Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0D16434g41436418380.0
Sklu_2172.539938311841e-162
Scas_713.51*42941311231e-152
YLR130C (ZRT2)42240411121e-150
Scas_693.3334737211041e-150
CAGL0E01353g43340910931e-147
CAGL0M04301g3893829971e-133
AGL143C3743729911e-133
YGL255W (ZRT1)3763656121e-75
Kwal_14.8243743565735e-70
Kwal_23.65223893655321e-63
Scas_709.29*17161643.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D16434g
         (408 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D16434g complement(1384826..1386070) similar to sgd|S000412...   712   0.0  
Sklu_2172.5 YLR130C, Contig c2172 7809-9008                           460   e-162
Scas_713.51*                                                          437   e-152
YLR130C (ZRT2) [3540] chr12 complement(402795..404063) Low-affin...   432   e-150
Scas_693.33                                                           429   e-150
CAGL0E01353g 127608..128909 similar to tr|Q12436 Saccharomyces c...   425   e-147
CAGL0M04301g complement(472227..473396) similar to tr|Q12436 Sac...   388   e-133
AGL143C [4169] [Homologous to ScYLR130C (ZRT2) - NSH; ScYGL255W ...   386   e-133
YGL255W (ZRT1) [1745] chr7 (20978..22108) High-affinity zinc tra...   240   1e-75
Kwal_14.824                                                           225   5e-70
Kwal_23.6522                                                          209   1e-63
Scas_709.29*                                                           29   3.5  

>KLLA0D16434g complement(1384826..1386070) similar to sgd|S0004122
           Saccharomyces cerevisiae YLR130c ZRT2 low affininty zinc
           transporter, start by similarity
          Length = 414

 Score =  712 bits (1838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/364 (95%), Positives = 346/364 (95%)

Query: 45  SDNDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIVAT 104
           SDNDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIVAT
Sbjct: 45  SDNDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIVAT 104

Query: 105 GFIHLLEPAADALGEECLGGTFADYPWAFGICLMSLFALFLSECVARYYTNKSYGFQNDH 164
           GFIHLLEPAADALGEECLGGTFADYPWAFGICLMSLFALFLSECVARYYTNKSYGFQNDH
Sbjct: 105 GFIHLLEPAADALGEECLGGTFADYPWAFGICLMSLFALFLSECVARYYTNKSYGFQNDH 164

Query: 165 VHSHFPXXXXXXXXXXXXXXXXXXYNQVVDEENVSLTVANNNNGAEITATNPHPSMPGSN 224
           VHSHFP                  YNQVVDEENVSLTVANNNNGAEITATNPHPSMPGSN
Sbjct: 165 VHSHFPSSKDQKSLEDEDDEDSDKYNQVVDEENVSLTVANNNNGAEITATNPHPSMPGSN 224

Query: 225 HFSHDKSHQDLATIGTPAQMTSKEKYQNQLLSVFILEFGIIFHSVFIGLALAVTGNDEFN 284
           HFSHDKSHQDLATIGTPAQMTSKEKYQNQLLSVFILEFGIIFHSVFIGLALAVTGNDEFN
Sbjct: 225 HFSHDKSHQDLATIGTPAQMTSKEKYQNQLLSVFILEFGIIFHSVFIGLALAVTGNDEFN 284

Query: 285 TLFIVLVFHQMFEGMGLGARIAEVSWAKKHRFTPWLLAAGFTLTTPIAIAIGIGVRHSYA 344
           TLFIVLVFHQMFEGMGLGARIAEVSWAKKHRFTPWLLAAGFTLTTPIAIAIGIGVRHSYA
Sbjct: 285 TLFIVLVFHQMFEGMGLGARIAEVSWAKKHRFTPWLLAAGFTLTTPIAIAIGIGVRHSYA 344

Query: 345 PGSRTALIANGCFDAISAGILIYTGLVELMAHEFLYSDNFKGENGLKKMLWAFFTMCWGA 404
           PGSRTALIANGCFDAISAGILIYTGLVELMAHEFLYSDNFKGENGLKKMLWAFFTMCWGA
Sbjct: 345 PGSRTALIANGCFDAISAGILIYTGLVELMAHEFLYSDNFKGENGLKKMLWAFFTMCWGA 404

Query: 405 GLMA 408
           GLMA
Sbjct: 405 GLMA 408

>Sklu_2172.5 YLR130C, Contig c2172 7809-9008
          Length = 399

 Score =  460 bits (1184), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 231/383 (60%), Positives = 280/383 (73%), Gaps = 19/383 (4%)

Query: 43  CESDNDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIV 102
           C++DN+YDG+D++R+ A+F+ILIS GLG++FPILSSRYS IRLP WCFFIAKFFGSGVIV
Sbjct: 13  CDNDNEYDGRDSLRILAVFMILISSGLGAFFPILSSRYSVIRLPAWCFFIAKFFGSGVIV 72

Query: 103 ATGFIHLLEPAADALGEECLGGTFADYPWAFGICLMSLFALFLSECVARYYTNKSYGFQN 162
           ATGFIHLL+PA D LG  CLGGTFADYPWAFGICLMSLFALF SE +  ++  K+ G  +
Sbjct: 73  ATGFIHLLKPATDNLGNTCLGGTFADYPWAFGICLMSLFALFFSEIITHHFFIKANG-NS 131

Query: 163 DHV--HSHFPXXXXXXXXXXXXXXXXXXYNQVVD----EENVSLTVANNNNGAEITAT-- 214
           DH   HSHF                     +  D     E + L V    +  E+  +  
Sbjct: 132 DHTNSHSHFGEPNHTTHQQFPDESEKKDDEEEADVECAAEYIPLKVGYFKDDEELRCSAS 191

Query: 215 ---------NPHPSMPGSNHFSHDKSHQDLATIGTPAQMTSKEKYQNQLLSVFILEFGII 265
                     P  S+PG +HFSH++ HQDL+ +GT  +   +E+Y +Q+ +VFILEFG++
Sbjct: 192 QGVSRKSDRKPSVSVPGKDHFSHEQDHQDLSQLGTLVRQKEREQYLSQVFAVFILEFGVV 251

Query: 266 FHSVFIGLALAVTGNDEFNTLFIVLVFHQMFEGMGLGARIAEVSWAKKHRFTPWLLAAGF 325
           FHSVF+GL+LAV G DEFNTLFIVLVFHQMFEG+GLG RIAE +W    R+TPWLL  G+
Sbjct: 252 FHSVFVGLSLAVAG-DEFNTLFIVLVFHQMFEGLGLGTRIAETTWPASKRYTPWLLGLGY 310

Query: 326 TLTTPIAIAIGIGVRHSYAPGSRTALIANGCFDAISAGILIYTGLVELMAHEFLYSDNFK 385
           TL+TPIAIAIGIGVRHS+APGS+ ALI NG FD+ISAGILIYTGLVELMAHEFLYS  FK
Sbjct: 311 TLSTPIAIAIGIGVRHSFAPGSKKALITNGVFDSISAGILIYTGLVELMAHEFLYSQQFK 370

Query: 386 GENGLKKMLWAFFTMCWGAGLMA 408
           GE G K+M+ A+F MC GAGLMA
Sbjct: 371 GEGGCKRMIGAYFIMCLGAGLMA 393

>Scas_713.51*
          Length = 429

 Score =  437 bits (1123), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 228/413 (55%), Positives = 276/413 (66%), Gaps = 49/413 (11%)

Query: 43  CESDNDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIV 102
           CE  N Y+G   +R+ A+FIILIS GLG +FPI++SRYSFI LP+WCFF+AKFFGSGVIV
Sbjct: 13  CEVSNTYNGHAGLRILAIFIILISSGLGVFFPIMASRYSFIHLPEWCFFLAKFFGSGVIV 72

Query: 103 ATGFIHLLEPAADALGEECLGGTFADYPWAFGICLMSLFALFLSECVARYYTNKSY---- 158
           AT FIHLL+PAA+ALG  CLGGTF +YPWAFGICLMSLF LFL E V  YY  KS+    
Sbjct: 73  ATAFIHLLDPAAEALGNSCLGGTFTEYPWAFGICLMSLFMLFLMEIVTHYYVAKSFGDHD 132

Query: 159 -------------------GFQNDHVHSHFPXXXXXXXXXXXXXXXXXXYNQVVDEENV- 198
                              GF +    +                      NQV DE+++ 
Sbjct: 133 HDGGHSNHHEDDITSFEADGFTDLERQNGIVRSTDHNNNSNNNNVLPMKKNQV-DEKSID 191

Query: 199 --------------------SLTVANNNNGAEITATNPH---PSMPGSNHFSHDKSHQDL 235
                               S +  NNN+    T TN      S+PG +HF HD  HQD 
Sbjct: 192 EDDERRDEDKEQDPASNDLASSSRINNNDHLVNTNTNISRFVSSVPGKDHFGHDDVHQDS 251

Query: 236 ATIGTPAQMTSKEKYQNQLLSVFILEFGIIFHSVFIGLALAVTGNDEFNTLFIVLVFHQM 295
           + IGTP +  +KE+Y NQ+++VFILEFGIIFHSVF+GL+L+V+G +EF TLFIVL+FHQM
Sbjct: 252 SQIGTPVEEENKEQYLNQMMAVFILEFGIIFHSVFVGLSLSVSG-EEFETLFIVLIFHQM 310

Query: 296 FEGMGLGARIAEVSWAKKHRFTPWLLAAGFTLTTPIAIAIGIGVRHSYAPGSRTALIANG 355
           FEG+GLG R+AE +W K  R+TPWL+   FT+T+PIA+AIGIGVR S+ PGSR ALIANG
Sbjct: 311 FEGLGLGTRVAETNWPKSKRYTPWLMGLAFTITSPIAVAIGIGVRKSWIPGSRNALIANG 370

Query: 356 CFDAISAGILIYTGLVELMAHEFLYSDNFKGENGLKKMLWAFFTMCWGAGLMA 408
            FD+IS+GILIYTGLVELMAHEFLYS+ FKG  GLKKML A+F MC GAGLMA
Sbjct: 371 VFDSISSGILIYTGLVELMAHEFLYSNQFKGPGGLKKMLTAYFIMCMGAGLMA 423

>YLR130C (ZRT2) [3540] chr12 complement(402795..404063) Low-affinity
           zinc transport protein, member of the zinc-iron permease
           (ZIP) family of metal ion transporters [1269 bp, 422 aa]
          Length = 422

 Score =  432 bits (1112), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 220/404 (54%), Positives = 275/404 (68%), Gaps = 39/404 (9%)

Query: 43  CESDNDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIV 102
           C++ N Y+G   +R+ A+FIILIS GLG YFPILSSRYSFIRLP+WCFFIAKFFGSGVIV
Sbjct: 14  CQASNGYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWCFFIAKFFGSGVIV 73

Query: 103 ATGFIHLLEPAADALGEECLGGTFADYPWAFGICLMSLFALFLSECVARYYTNKSYGFQN 162
           AT F+HLL+PAA+ALG+ECLGGTFA+YPWAFGICLMSLF LF +E +  Y+  K+ G  +
Sbjct: 74  ATAFVHLLQPAAEALGDECLGGTFAEYPWAFGICLMSLFLLFFTEIITHYFVAKTLGHDH 133

Query: 163 -DH--VHSHFPXXXXXXXXXXXXXXXXXXYNQ--------------VVDEENVSLTVANN 205
            DH  V S                     +N                 +EE V+  +   
Sbjct: 134 GDHGEVTSIDVDAPSSGFVIRNMDSDPVSFNNEAAYSIHNDKTPYTTRNEEIVATPIKEK 193

Query: 206 NNGAEITATNPHP---------------------SMPGSNHFSHDKSHQDLATIGTPAQM 244
             G+ +T  +  P                     S+PG +H+SH+  HQD++ + T  + 
Sbjct: 194 EPGSNVTNYDLEPGKTESLANELVPTSSHATNLASVPGKDHYSHENDHQDVSQLATRIEE 253

Query: 245 TSKEKYQNQLLSVFILEFGIIFHSVFIGLALAVTGNDEFNTLFIVLVFHQMFEGMGLGAR 304
             KE+Y NQ+L+VFILEFGIIFHSVF+GL+L+V G +EF TLFIVL FHQMFEG+GLG R
Sbjct: 254 EDKEQYLNQILAVFILEFGIIFHSVFVGLSLSVAG-EEFETLFIVLTFHQMFEGLGLGTR 312

Query: 305 IAEVSWAKKHRFTPWLLAAGFTLTTPIAIAIGIGVRHSYAPGSRTALIANGCFDAISAGI 364
           +AE +W +  ++ PWL+   FTLT+PIA+A+GIGVRHS+ PGSR ALIANG FD+IS+GI
Sbjct: 313 VAETNWPESKKYMPWLMGLAFTLTSPIAVAVGIGVRHSWIPGSRRALIANGVFDSISSGI 372

Query: 365 LIYTGLVELMAHEFLYSDNFKGENGLKKMLWAFFTMCWGAGLMA 408
           LIYTGLVELMAHEFLYS+ FKG +GLKKML A+  MC GA LMA
Sbjct: 373 LIYTGLVELMAHEFLYSNQFKGPDGLKKMLSAYLIMCCGAALMA 416

>Scas_693.33
          Length = 347

 Score =  429 bits (1104), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 211/372 (56%), Positives = 272/372 (73%), Gaps = 41/372 (11%)

Query: 43  CESDNDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIV 102
           C++ NDY+G+ N+R+ + F+I+IS GLG  FP ++S+YSFIRLPDWCFF+AKFFGSGVIV
Sbjct: 5   CQAQNDYNGETNIRILSGFMIMISSGLGGLFPFVASKYSFIRLPDWCFFLAKFFGSGVIV 64

Query: 103 ATGFIHLLEPAADALGEECLGGTFADYPWAFGICLMSLFALFLSECVARYYTNKSYGFQN 162
           AT F+HLL+PA++AL + CLGGTFADYPWAFGICLMSLF LF +E  + YY +K++    
Sbjct: 65  ATAFVHLLQPASEALSDPCLGGTFADYPWAFGICLMSLFFLFFTEIFSHYYISKAFS--- 121

Query: 163 DHVHSHFPXXXXXXXXXXXXXXXXXXYNQVVDEENVSLTVANNNN-GAEITATNPHP--- 218
                                          DE++ S T++ +++  +++ A    P   
Sbjct: 122 -------------------------------DEKDSSDTISKDSSYDSDLEANQVIPVND 150

Query: 219 SMPGSNHFSHDKSHQDLATIGTPAQMTSKEKYQNQLLSVFILEFGIIFHSVFIGLALAVT 278
           S PG  HFSH++ HQD   IGTPA   +KE+Y NQ+ +VFILEFGI+FHS+FIGL+LAV+
Sbjct: 151 SRPGKQHFSHEEDHQDAIQIGTPANDKAKEQYTNQVFAVFILEFGILFHSIFIGLSLAVS 210

Query: 279 GNDEFNTLFIVLVFHQMFEGMGLGARIAEVSWAKK--HRFTPWLLAAGFTLTTPIAIAIG 336
           G DEF+TLFIVL+FHQMFEG+GLG R+AE +W      ++TPWL+   FT  TP+AIAIG
Sbjct: 211 G-DEFHTLFIVLIFHQMFEGLGLGTRVAETNWPDSGPKKWTPWLMGLAFTFVTPVAIAIG 269

Query: 337 IGVRHSYAPGSRTALIANGCFDAISAGILIYTGLVELMAHEFLYSDNFKGENGLKKMLWA 396
           +GVRHS+ PGSR ALIANG FD++S+GILIYTGLVELMAHEFLYS+ FKG  G KKML+A
Sbjct: 270 LGVRHSWVPGSRRALIANGVFDSLSSGILIYTGLVELMAHEFLYSNQFKGPGGFKKMLYA 329

Query: 397 FFTMCWGAGLMA 408
           +F MC GAG+MA
Sbjct: 330 YFFMCCGAGIMA 341

>CAGL0E01353g 127608..128909 similar to tr|Q12436 Saccharomyces
           cerevisiae YLR130c ZRT2 or sp|P32804 Saccharomyces
           cerevisiae YGL255w ZRT1, hypothetical start
          Length = 433

 Score =  425 bits (1093), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 221/409 (54%), Positives = 270/409 (66%), Gaps = 44/409 (10%)

Query: 43  CESDNDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIV 102
           C  DND++G  N+R+ ++F++LIS  +G YFP+L+SRYSFI LP W FFIAKFFGSGVIV
Sbjct: 20  CAVDNDFNGHTNLRILSVFMVLISSAIGVYFPLLASRYSFINLPSWVFFIAKFFGSGVIV 79

Query: 103 ATGFIHLLEPAADALGEECLGGTFADYPWAFGICLMSLFALFLSECVARYYTNKSYGFQN 162
           AT FIHLLEPA+D+LG  CLGGTFA+YPWAFGICLM+LFALFL E V+ +Y  K+ G  +
Sbjct: 80  ATAFIHLLEPASDSLGNPCLGGTFANYPWAFGICLMALFALFLIEIVSHHYVGKTMGGGH 139

Query: 163 DH----------VHSH------FPXXXXXXXXXXXXXXXXXXYNQVVDEEN--------- 197
           +H           H H                          Y  VV   N         
Sbjct: 140 NHSHNMPTTFGQTHMHGVEDDMVDEDGSSSTHSHSHVAMDDKYGDVVKNNNYNYDDGSDD 199

Query: 198 -----------VSLTVANNNNGAEI-------TATNPHPSMPGSNHFSHDKSHQDLATIG 239
                          V N++N  +        T  +P   MPG NHFSHD+ HQD+  IG
Sbjct: 200 IESQKRPAFNVAQQKVRNDSNENDSLVGHVHNTTVDPLEHMPGHNHFSHDEVHQDITQIG 259

Query: 240 TPAQMTSKEKYQNQLLSVFILEFGIIFHSVFIGLALAVTGNDEFNTLFIVLVFHQMFEGM 299
           + A    KE+Y NQL S+FILEFGI+FHSVF+GL+L+V+G DEF TLF+V+VFHQMFEGM
Sbjct: 260 SKANDQQKEQYLNQLTSLFILEFGILFHSVFVGLSLSVSG-DEFKTLFVVIVFHQMFEGM 318

Query: 300 GLGARIAEVSWAKKHRFTPWLLAAGFTLTTPIAIAIGIGVRHSYAPGSRTALIANGCFDA 359
           GLGARI E  W    R+ P+LL  G+T+TTPIAIAIGIGVRHS+ PGSR +LI NG FDA
Sbjct: 319 GLGARITECYWPHSKRWLPYLLGFGYTITTPIAIAIGIGVRHSFVPGSRRSLIVNGVFDA 378

Query: 360 ISAGILIYTGLVELMAHEFLYSDNFKGENGLKKMLWAFFTMCWGAGLMA 408
           ISAGIL+Y GLVELMAHEFL+++ FKGE+GL+ ML A+F M  GAGLMA
Sbjct: 379 ISAGILVYAGLVELMAHEFLFTNQFKGEHGLRNMLAAYFVMALGAGLMA 427

>CAGL0M04301g complement(472227..473396) similar to tr|Q12436
           Saccharomyces cerevisiae YLR130c ZRT2 or sp|P32804
           Saccharomyces cerevisiae YGL255w ZRT1, hypothetical
           start
          Length = 389

 Score =  388 bits (997), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 197/382 (51%), Positives = 258/382 (67%), Gaps = 27/382 (7%)

Query: 43  CESDNDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIV 102
           C ++NDY+G+ N+R+ A+FI++IS GLG+YFPILSS+YSFIRLP+WCFF+AKFFGSGVI+
Sbjct: 13  CSTENDYNGEQNLRILAVFIVMISSGLGAYFPILSSQYSFIRLPNWCFFVAKFFGSGVII 72

Query: 103 ATGFIHLLEPAADALGEECLGGTFADYPWAFGICLMSLFALFLSECVARYYTNKSYGFQN 162
           AT FIHLL+PAA+AL ++CLGGTF DYPWAFGICLMSLF LFL+E VA ++ +K +    
Sbjct: 73  ATAFIHLLQPAAEALTDDCLGGTFEDYPWAFGICLMSLFMLFLAEIVAHHFVDKKF---- 128

Query: 163 DHVHSH------FPXXXXXXXXXXXXXXXXXXYN------QVVDEENVSLTVANNNNGAE 210
           +H H+        P                   N       + D + +   V+ N    +
Sbjct: 129 NHSHAETDNANALPDIILKDIQISTDDLSEGMLNCAGHQDSLQDSKKIETGVSTNLKRVD 188

Query: 211 ITATNPHPSMPGSNHFSHDKSHQDLATIGTPAQMTSKEK----YQNQLLSVFILEFGIIF 266
            +         G   +  + + +      T     S+ K    Y +++  + +LEFGIIF
Sbjct: 189 DSG------FEGQYEYKRESTDETWIDENTLTTGNSEHKFSADYVSKVFVLCVLEFGIIF 242

Query: 267 HSVFIGLALAVTGNDEFNTLFIVLVFHQMFEGMGLGARIAEVSWAKKHRFTPWLLAAGFT 326
           HSVF+GL+LAV G+ EF  LFIV+ FHQMFEG+GLG RIAE  W     +TPW++A  FT
Sbjct: 243 HSVFVGLSLAVAGS-EFKVLFIVITFHQMFEGLGLGTRIAETEWPPSKWYTPWIMAFAFT 301

Query: 327 LTTPIAIAIGIGVRHSYAPGSRTALIANGCFDAISAGILIYTGLVELMAHEFLYSDNFKG 386
           +T+PIAIAIGIGVRHS+ PGSR ALIANG FD+IS+GILIYTGL+ELMAHEF++S+ FKG
Sbjct: 302 ITSPIAIAIGIGVRHSWVPGSRKALIANGVFDSISSGILIYTGLIELMAHEFIFSNQFKG 361

Query: 387 ENGLKKMLWAFFTMCWGAGLMA 408
           E+ L+ ML A+F MC GA LMA
Sbjct: 362 EHSLRNMLTAYFIMCCGAALMA 383

>AGL143C [4169] [Homologous to ScYLR130C (ZRT2) - NSH; ScYGL255W
           (ZRT1) - NSH] (431959..433083) [1125 bp, 374 aa]
          Length = 374

 Score =  386 bits (991), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 188/372 (50%), Positives = 250/372 (67%), Gaps = 37/372 (9%)

Query: 43  CESDNDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIV 102
           C ++N+YDG D +R+ ++FIIL++  +G++FP+L SR+S +RLP W FF AK+FGSGVIV
Sbjct: 28  CPTENEYDGSDGIRILSVFIILLASAIGTFFPMLGSRFSRVRLPTWAFFFAKYFGSGVIV 87

Query: 103 ATGFIHLLEPAADALGEECLGGTFADYPWAFGICLMSLFALFLSECVARYYTNKSYGFQN 162
           ATGFIHLL    ++L   CLGG  ++YPWAF IC+MSLF LF  E  + ++ NK+     
Sbjct: 88  ATGFIHLLLHGHESLSNPCLGGVLSEYPWAFAICMMSLFTLFFVEINSHHFVNKA----- 142

Query: 163 DHVHSHFPXXXXXXXXXXXXXXXXXXYNQVVDEENVSLTVANNNNGAEITATNPHPSMPG 222
                                          DE+++       +   E T   P+ ++ G
Sbjct: 143 ---------------------ARSTAVAVAGDEKSI-----KEDESTEDTPPKPNTAVSG 176

Query: 223 SN------HFSHDKSHQDLATIGTPAQMTSKEKYQNQLLSVFILEFGIIFHSVFIGLALA 276
           +N      HF+HD+ HQDL    + A   ++E+Y NQL+S+FILEFG++FHSV IGL+LA
Sbjct: 177 ANSAVVSQHFAHDECHQDLEQAKSLAADPNREQYLNQLISLFILEFGVVFHSVLIGLSLA 236

Query: 277 VTGNDEFNTLFIVLVFHQMFEGMGLGARIAEVSWAKKHRFTPWLLAAGFTLTTPIAIAIG 336
           VT  D F TLF+VL+FHQMFEGMGLGARIAE  W    ++TPWLL  G+ L+TPIAIAIG
Sbjct: 237 VTAEDHFTTLFVVLIFHQMFEGMGLGARIAETEWGVHRKWTPWLLGLGYCLSTPIAIAIG 296

Query: 337 IGVRHSYAPGSRTALIANGCFDAISAGILIYTGLVELMAHEFLYSDNFKGENGLKKMLWA 396
           +GVRHS+AP SR +LI NG FD++SAGI++YTGL+ELMAHEFL+S++FKGE G  KM+  
Sbjct: 297 LGVRHSFAPESRPSLIVNGVFDSLSAGIMLYTGLIELMAHEFLFSNSFKGEGGFNKMMQG 356

Query: 397 FFTMCWGAGLMA 408
           F  MC GAGLMA
Sbjct: 357 FVYMCLGAGLMA 368

>YGL255W (ZRT1) [1745] chr7 (20978..22108) High-affinity zinc
           transport protein, member of ZIP family of metal ion
           transporters [1131 bp, 376 aa]
          Length = 376

 Score =  240 bits (612), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 137/365 (37%), Positives = 203/365 (55%), Gaps = 38/365 (10%)

Query: 47  NDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIVATGF 106
           N+Y+G    R+ ++F+IL      + FP++S++   +R+P + +  AK+FGSGVIVAT F
Sbjct: 41  NEYNGNLGARISSVFVILFVSTFFTMFPLISTKVKRLRIPLYVYLFAKYFGSGVIVATAF 100

Query: 107 IHLLEPAADALG-EECLG--GTFADYPWAFGICLMSLFALFLSECVARYYTNKSYGFQND 163
           IHL++PA  A+G   C+G  G +  Y W   I L SL   FL++  +  +  + YG  +D
Sbjct: 101 IHLMDPAYGAIGGTTCVGQTGNWGLYSWCPAIMLTSLTFTFLTDLFSSVWVERKYGLSHD 160

Query: 164 HVHSHFPXXXXXXXXXXXXXXXXXXYNQVVDEENVSLTVANNNNGAEITATNPHPSMPGS 223
           H H                       + VV       +  +N NG   TA   H +  G 
Sbjct: 161 HTHDEIK-------------------DTVVRNTAAVSSENDNENG---TANGSHDTKNGV 198

Query: 224 NHFSHDKSHQDLATIGTPAQMTSKEKYQNQLLSVFILEFGIIFHSVFIGLALAVTGNDEF 283
            ++    +            M   + +Q Q  +  ILEFG+IFHSV IGL L   G DEF
Sbjct: 199 EYYEDSDA----------TSMDVVQSFQAQFYAFLILEFGVIFHSVMIGLNLGSVG-DEF 247

Query: 284 NTLFIVLVFHQMFEGMGLGARIAEVSWAKKHRFTPWLLAAGFTLTTPIAIAIGIGVRHSY 343
           ++L+ VLVFHQ FEG+G+GAR++ + + +  R+ PW L   + LTTPI +AIG+GVR  Y
Sbjct: 248 SSLYPVLVFHQSFEGLGIGARLSAIEFPRSKRWWPWALCVAYGLTTPICVAIGLGVRTRY 307

Query: 344 APGSRTALIANGCFDAISAGILIYTGLVELMAHEFLYSDNFKGENGLKKMLWAFFTMCWG 403
             GS TAL+ +G  DAISAGIL+YTGLVEL+A +F++  N +    L+++ +      +G
Sbjct: 308 VSGSYTALVISGVLDAISAGILLYTGLVELLARDFIF--NPQRTKDLRELSFNVICTLFG 365

Query: 404 AGLMA 408
           AG+MA
Sbjct: 366 AGIMA 370

>Kwal_14.824
          Length = 374

 Score =  225 bits (573), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 127/356 (35%), Positives = 198/356 (55%), Gaps = 47/356 (13%)

Query: 46  DNDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIVATG 105
           +N+Y+G    R+ ++F+I     L + FP++++R   IR+P + +  A++FG+GVIVAT 
Sbjct: 39  ENEYNGSMGARISSIFVIFFVSTLFTLFPVVAARVKSIRIPKYVYLFARYFGTGVIVATA 98

Query: 106 FIHLLEPAADALG-EECLGGT--FADYPWAFGICLMSLFALFLSECVARYYTNKSYGFQN 162
           FIHLL+PA   +G + C+G T  +ADY W   I L+++F +FL +  +  Y  + +G  +
Sbjct: 99  FIHLLDPAYGEIGGDSCVGKTGHWADYSWCPAIVLLTIFIIFLVDLASDVYVKRRFGVAH 158

Query: 163 DHVHSHFPXXXXXXXXXXXXXXXXXXYNQVVDEENVSLTVANNNNGAEITATNPHPSMPG 222
           +H                           V+++  V                + H  +  
Sbjct: 159 NH-------------------------GDVIEDAVVK------------RQGDAHEDLES 181

Query: 223 SNHFSH----DKSHQDLATIGTPAQMTSKEKYQNQLLSVFILEFGIIFHSVFIGLALAVT 278
            N+  H    DKS +    I   +   + E +++Q  +  ILEFG+IFHSV IGL L   
Sbjct: 182 HNNHMHADSDDKSKKSYDVISDASSEIATESFESQFAAFLILEFGVIFHSVMIGLNLGTV 241

Query: 279 GNDEFNTLFIVLVFHQMFEGMGLGARIAEVSWAKKHRFTPWLLAAGFTLTTPIAIAIGIG 338
           G DEF+ L+ VLVFHQ FEG+G+GAR++ +++ K   + P+ L   + L TPI +AIG+G
Sbjct: 242 G-DEFSVLYPVLVFHQSFEGLGIGARLSSIAFPKGKAWWPYALCITYGLATPICVAIGLG 300

Query: 339 VRHSYAPGSRTALIANGCFDAISAGILIYTGLVELMAHEFLYSDNFKGENGLKKML 394
           VR SY   S T  I +G  DAISAGILIYTGLVEL+A +F++ +  K  N + +++
Sbjct: 301 VRTSYNGNSFTVNIVSGVLDAISAGILIYTGLVELLARDFIFDE--KRTNDIPRLI 354

>Kwal_23.6522
          Length = 389

 Score =  209 bits (532), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 131/365 (35%), Positives = 208/365 (56%), Gaps = 44/365 (12%)

Query: 47  NDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIVATGF 106
           ++Y G    R+ ++F++L      +  PI+ ++   +++P +C+  A++FG+GVIV+T F
Sbjct: 60  SEYQGSLPARISSIFVLLFVSTSFTLLPIVLNKIKGVKVPRYCYLFARYFGTGVIVSTAF 119

Query: 107 IHLLEPAADALGE-ECLG--GTFADYPWAFGICLMSLFALFLSECVARYYTNKSYGFQND 163
           IHL+E +  ++G   C+G  G +ADY W   I ++++F +FL + ++  Y  + YG    
Sbjct: 120 IHLMEHSYMSIGSNSCVGMTGHWADYTWCSCIVMVTVFVIFLVDLLSDVYIERKYGLTGG 179

Query: 164 HVHSHFPXXXXXXXXXXXXXXXXXXYNQVVDEENVSLTVANNNNGAEITATNPHPSMPGS 223
           H  S                           EE ++  V  + N  E  +      M  S
Sbjct: 180 HGDS--------------------------IEEAIT-DVHKDENDVECASGE----MTKS 208

Query: 224 NHFSHDKSHQDLATIGTPAQMTSKEKYQNQLLSVFILEFGIIFHSVFIGLALAVTGNDEF 283
           +  S D       T+   +  +S + +++Q+ + F+LEFGIIFHSV IGL L  TG+ EF
Sbjct: 209 DDASFD-------TLFCASSGSSIKSFESQIGAFFVLEFGIIFHSVMIGLELGTTGS-EF 260

Query: 284 NTLFIVLVFHQMFEGMGLGARIAEVSWAKKHRFTPWLLAAGFTLTTPIAIAIGIGVRHSY 343
           + L+ V+VFHQ FEG+GLGAR+  + + +  ++ P+ L   + +TTPIA+AIG+GVR +Y
Sbjct: 261 SVLYPVIVFHQSFEGLGLGARLMSIKFPEGKKWWPYALCGLYGITTPIAVAIGLGVRLTY 320

Query: 344 APGSRTALIANGCFDAISAGILIYTGLVELMAHEFLYSDNFKGENGLKKMLWAFFTMCWG 403
              S T  I +G  DAISAGILIYTGLVEL+A +F+++ N + ++  K  L  F T+  G
Sbjct: 321 NAHSFTMSIISGILDAISAGILIYTGLVELLAKDFIFNPN-RTKDMTKLSLMIFATLS-G 378

Query: 404 AGLMA 408
           AGLMA
Sbjct: 379 AGLMA 383

>Scas_709.29*
          Length = 171

 Score = 29.3 bits (64), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 7/61 (11%)

Query: 224 NHFSHDKSHQDLATIGTPAQMTSKEKY--QNQLLSVFILEFGIIFHSVFIGLALAVTGND 281
           N +S+++ H       TP Q+ +   Y  +N  LS FIL FGI   +V I +   +   D
Sbjct: 75  NPYSYEQDHST-----TPIQILATRAYNQRNVYLSGFILYFGICIATVMIIIGKIIRFED 129

Query: 282 E 282
           E
Sbjct: 130 E 130

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.326    0.140    0.444 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,787,919
Number of extensions: 475923
Number of successful extensions: 1423
Number of sequences better than 10.0: 19
Number of HSP's gapped: 1444
Number of HSP's successfully gapped: 28
Length of query: 408
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 304
Effective length of database: 12,995,837
Effective search space: 3950734448
Effective search space used: 3950734448
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 63 (28.9 bits)