEAI--SEKRYLQLEKVLDEQFTLQ 166
           +L  ++ +  K+++  K    +E+    I++ +P   A+  S +R+ QL K L + F+  
Sbjct: 135 LLDALEWSGEKMLREEKRSTSDEETIGVINNMRPDQAALQMSPERFEQLRKALAKSFSYT 194

Query: 167 QLRNYCYLKHGVRKARIPKKNLIPTIITKLWNCSIDYNKSEHDDLIVENEISLETRDIYL 226
           QLR Y    +G++K    KK  +  ++ + W C +D   S+  DLI++  I L  +D+YL
Sbjct: 195 QLRLYASKLYGLKKTNETKKAFVTKVMQECWKCKVDKTISKKQDLIIKRTIDLSQKDMYL 254

Query: 227 LLLTKNGRILQNLARIGATIAVVIDENKLVVRATSHIFKYVEVSISRILENVVSDDFSIE 286
           LL+T  GRILQN+AR GA+IA    ENKL++ A+  +  Y+E SI+ IL ++ S   S+ 
Sbjct: 255 LLMTDGGRILQNMARTGASIAAAFTENKLIIHASKSLATYIEASIASILNSIQSSRLSLY 314

Query: 287 EFIKDHSQIDGVH--HMTPEEIIALMQTQSSSYVEITDD--SKYKISTIGRKNMNIINSL 342
           EF K+H+ +        +PE+++A++  + S + E   +      +S + ++ +     L
Sbjct: 315 EFAKEHTAVQDSRSPQYSPEQLLAMVCRECSVHQEKYPEVPGLVALSALSQEKLAAARQL 374

Query: 343 LLWVLNYNPQTTEILVPYDGGEKTE----QYPLTNYEWINWVARKQSWHRIQQ------P 392
           LLW  +Y P+ T   + + G E  +    +YP+++ EW NW+ RK  W R+QQ      P
Sbjct: 375 LLWAFDYKPEVTTDTI-FCGLEDNQITYAKYPVSDPEWFNWLERKTKWFRLQQVEHRLSP 433

Query: 393 VAINQEIKDTKIDLSEKIDKIWDILEINKTKCAKPLA--FTETKSLSIAFGHIL-ENAQN 449
                      +     +++++D      T     +     E K L ++ G +L + +  
Sbjct: 434 DMSGAAPAPVPVVPENVLNQVYDFCMRQSTGNVAEIQNHAAEAKVLRVSLGQVLTDESGQ 493

Query: 450 KILFQSKIPEVVPKVLRLPLWDKDGYVEDDLFSVDQHLYLVQMKFVPNLADVSHKVNVSP 509
           + +FQ + P +  K+L+L         E D +SVDQH Y +Q+++ P L+    + N+ P
Sbjct: 494 RQMFQPQAPYMNQKLLQL-PLYYPLESEHDYYSVDQHDYFLQLRYAPVLSATGFRYNLPP 552

Query: 510 LEVWFTLDENNNADTSTVRCIHTYSDNSACIQTPTLSHDFKITVTDTVDALPEDLESSEF 569
           LE+WFTL ENN  +  TVRCI+  ++ S  +Q P    D ++T+    + +P   ++S  
Sbjct: 553 LELWFTLGENNRVEPHTVRCINRLAERSVMLQLPGSPVDCRVTLERVSEMVPPGDDASH- 611

Query: 570 FDWLQREQPSFRKFLQESNFSFGGLKKPR-----IAPSFELNVKLEGMEEPQKIRYNYLH 624
            +WL   QP+ +++L     +     + R     +     LNV L G   P  I Y ++ 
Sbjct: 612 -EWLLTHQPALQQYLDRVTPTLDRHLRARMQNVALPDPIHLNVALPG-SPPSPIPYRFVS 669

Query: 625 RYEHRLLRFKYKEDCLVQLSEIEGGSLGGKASSIDFI 661
              HR+L  +Y +   VQLS + GG  GGK S +D +
Sbjct: 670 MAHHRVLSLRYLDKYRVQLSTVSGGPAGGKHSELDVL 706

>Scas_506.6
          Length = 742

 Score =  221 bits (562), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 170/609 (27%), Positives = 286/609 (46%), Gaps = 78/609 (12%)

Query: 109 DILSNIQDTTSKLMKFKEQEDNEQMAKAIDSCKPSSEAISEKRYLQLEKVLDEQFTLQQL 168
           ++L  I+  T+KL+  K      Q+ ++ID  +P +E IS   Y+ L + L   +TL QL
Sbjct: 145 NLLQEIESQTNKLLVSKINVTTPQVIQSIDVQRPITETISHYEYINLVEKLKGSYTLPQL 204

Query: 169 RNYCYLKHGVRKARIPKKNLIPTIITKLWNCSIDYNKSEHDDLIVENEIS---------- 218
           R+Y      +    + K  LI  II K+WNC I  N    D  +  N I           
Sbjct: 205 RSYTKQNFNLSLPHVTKSKLIERIILKMWNCKIVTNGD--DGSLQSNSIEQVSATTNTST 262

Query: 219 -----------LETRDIYLLLLTKNGRILQNLARI-GATIAVVIDENKLVVR-ATSHIFK 265
                      L+  +I LLL T+ G++LQNL RI G TIA  +DENK++++ AT  + +
Sbjct: 263 ASSSYEILTMDLQNTEITLLLFTQRGKLLQNLTRINGLTIAFPLDENKIIIKAATRGVAR 322

Query: 266 YVEVSISRILENVVSDDFSIEEFIKDHSQIDGVHHMTPEEIIALMQTQSSSYVEITD--- 322
           YVEVSI +IL NV+++  +I+  ++  S       +  +++I L+++ + +  E  +   
Sbjct: 323 YVEVSIRKILSNVINEFVNIDHLLQGMSST-----LNLKDLINLIESHTDTVFEKIENDN 377

Query: 323 ------DSKYKISTIGRKNMNIINSLLLW-VLNYNPQTTE---ILVPYDGGEKT---EQY 369
                  + +KIS  G++ + +   LL+W   N +  T E    ++P      T   ++Y
Sbjct: 378 NGNTNNKTIFKISAFGQRRIELAKKLLIWGTYNDHSMTNEQILAVLPSSLNGNTNNLKKY 437

Query: 370 PLTNYEWINWVARKQSWHRIQQPV--AINQEIKDTKIDLS-EKIDKIWDILEINKTKCAK 426
           P  + +  +W+ +   W R+Q P+       +    + LS   +D I+ +    +    +
Sbjct: 438 PYNDIDAFDWLHKDNEWTRLQIPLKKGTMTTVPQEPLTLSITNMDSIYQMFAPQQEDSQE 497

Query: 427 PLAFTETKSLSIAFG-HILENAQNKILFQSKIPEVVPKVLRLPLWDKDGYVEDDLFSVDQ 485
              +    S+S+ +    L N +    FQ KIP++  ++L LPL+D     +D+LFS+D+
Sbjct: 498 KSMY----SMSLGYSLQALSNGKTIQYFQPKIPQLASRLLNLPLYD-SSLTQDELFSIDK 552

Query: 486 HLYLVQMKFVPNL---ADVSHKVNVSPLEVWFTLDENNNADTSTVRCIHTYSDNSACIQT 542
           H Y VQ+KF+PN    A    K+   P+E+WF LDE  +    ++RCI   +  S  +QT
Sbjct: 553 HEYYVQLKFIPNTLVSASFDSKITYPPVELWFELDEEGHPIMDSLRCIAQLNKKSMILQT 612

Query: 543 PTLSHDFKITVTDTVDALPEDLES---------------SEFFDWLQREQPSFRKFLQES 587
           PT   D+ I +   +D L     +               S         Q    +FL+ S
Sbjct: 613 PTAPFDYAINMESYIDLLEPTATTLKTSSSSSSSSSSSSSSSSSSFLTSQDGINQFLKNS 672

Query: 588 NFSFGGLKKPR-----IAPSFELNVKLEGMEEPQKIRYNYLHRYEHRLLRFKYKEDCLVQ 642
             +F    K +     +  S  +N+      + Q + Y YL  + H +LR KY +  +VQ
Sbjct: 673 TLNFQTNNKDKKNKLLLPNSMNVNISKNPTSKTQMVNYKYLITHHHSVLRLKYLDKYMVQ 732

Query: 643 LSEIEGGSL 651
            S+I  GSL
Sbjct: 733 FSDINAGSL 741

>YLR139C (SLS1) [3549] chr12 complement(421543..423474) Protein
           involved in mitochondrial transcription and/or
           translation processes [1932 bp, 643 aa]
          Length = 643

 Score =  162 bits (411), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 168/649 (25%), Positives = 292/649 (44%), Gaps = 96/649 (14%)

Query: 58  FLVLTPHQTGVMRLPRKSKTLQSNSHLSILEGFDFKRHTENGTNHSQVRDVDILSNIQDT 117
           F+VL P Q+G+++  +K    + +           + H E G N+             D 
Sbjct: 37  FVVLNPTQSGLVKNDQKQPRHRPSKK---------RSHKETGDNN------------LDF 75

Query: 118 TSKLMKFKEQEDNEQMAKAIDSCKPSSEAISEKRYLQLEKVLDEQFTLQQLRNYCYLKHG 177
            SKL+ F++Q   +    +I   KP+S ++    Y  L + L   +   QLR +      
Sbjct: 76  GSKLLVFEKQNSLDSALNSIRLKKPTSASLPSLEYNALLQSLTSSYNRYQLREFISTHQP 135

Query: 178 VRKARIP---KKNLIPTIITKLWNCSIDYNKSEHDDLIVENEISLE---TRDIYLLLLTK 231
              + +    K  L   II K+WNC      +     I    ++ +    R+I+LLL+T+
Sbjct: 136 DSSSHLTHWKKSKLSQYIIEKIWNCQPISTPTTPTG-IKSTSLTFQFDSPREIFLLLITQ 194

Query: 232 NGRILQNLARIGATIAVVIDENKLVVRATSHIFKYVEVSISRILENVVSDDFSIEEFIKD 291
           NG+IL N  ++G T  + I +N+L V+ +  + KY E+S+++I  N+             
Sbjct: 195 NGKILTNFNKLGLTFIISIQDNELTVKGSPSLLKYAEISLNKIWSNIT------------ 242

Query: 292 HSQIDGVHHMTPEEIIALMQTQSSSYVE-ITDDSKYKISTIGRKNMNIINSLLLWVLNYN 350
           H  +     M  +++I L+Q ++ ++ E + D   YKIS +  K +++    LL  +  N
Sbjct: 243 HENVRMYSLMPSKDVINLIQKETHTFFEYLPDLQMYKISALSTKKISMAKVFLLNAVASN 302

Query: 351 PQTTE----ILVPYDGGEKTEQYPLTN-YEWINWVARKQSWHRIQQPVAIN--QEIKDTK 403
           P TT+    I  P     KTE YP  N  E ++W+ + Q W R+Q  V  N    +  T+
Sbjct: 303 PNTTQHHHTIASP---ALKTELYPFNNTLENLDWLNKSQDWARLQSVVPKNCTDLMTPTE 359

Query: 404 IDLSEKIDKIWDILEINKTKCAKPLAFTE--TKSLSIAFGHILENAQNKILFQSKI-PEV 460
               E  D      E + +K    L+ ++  ++SLSI  GH L++A    +FQ  I    
Sbjct: 360 NATPELTDAQVSQFESSLSKNIPSLSPSDSISQSLSITLGHSLQSASFSSIFQPLIHKSF 419

Query: 461 VPKVLRLPLWDKDGYVEDDL-FSVDQHLY------LVQMKFVPNLADVSHKVNVSPLEVW 513
           + K+L LP++ +       +   +DQHL        +Q+ F P         +   L++W
Sbjct: 420 ISKLLNLPMYKESSSSAVPVPVPLDQHLITNAHQSFIQLNFTPVPPTSGSSSSPF-LQIW 478

Query: 514 FTLDENNNADTSTVRCIHTYSDNSACIQTPTLSHDFKITVTDTVDALPEDLESSEFFDWL 573
           F +DE +N  T+++R +    +NS  ++TP    D+KIT     D LP D + +    WL
Sbjct: 479 FEIDEFDNIVTTSMRPLLKLQENSVILRTPQCQTDYKITSDYIQDLLP-DFDQTNPDAWL 537

Query: 574 QREQPSFRKFLQESNF---SFGGLKKPRIAPSFELNVKLEGMEEPQKIRYNYLHRYE--- 627
             EQ   ++FL +S++    +  L K       ++N+ L           N + +Y+   
Sbjct: 538 S-EQKGLQEFLLKSHWKLNKYQNLMK-------KINISLPD---------NLIQQYQLTD 580

Query: 628 ---HRLLRFKYKEDC------LVQLSEIEGGSL-GGKASSIDFISTNGS 666
              HR+L  ++  +       ++Q S+I  G L  G    +DFI+ N S
Sbjct: 581 VLTHRVLNLRFPTNTAQDDKYIIQYSDISRGFLNNGSYRQLDFINVNPS 629

>Kwal_27.12090
          Length = 394

 Score = 35.0 bits (79), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 39/73 (53%), Gaps = 11/73 (15%)

Query: 350 NPQTTEILVPYDGGEKTEQYPLTNYEWINWVARKQSWHRIQQPV-AINQEIKDTKI-DLS 407
           NP T EIL P D G K          +I++  R   W+ I+  V  +N  + D +I D++
Sbjct: 315 NPSTYEILDPQDFGLK---------RYIHFANRLTGWNAIKSRVEQLNLHLTDDQIKDVT 365

Query: 408 EKIDKIWDILEIN 420
           +KI KI D+ +++
Sbjct: 366 QKIKKIGDVRQLS 378

>Scas_704.3
          Length = 438

 Score = 34.3 bits (77), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 38/73 (52%), Gaps = 11/73 (15%)

Query: 350 NPQTTEILVPYDGGEKTEQYPLTNYEWINWVARKQSWHRIQQPV-AINQEIKDTKI-DLS 407
           NP T EIL P+D G K          +I++  R   W+ I+  V  +N  + D +I +++
Sbjct: 329 NPSTYEILDPHDFGLK---------RYIHFANRLTGWNAIKSRVDQLNLNLTDAQIKEIT 379

Query: 408 EKIDKIWDILEIN 420
            KI K+ D+  +N
Sbjct: 380 AKIKKLGDVRPLN 392

>YDL131W (LYS21) [738] chr4 (227393..228715) Homocitrate synthase
           isoenzyme, involved in lysine metabolism [1323 bp, 440
           aa]
          Length = 440

 Score = 34.3 bits (77), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 54/117 (46%), Gaps = 27/117 (23%)

Query: 350 NPQTTEILVPYDGGEKTEQYPLTNYEWINWVARKQSWHRIQQPV-AINQEIKDTKI-DLS 407
           NP T EIL P+D G K          +I++  R   W+ I+  V  +N  + D +I +++
Sbjct: 330 NPSTYEILDPHDFGMK---------RYIHFANRLTGWNAIKSRVDQLNLNLTDDQIKEVT 380

Query: 408 EKIDKIWDILEIN---------------KTKCAKPL-AFTETKSLSIAFGHILENAQ 448
            KI K+ D+  +N                T   KP+   T+  ++ I+ GH+ + A+
Sbjct: 381 AKIKKLGDVRPLNIDDVDSIIKDFHAELSTPLLKPVNKGTDDDNIDISNGHVSKKAK 437

>YDL182W (LYS20) [690] chr4 (133438..134724) Homocitrate synthase
           isoenzyme, involved in lysine biosynthesis [1287 bp, 428
           aa]
          Length = 428

 Score = 34.3 bits (77), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 38/73 (52%), Gaps = 11/73 (15%)

Query: 350 NPQTTEILVPYDGGEKTEQYPLTNYEWINWVARKQSWHRIQQPV-AINQEIKDTKI-DLS 407
           NP T EIL P+D G K          +I++  R   W+ I+  V  +N  + D +I +++
Sbjct: 316 NPSTYEILDPHDFGMK---------RYIHFANRLTGWNAIKARVDQLNLNLTDDQIKEVT 366

Query: 408 EKIDKIWDILEIN 420
            KI K+ D+  +N
Sbjct: 367 AKIKKLGDVRSLN 379

>KLLA0F05489g 541146..542471 highly similar to sp|Q12122
           Saccharomyces cerevisiae YDL131w LYS21 homocitrate
           synthase, start by similarity
          Length = 441

 Score = 33.9 bits (76), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 38/73 (52%), Gaps = 11/73 (15%)

Query: 350 NPQTTEILVPYDGGEKTEQYPLTNYEWINWVARKQSWHRIQQPV-AINQEIKDTKI-DLS 407
           NP T EIL P+D G K          +I++  R   W+ I+  V  +N  + D ++ +++
Sbjct: 332 NPSTYEILDPHDFGMK---------RYIHFANRLTGWNAIKSRVDQLNLNLTDDQVKEVT 382

Query: 408 EKIDKIWDILEIN 420
            KI K+ DI  +N
Sbjct: 383 AKIKKLGDIRPLN 395

>CAGL0J06402g complement(608851..610146) highly similar to sp|Q12122
           Saccharomyces cerevisiae YDL131w LYS21 or sp|P48570
           Saccharomyces cerevisiae YDL182w LYS20, hypothetical
           start
          Length = 431

 Score = 33.5 bits (75), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 38/73 (52%), Gaps = 11/73 (15%)

Query: 350 NPQTTEILVPYDGGEKTEQYPLTNYEWINWVARKQSWHRIQQPV-AINQEIKDTKI-DLS 407
           NP T EIL P+D G K          +I++  R   W+ I+  V  +N  + D +I +++
Sbjct: 315 NPSTYEILDPHDFGMK---------RYIHFANRLTGWNAIKARVDQLNLNLTDDQIKEVT 365

Query: 408 EKIDKIWDILEIN 420
            KI K+ D+  +N
Sbjct: 366 AKIKKLGDVRPLN 378

>CAGL0J09240g 911669..912982 highly similar to sp|Q12122
           Saccharomyces cerevisiae YDL131w LYS21 or sp|P48570
           Saccharomyces cerevisiae YDL182w LYS20, start by
           similarity
          Length = 437

 Score = 33.5 bits (75), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 38/73 (52%), Gaps = 11/73 (15%)

Query: 350 NPQTTEILVPYDGGEKTEQYPLTNYEWINWVARKQSWHRIQQPV-AINQEIKDTKI-DLS 407
           NP T EIL P+D G K          +I++  R   W+ I+  V  +N  + D ++ +++
Sbjct: 327 NPSTYEILDPHDFGMK---------RYIHFANRLTGWNAIKSRVDQLNLNLTDDQVKEVT 377

Query: 408 EKIDKIWDILEIN 420
            KI K+ DI  +N
Sbjct: 378 TKIKKLGDIRPLN 390

>Scas_701.35
          Length = 430

 Score = 32.7 bits (73), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 38/73 (52%), Gaps = 11/73 (15%)

Query: 350 NPQTTEILVPYDGGEKTEQYPLTNYEWINWVARKQSWHRIQQPV-AINQEIKDTKI-DLS 407
           NP T EIL P+D G K          +I++  R   W+ I+  V  +N  + D ++ +++
Sbjct: 320 NPSTYEILDPHDFGLK---------RYIHFANRLTGWNAIKSRVDQLNLNLTDDQVKEVT 370

Query: 408 EKIDKIWDILEIN 420
            KI K+ D+  +N
Sbjct: 371 AKIKKLGDVRPLN 383

>KLLA0E23782g complement(2105401..2106582) highly similar to
           sp|Q12122 Saccharomyces cerevisiae YDL131w LYS21
           homocitrate synthase, start by similarity
          Length = 393

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 38/73 (52%), Gaps = 11/73 (15%)

Query: 350 NPQTTEILVPYDGGEKTEQYPLTNYEWINWVARKQSWHRIQQPV-AINQEIKDTKI-DLS 407
           NP T EIL P D G K          +I++  R   W+ I+  V  +N  + D +I +++
Sbjct: 315 NPSTYEILNPEDFGMK---------RYIHFANRLTGWNAIKSRVEQLNLHLSDDQIKEVT 365

Query: 408 EKIDKIWDILEIN 420
            KI +I D+ +++
Sbjct: 366 SKIKQIGDVRQLS 378

>Kwal_56.24401
          Length = 441

 Score = 31.2 bits (69), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 37/73 (50%), Gaps = 11/73 (15%)

Query: 350 NPQTTEILVPYDGGEKTEQYPLTNYEWINWVARKQSWHRIQQPV-AINQEIKDTKI-DLS 407
           NP T EIL P+D G K          +I++  R   W+ I+  V  +N  + D +  +++
Sbjct: 329 NPSTYEILDPHDFGLK---------RYIHFANRLTGWNAIKSRVDQLNLNMSDEQCKEVT 379

Query: 408 EKIDKIWDILEIN 420
            KI K+ DI  +N
Sbjct: 380 FKIKKLGDIRPLN 392

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.134    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 22,468,518
Number of extensions: 1013645
Number of successful extensions: 3512
Number of sequences better than 10.0: 38
Number of HSP's gapped: 3620
Number of HSP's successfully gapped: 38
Length of query: 671
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 563
Effective length of database: 12,857,365
Effective search space: 7238696495
Effective search space used: 7238696495
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)