Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0D15158g66665633400.0
Scas_716.2668667510351e-131
Kwal_55.205296916739581e-120
YGR099W (TEL2)6886789531e-119
AAR090W6596457979e-97
CAGL0G07755g6852255223e-57
YKR054C (DYN1)409258693.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D15158g
         (656 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D15158g 1281895..1283895 similar to sp|P53038 Saccharomyces...  1291   0.0  
Scas_716.26                                                           403   e-131
Kwal_55.20529                                                         373   e-120
YGR099W (TEL2) [2059] chr7 (687901..689967) Protein involved in ...   371   e-119
AAR090W [276] [Homologous to ScYGR099W (TEL2) - SH] complement(5...   311   9e-97
CAGL0G07755g 736112..738169 similar to sp|P53038 Saccharomyces c...   205   3e-57
YKR054C (DYN1) [3305] chr11 complement(535289..547567) Cytoplasm...    31   3.4  

>KLLA0D15158g 1281895..1283895 similar to sp|P53038 Saccharomyces
           cerevisiae YGR099w TEL2 involved in controlling telomere
           length and position effect singleton, start by
           similarity
          Length = 666

 Score = 1291 bits (3340), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 631/656 (96%), Positives = 631/656 (96%)

Query: 1   MSGIDSTLLNEKCDKDTIYQVLERMSSKKQHSSNEILPIIKNVVPIYPSLPRELKMALRR 60
           MSGIDSTLLNEKCDKDTIYQVLERMSSKKQHSSNEILPIIKNVVPIYPSLPRELKMALRR
Sbjct: 1   MSGIDSTLLNEKCDKDTIYQVLERMSSKKQHSSNEILPIIKNVVPIYPSLPRELKMALRR 60

Query: 61  LCGNNYIFISLVIEYAKELGKNRETSIFYGFLTDVLKYESDCLFNYLEHSSRRDLPFIKS 120
           LCGNNYIFISLVIEYAKELGKNRETSIFYGFLTDVLKYESDCLFNYLEHSSRRDLPFIKS
Sbjct: 61  LCGNNYIFISLVIEYAKELGKNRETSIFYGFLTDVLKYESDCLFNYLEHSSRRDLPFIKS 120

Query: 121 ILFGSRCYNALSSSISIVEYLKFMKMQWEFVFKETKQYDKTHLEMFVSCLQLNIPYGVDI 180
           ILFGSRCYNALSSSISIVEYLKFMKMQWEFVFKETKQYDKTHLEMFVSCLQLNIPYGVDI
Sbjct: 121 ILFGSRCYNALSSSISIVEYLKFMKMQWEFVFKETKQYDKTHLEMFVSCLQLNIPYGVDI 180

Query: 181 FIEGLATTSEFSWNALIMMLSKGTSVQQRRFFMYHLVPFLEKVTNPDNSSTIFTLLSQLP 240
           FIEGLATTSEFSWNALIMMLSKGTSVQQRRFFMYHLVPFLEKVTNPDNSSTIFTLLSQLP
Sbjct: 181 FIEGLATTSEFSWNALIMMLSKGTSVQQRRFFMYHLVPFLEKVTNPDNSSTIFTLLSQLP 240

Query: 241 FDIPTSIDCFKWGNPYFKIVYLHGMSEAKRAQLFRELLPCFELMDLYTDDSLAEILVMIL 300
           FDIPTSIDCFKWGNPYFKIVYLHGMSEAKRAQLFRELLPCFELMDLYTDDSLAEILVMIL
Sbjct: 241 FDIPTSIDCFKWGNPYFKIVYLHGMSEAKRAQLFRELLPCFELMDLYTDDSLAEILVMIL 300

Query: 301 DAMSKDSRDELSHDAISLNFVTKRLHSEDHLVRERTMFVAKKLTNDQLQYESDFTIDLPR 360
           DAMSKDSRDELSHDAISLNFVTKRLHSEDHLVRERTMFVAKKLTNDQLQYESDFTIDLPR
Sbjct: 301 DAMSKDSRDELSHDAISLNFVTKRLHSEDHLVRERTMFVAKKLTNDQLQYESDFTIDLPR 360

Query: 361 IELIKLSKLEFPIKEGLQNLPKGNSTKNELVQQFNTITLQXXXXXXXXXXXRXXXXXXXX 420
           IELIKLSKLEFPIKEGLQNLPKGNSTKNELVQQFNTITLQ           R        
Sbjct: 361 IELIKLSKLEFPIKEGLQNLPKGNSTKNELVQQFNTITLQDSDDESDEEDSRDILFLKDL 420

Query: 421 XXXXXXVIKNDGSELRLLKETVKLVRQKKNFPTEVSFYSKELLKKIATISNKFDEKSFEE 480
                 VIKNDGSELRLLKETVKLVRQKKNFPTEVSFYSKELLKKIATISNKFDEKSFEE
Sbjct: 421 LLEFEKVIKNDGSELRLLKETVKLVRQKKNFPTEVSFYSKELLKKIATISNKFDEKSFEE 480

Query: 481 WKANALVSILVVCPDKIVDLYAILFNNELSLQQRMVILTSAALSARELRGFDDEFVVKPK 540
           WKANALVSILVVCPDKIVDLYAILFNNELSLQQRMVILTSAALSARELRGFDDEFVVKPK
Sbjct: 481 WKANALVSILVVCPDKIVDLYAILFNNELSLQQRMVILTSAALSARELRGFDDEFVVKPK 540

Query: 541 YDFPTNRLPWDESATEQQPENNKIQDITEITGSKVTWRSKRLETDSKITQQQNNFRKYAT 600
           YDFPTNRLPWDESATEQQPENNKIQDITEITGSKVTWRSKRLETDSKITQQQNNFRKYAT
Sbjct: 541 YDFPTNRLPWDESATEQQPENNKIQDITEITGSKVTWRSKRLETDSKITQQQNNFRKYAT 600

Query: 601 LFFYPLAHAWLNGINLGAFDKVFKRHYISMLKIILTCASPHYELEEMQILMQEILS 656
           LFFYPLAHAWLNGINLGAFDKVFKRHYISMLKIILTCASPHYELEEMQILMQEILS
Sbjct: 601 LFFYPLAHAWLNGINLGAFDKVFKRHYISMLKIILTCASPHYELEEMQILMQEILS 656

>Scas_716.26
          Length = 686

 Score =  403 bits (1035), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 242/675 (35%), Positives = 388/675 (57%), Gaps = 30/675 (4%)

Query: 5   DSTLLNEKCDKDTIYQVLERMSSKKQHSSNEI-LPIIKNVVPIYPSLPRELKMALRRLCG 63
           D  +L +  D   I  VL+++S++    + E+ L II++V+PIYPSL +  +   + L  
Sbjct: 3   DFKVLKDHPDAQVIEDVLQQLSNETDAPTLEVCLLIIQHVIPIYPSLSKHTRDLTQSLVS 62

Query: 64  NNYIFISLVIEYAKELGKNR-ETSIFYGFLTDVLKYESDCLFNYLEH--SSRRDLPFIKS 120
            ++ F+S ++ YA  + K++ E  ++  F+ +VL  + +CL NYL H  SSR +  ++K+
Sbjct: 63  RSFTFMSQLVNYASTVMKDKPEGKLYRNFIKEVLATQPECLHNYLIHMSSSRMEKNYLKT 122

Query: 121 ILFGSRCYNALSSSISIVEYLKFMKMQWEFVFK-----ETKQYDKTHLEMFVSCLQLNIP 175
           + FGSR +N+L + I I+EYL+ ++ QW+ V       ET   D    E+ VS L LN  
Sbjct: 123 LFFGSRVFNSLGNDIDIIEYLELLRSQWKSVLDDDILIETLVLDSFLGELLVSSLILNPT 182

Query: 176 YGVDIFIEGLATTSEFSWNALIMMLSKGTSVQQRRFFMYHLVPFLEKVTNPDNSSTIFTL 235
           Y +D+    L  ++E     L  ++   +++ Q+R     L+P+LE +TN  N  +   +
Sbjct: 183 YAMDLLFGDLFLSTETYATILNKIILNASNLDQQRLVNKFLLPYLEPLTNTSNFKSTNHI 242

Query: 236 LSQLPFDIPTSIDC-FKWGNPYFKIVYLHGMSEAKRAQLFRELLPCFELMDLYTDDSLAE 294
           L +LP     ++D   +  +   + + +  MSE   + +   L+  F  +D   D+ +  
Sbjct: 243 LRELPLHKCITLDVILRMKSHILQEIIIRQMSEFA-SSIIPSLISKFGTLDESQDEDICI 301

Query: 295 ILVMILD-AMSKDSRDELSHDAISLNFVTKRLHSEDHLVRERTMFVAKKLTNDQLQYESD 353
           I VM+L   ++++ R++L+HD   L+ +TKRL  ++   RERTMF+AK  +N++L+Y+SD
Sbjct: 302 IFVMVLKFNLNEEQREQLAHDGNFLDAITKRLSHKNSEFRERTMFIAKLASNNELEYDSD 361

Query: 354 FTIDLPRIELIKLSKLEF-PIKEGLQNLPKGNSTKNELVQQFNTITLQXXXXXXXXXXXR 412
           F I LP +++    K+E  P      +     S  + +   F+ + LQ           +
Sbjct: 362 FVIKLPDLDITNNEKIEIDPALFKRSSSGVSASKVSRISSGFHEMVLQEDSDDEVQDDEQ 421

Query: 413 XXXXXXXXXXXXXXVIKNDGSE-----LRLLKETVKLVRQKKNFPTEVSFYSKELLKKIA 467
                           + +G++     + LLK+T+ LVRQK++FP EV +Y   LL  IA
Sbjct: 422 EIINRIVFLKDLVKEFEKNGNDGPAESIPLLKKTITLVRQKEHFPLEVDYYFSGLLTNIA 481

Query: 468 TISNKFDEKSFEEWKANALVSILVVCPDKIVDLYAILFNNELSLQQRMVILTSAALSARE 527
            ++N  +E +FEEW+ NALVS+LVV P+K+ +L  I  ++ELSLQQRM IL+S  LSARE
Sbjct: 482 YLNNNLEESNFEEWRINALVSLLVVVPEKVQELIKIFLSSELSLQQRMSILSSLGLSARE 541

Query: 528 LRGFDDEFVVKPKYDFPTNRLPWDESATEQQPENNKIQDITEITGS-------KVTWRSK 580
           LRG DD+ + KPK DFPT+RLPWD+   EQ  +    + ITE+  S       K TW+SK
Sbjct: 542 LRGMDDKVITKPKLDFPTSRLPWDKKTKEQHDK----KRITELGNSNSTLIETKTTWKSK 597

Query: 581 RLETDSKITQQQNNFRKYATLFFYPLAHAWLNGINLGAFDKVFKRHYISMLKIILTCASP 640
           +L   +K   + N FR+YATLFFYPLAH WLNGI++G FD +FK H+++ L+II  CA P
Sbjct: 598 KLTLAAK-EDKPNRFREYATLFFYPLAHIWLNGIDVGTFDDLFKNHFLTTLRIIYMCAHP 656

Query: 641 HYELEEMQILMQEIL 655
            ++ E M  LM++I+
Sbjct: 657 VHDYESMTQLMEQII 671

>Kwal_55.20529
          Length = 691

 Score =  373 bits (958), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 217/673 (32%), Positives = 364/673 (54%), Gaps = 43/673 (6%)

Query: 9   LNEKCDKDTIYQVLERMSSKKQHSSNEILPIIKNVVPIYPSLPRELKMALRRLCGNNYIF 68
           L  +   + I + L  + S+   +      + + V+P+Y SLP   KM L  +   +++ 
Sbjct: 17  LKTQPSAEVIQECLSVIQSQASLTVESAAVLARYVIPVYTSLPSASKMLLFTIFEESFLL 76

Query: 69  ISLVIEYAKELGKNRETSIFYGFLTDVLKYESDCLFNYLEHSSR-RDLPFIKSILFGSRC 127
           +  V+ + K L K+ E  I+  FL + L +   C++ Y+  +    +L  ++S  FGS+ 
Sbjct: 77  LGHVLNFIKLLQKSSEAKIYKRFLIEGLSHNHGCIYKYIRGAEHITELQMLRSAFFGSKI 136

Query: 128 YNALSSSISIVEYLKFMKMQWEFVFKETKQY-DKTHLEMFVSCLQLNIPYGVDIFIEGLA 186
            N++   I I  YL  ++ Q++F+F +T Q+ DK + +   + + L+     ++   GL 
Sbjct: 137 LNSVGDEIDIENYLDIVRAQFKFIFDQTPQFEDKVYADFLCAFISLHSLLAPEVVFGGLV 196

Query: 187 TTSEFSWNALIMMLSKGTSVQQRRFFMYHLVPFLEKVTNPDNSSTIFTLLSQLPFDIPTS 246
            +SE  ++  + +L   + + Q++  +  L+ FL+   +  N+ + F +  ++  ++ ++
Sbjct: 197 LSSEDHFSKFVQILRCASLLSQKKL-VKALIFFLDSRVSQANTDSAFNIFQRVGVELLST 255

Query: 247 IDCFKWGNPYFKIVYLHGMSEAKRAQLFRELLPCFELMDLYTDDSLAEILVMILDAMSKD 306
               K  N     V +  ++E +  +L+  LL  F   +  +D +   +L + L  +   
Sbjct: 256 DILLKVHNEILSAVLVRNLTEEQALKLYHSLLVFFHRHEAESDGTACFLLCLALQRLPHS 315

Query: 307 SRDELSHDAISLNFVTKRLHSEDHLVRERTMFVAKKLTNDQLQYESDFTIDLPRIELIKL 366
            + EL H    LN VT RL S+D  +RERTM++AKK+TND  +YESDFTI+ P I+  K 
Sbjct: 316 VKAELGHAEEFLNAVTFRLTSQDAAIRERTMYIAKKITNDSFEYESDFTIETPHIKTPKS 375

Query: 367 SKLEF-------PIKEGLQNLPKGNSTKNELVQ--------QFNTITLQXXXXXXXXXXX 411
           S ++F       P+ +  +N     S  N +V+          N +TL            
Sbjct: 376 SIIDFSTLQAVKPLHDHERNFKPSASLDNTMVRLSLSESETDENGVTL------------ 423

Query: 412 RXXXXXXXXXXXXXXVIKNDGSELRLLKETVKLVRQKKNFPTEVSFYSKELLKKIATISN 471
                          +     S L LLK TV+L+RQKK+F  E+S YS +LL  I +++N
Sbjct: 424 ---VFLKDLIREFELLSNQTASRLHLLKSTVRLIRQKKDFTLEISTYSPQLLAVITSLAN 480

Query: 472 KFDEKSFEEWKANALVSILVVCPDKIVDLYAILFNNELSLQQRMVILTSAALSARELRGF 531
             +E +FEEW+ NALVSIL   P+K+++L  ILF  ELSLQQRM IL++ +L+ARELRG 
Sbjct: 481 NLEEPAFEEWRINALVSILFAAPEKVIELIKILFGQELSLQQRMSILSALSLAARELRGI 540

Query: 532 DDEFVVKPKYDFPTNRLPWDESATEQQPENNKIQDITEITGS-----KVTWRSKRLETDS 586
           DD  ++K + DFPT RLPWD+   E   +N+K+      + S     K TW+SK+L T +
Sbjct: 541 DDSVIMKLQVDFPTKRLPWDKGKPEGM-KNDKLSASVPTSKSLLQENKTTWKSKKLTTSA 599

Query: 587 KITQQQNNFRKYATLFFYPLAHAWLNGINLGAFDKVFKRHYISMLKIILTCASPHYEL-- 644
           K    +N FRK A  FF+PLAH WLNGIN+G +D +FK+HY++ ++++L+ A PH+E   
Sbjct: 600 KDILSENRFRKVAAKFFFPLAHGWLNGINMGTYDLMFKKHYLTTMQMVLSAAYPHHEFNS 659

Query: 645 --EEMQILMQEIL 655
             ++M I++Q+ +
Sbjct: 660 MCQQMAIIVQDAI 672

>YGR099W (TEL2) [2059] chr7 (687901..689967) Protein involved in
           controlling telomere length and telomere position effect
           [2067 bp, 688 aa]
          Length = 688

 Score =  371 bits (953), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 230/678 (33%), Positives = 369/678 (54%), Gaps = 37/678 (5%)

Query: 9   LNEKCDKDTIYQVLERMSS--KKQHSSNEILPIIKNVVPIYPSLPRELKMALRRLCGNNY 66
           L +  D   I++ L ++ S  ++    +  + +IK V+P+YPSLP   K+ LRRL   ++
Sbjct: 6   LKQGLDSSQIHEALIQLDSYPREPVDLDASMVLIKFVIPVYPSLPERSKVILRRLASKSF 65

Query: 67  IFISLVIEYAKEL-GKN--RETSIFYGFLTDVLKYESDCLFNYLEHS--SRRDLPFIKSI 121
            F+  ++ +++ + G++  +E  I+   L D++ +E  CL  YL+ S  S+ D   IK++
Sbjct: 66  TFLCQIVTFSRTISGRDGLQEIRIYQEILEDIISFEPGCLTFYLKASTTSKADRDSIKAL 125

Query: 122 LFGSRCYNALSSSISIVEYLKFMKMQWEFVFKETKQYDKTHL--EMFVSCLQLNIPYGVD 179
            FGS+ +N L++ I + +YL ++++QW+F+  E+ + D      E  VS   LN     D
Sbjct: 126 FFGSKLFNVLANRIDMAKYLGYLRLQWKFLL-ESNETDPPGFLGEWLVSSFLLNPVLAAD 184

Query: 180 IFIEGLATTSEFSWNALIMMLSKGTSVQQRRFFMYHLVPFLEKVTNPDNSSTIFTLLSQL 239
           + +  L    E  + +   ++S  + + Q+R     L+P+++ +   +N + +  +L + 
Sbjct: 185 MLLGELFLLKESYFFSFQKIISASSLIDQKRLIAKFLLPYIQVIVTLENLNDVRKILRRF 244

Query: 240 PFDIPTSIDC-FKWGNPYFKIVYLHGMSEAKRAQLFRELLPCF-ELMDLYTDDSLAEILV 297
             D   S+   F+  +   K V +  MS     +    L+  F +  D   D    E+LV
Sbjct: 245 DLDKIISLSVLFEIQSLPLKEVIVRLMSNHSSTKFVSALVSKFADFTDEEVDTKTCELLV 304

Query: 298 MI-LDAMSKDSRDELSHDAISLNFVTKRLHSEDHLVRERTMFVAKKLTNDQLQYESDFTI 356
           +  +  ++   R+E++HD   LN VTK L S +   RER MF+AK L+   L+YESDF I
Sbjct: 305 LFAVHNLNHSQREEIAHDERFLNGVTKHLGSNEREARERAMFIAKLLSGGHLKYESDFKI 364

Query: 357 DLPRIE--------LIKLSKLEFPIKEGLQNLPKGNSTKNELVQQFNTITLQXXXXXXXX 408
           ++P ++        +I    L+ P     Q    G     E+     ++TL         
Sbjct: 365 NIPNVKFESNSDDKIIDFQSLKNPSICNTQT-DVGKDKITEVSGHVQSLTLDCSDSDDED 423

Query: 409 XXXRXXXXXXXXXXXXXXVIKNDGSELR------LLKETVKLVRQKKNFPTEVSFYSKEL 462
                                    E R      LLK+TVKL+RQK +F  EV +Y++ +
Sbjct: 424 ENDEREIVKRIVFLKDLMKEYEKTGESRKAPLIPLLKQTVKLIRQKADFQLEVGYYAQGI 483

Query: 463 LKKIATISNKFDEKSFEEWKANALVSILVVCPDKIVDLYAILFNNELSLQQRMVILTSAA 522
           L  I  ++N+FDE  FE+W+ NAL SILVV P+K+     ILFN+ELSLQQRM +L++  
Sbjct: 484 LSSIVCLNNEFDEPLFEQWRINALTSILVVLPEKVNGAINILFNSELSLQQRMSLLSALG 543

Query: 523 LSARELRGFDDEFVVKPKYDFPTNRLPWDESATEQQPENNKIQDITEITG----SKVTWR 578
           LSARELRG DD  +VKPK+DFPTNRLPWD    +Q   N+++ ++ E T     +K  W+
Sbjct: 544 LSARELRGLDDPTIVKPKFDFPTNRLPWD----DQSHHNSRLVEVQESTSMIKKTKTVWK 599

Query: 579 SKRLETDSKITQQQNNFRKYATLFFYPLAHAWLNGINLGAFDKVFKRHYISMLKIILTCA 638
           S++L  D +    QN FRKYA LFFYPLAH WLNGI++G ++++FK HY++ L+II +CA
Sbjct: 600 SRKLGKDRE-KGTQNRFRKYAGLFFYPLAHGWLNGIDVGTYNQLFKSHYLTTLRIIYSCA 658

Query: 639 SPHYELEEMQILMQEILS 656
           +P ++ E M  LM  I+S
Sbjct: 659 NPVHDFESMTELMNHIIS 676

>AAR090W [276] [Homologous to ScYGR099W (TEL2) - SH]
           complement(506082..508061) [1980 bp, 659 aa]
          Length = 659

 Score =  311 bits (797), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 207/645 (32%), Positives = 335/645 (51%), Gaps = 18/645 (2%)

Query: 20  QVLERMSSKKQHSS---NEILPIIKNVVPIYPSLPRELKMALRRLCGNNYIFISLVIEYA 76
           +V+E++ S+ + S       L +++ VV  Y SLP  L+  LRRLCG + + +S V+  A
Sbjct: 13  EVMEQVLSELEQSPMAPEAALVVLQRVVTAYESLPSRLQAMLRRLCGKSSVLMSQVVVAA 72

Query: 77  KELGKNRETSIFYGFLTDVLKYESDCLFNYLEHSSRRDLPFIKSILFGSRCYNALSSSIS 136
           +++    E  I+   L + L+ E   L + L          + ++ FGSR +N L+ ++S
Sbjct: 73  QQVRGRPEAGIYQRVLRETLEREPGALAHQLAGGGPTQRRLVTALFFGSRVFNVLAHTLS 132

Query: 137 IVEYLKFMKMQWEFVFKETKQYDKTHLEMFVSCLQLNIPYGVDIFIEGLATTSEFSWNAL 196
              Y+  +  Q +  F++     +   E+ V+ L+ +     D  ++      E  W   
Sbjct: 133 AAAYVSLLTPQLQTWFEKGAGAPEDA-EVLVALLRFHPTQAADALVD--LVLCEVRWQIF 189

Query: 197 IMMLSKGTSVQQRRFFMYHLVPFLEKVTNPDNSSTIFTLLSQLPFDIPTSIDCFKWGNPY 256
             + ++   V QR+     L+  L ++    N    + LL  L + +   ++  K  + +
Sbjct: 190 CKICNQRVGVVQRQLVNGFLLRTLGRLVEASNVQAAYDLLLTLDYRLFNLLELHKVNSVH 249

Query: 257 FKIVYLHGMSEAKRAQLFRELLPCFELMDLYTDDSLAEILVMILDAMSKDSRDELSHDAI 316
            +   +  + E+    L +  L  F   D   D+    +  +++  M+    +++ HD  
Sbjct: 250 LQSAIVQVLPESGCEALLKICLGMFGTPD-TDDEKRCNLFAILIARMAGPELEKIVHDQQ 308

Query: 317 SLNFVTKRLHSEDHLVRERTMFVAKKLTNDQLQYESDFTIDLPRIELIKLSKLEFPIKEG 376
            L+ VT RL SED  VR+RTM +AK +  + L+YE+   I LP   L     + F   E 
Sbjct: 309 FLSAVTFRLASEDGAVRDRTMSIAKAVAGESLKYEAAH-IKLPVPPLRPKGTICF---EE 364

Query: 377 LQNLPKGNSTKNELVQ-QFNTITLQXXXXXXXXXXX-RXXXXXXXXXXXXXXVIKNDGSE 434
           +          N  V+ Q   +TL+            R              +   D SE
Sbjct: 365 ITTPRASAYVNNSAVEPQLGALTLEDSDDSDVDSDGERRGREIVFLKDLLVELEAPDLSE 424

Query: 435 ---LRLLKETVKLVRQKKNFPTEVSFYSKELLKKIATISNKFDEKSFEEWKANALVSILV 491
              LRLLK T+KLVRQK+ F +EVSFY+  +L  +ATISN   E+ FEE++ NALVS+LV
Sbjct: 425 RGPLRLLKLTIKLVRQKQAFVSEVSFYAPAMLTAVATISNSQSEQDFEEYRINALVSLLV 484

Query: 492 VCPDKIVDLYAILFNNELSLQQRMVILTSAALSARELRGFDDEFVVKPKYDFPTNRLPWD 551
             P+K+ DL  +LF  +LSLQQRM IL++ AL+ARELRG +D++V+KP +DFPT RLP +
Sbjct: 485 AVPEKVTDLLHLLFQADLSLQQRMAILSALALAARELRGLEDKYVLKPVFDFPTRRLPRN 544

Query: 552 ESATEQ-QPENNKIQDITEITGSKVTWRSKRLETDSKITQQQNNFRKYATLFFYPLAHAW 610
           ++ +   +   +       I+     WRS++L++ +   ++ N FRK+A  FF+PLAHAW
Sbjct: 545 DAPSRALESRESGTSSEGTISAHHTVWRSRKLDS-APAPERPNAFRKHAPAFFFPLAHAW 603

Query: 611 LNGINLGAFDKVFKRHYISMLKIILTCASPHYELEEMQILMQEIL 655
           LNGI+LG FD +FK+HY+S L++IL  A+PH E + M  LM  +L
Sbjct: 604 LNGIDLGTFDALFKKHYLSTLRLILAAANPHAEFDRMSELMSYVL 648

>CAGL0G07755g 736112..738169 similar to sp|P53038 Saccharomyces
           cerevisiae YGR099w TEL2 involved in controlling telomere
           length and position effect, hypothetical start
          Length = 685

 Score =  205 bits (522), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 114/225 (50%), Positives = 162/225 (72%), Gaps = 14/225 (6%)

Query: 437 LLKETVKLVRQKKNFPTEVSFYSKELLKKIATISNKFDEKSFEEWKANALVSILVVCPDK 496
           +LK TVKLVRQKK F +EV++Y+  +++ I  ++N  DEK FEE + NALVSILVV P+K
Sbjct: 456 ILKNTVKLVRQKKLFRSEVAYYAGAMIRNIVILNNDLDEKQFEELRVNALVSILVVVPEK 515

Query: 497 IVDLYAILFNNELSLQQRMVILTSAALSARELRGFDDEFVVKPKYDFPTNRLPWDESATE 556
           I +L  +LF  ELSLQQR+ +L S ++SARELRG+DD+ ++KP++DFPT+ LPWD     
Sbjct: 516 IDELLKMLFTAELSLQQRLSLLLSVSMSARELRGYDDKQILKPQFDFPTSMLPWD----- 570

Query: 557 QQPENNKIQDITE-----ITGSKVTWRSKRLETDSKITQQQNN-FRKYATLFFYPLAHAW 610
           ++ ENN+I++I +      +G KV W+S +L   +K T++ NN FR+YA+ FFYPLA+ W
Sbjct: 571 RRQENNRIEEIDDNGSDNTSGGKVLWKSSKL---TKNTEEINNRFREYASKFFYPLANGW 627

Query: 611 LNGINLGAFDKVFKRHYISMLKIILTCASPHYELEEMQILMQEIL 655
           LNGI+LG FDK+FK +Y+S LK +  CA   ++ E+M   M  IL
Sbjct: 628 LNGIDLGTFDKLFKTYYLSTLKTVYNCAYLVHDFEDMTTTMDTIL 672

 Score = 96.3 bits (238), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 84/354 (23%), Positives = 168/354 (47%), Gaps = 14/354 (3%)

Query: 16  DTIYQVLERMSSKKQHSSNEILPIIKNVVPIYPSLPRELKMALRRLCGNNYIFISLVIEY 75
           DT++Q  + +++      + IL +IK VV  +  +P+ + + L     ++ I  S +I++
Sbjct: 25  DTVFQEKDSLTN-----IDVILTVIKYVVSHHQVMPKSVILKLNWFFAHSLIGFSQLIKF 79

Query: 76  AKEL-GKNRETSIFYGFLTDVLKYESDCLFNYL-EHSSRRDLPFI-KSILFGSRCYNALS 132
             ++  K  E  I+  ++T  LK  +  L NYL E +  R    I K    GS  +N + 
Sbjct: 80  GSDIDAKQSEQLIYIEYVTQFLKSSTTYLQNYLIECTENRTKELILKRTFTGSTVFNFVK 139

Query: 133 SSISIVEYLKFMKMQWEFVFKE----TKQYDKTHLEMFVSCLQLNIPYGVDIFIEGLATT 188
             ++ +EY++ +  Q  F   +    +  + K       S    +  +  D+ +      
Sbjct: 140 GKLNPLEYIELLNNQLVFALDKLDSRSGDFHKYLGNHIASLCDFHNIFAPDVILSKTFLI 199

Query: 189 SEFSWNALIMMLSKGTSVQQRRFFMYHLVPFLEKVTNPDNSSTIFTLLSQLPFDIPTSI- 247
            +     L + + K +   + +  + +L+P+L+KV +  N+  +  +L  L       + 
Sbjct: 200 KQERLETLSLFMKKTSEYTRYKIGIKYLLPYLDKVCSDTNAQLVHHILGTLGIGKLILVQ 259

Query: 248 DCFKWGNPYFKIVYLHGMSEAKRAQLFRELLPCFELMDLYTDDSLAEILVMILDAMSKDS 307
           D F+  +   +   L  +   K   +   LL  F  ++  +D++  +++V IL     DS
Sbjct: 260 DIFRLNSFTLQKTILAILDSKKIDSVMDFLLMKFHSIEYESDNNTCQLIVTILKNHLNDS 319

Query: 308 -RDELSHDAISLNFVTKRLHSEDHLVRERTMFVAKKLTNDQLQYESDFTIDLPR 360
            + ++ H    LN +TKRL  +D ++RER+M++AK  +N ++ YESDFTID+ +
Sbjct: 320 GKIKVCHSDQFLNAITKRLSDQDKIIRERSMYIAKIASNHKIDYESDFTIDIGK 373

>YKR054C (DYN1) [3305] chr11 complement(535289..547567) Cytoplasmic
            dynein, heavy chain, mutants have defects in spindle
            orientation and nuclear migration [12279 bp, 4092 aa]
          Length = 4092

 Score = 31.2 bits (69), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 5/58 (8%)

Query: 113  RDLPFIKSILFGSRCYNALSSSISIVEYLKFMKMQWEFVFKETKQYDKTHLEMFVSCL 170
            RD+  IK+ +  S     L  SIS+V+ L F K +W      TKQ+ KT  E+  +C+
Sbjct: 3273 RDVEAIKTEM--SNVQANLDRSISLVKSLTFEKERW---LNTTKQFSKTSQELIGNCI 3325

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.136    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 20,829,059
Number of extensions: 907411
Number of successful extensions: 2828
Number of sequences better than 10.0: 15
Number of HSP's gapped: 2879
Number of HSP's successfully gapped: 19
Length of query: 656
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 548
Effective length of database: 12,857,365
Effective search space: 7045836020
Effective search space used: 7045836020
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 65 (29.6 bits)