Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0D15136g1591156681140.0
AAR089C1618154126480.0
Scas_716.271620157823040.0
Kwal_55.205351636158321360.0
YGR098C (ESP1)1630160520600.0
CAGL0G03223g16049259321e-103
CAGL0L04136g82993820.23
Kwal_27.1251495870780.77
Sklu_2412.159182780.80
YDR135C (YCF1)151585770.99
KLLA0F17655g59074732.8
YER142C (MAG1)29674723.2
CAGL0L08932g31251697.2
Kwal_33.134612197225707.6
AGL006C30551689.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D15136g
         (1566 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D15136g complement(1276819..1281594) similar to sp|Q03018 S...  3130   0.0  
AAR089C [275] [Homologous to ScYGR098C (ESP1) - SH] (500951..505...  1024   0.0  
Scas_716.27                                                           892   0.0  
Kwal_55.20535                                                         827   0.0  
YGR098C (ESP1) [2058] chr7 complement(682568..687460) Separin pr...   798   0.0  
CAGL0G03223g complement(300119..304933) similar to sp|Q03018 Sac...   363   e-103
CAGL0L04136g complement(482826..485315) similar to sp|P53540 Sac...    36   0.23 
Kwal_27.12514                                                          35   0.77 
Sklu_2412.1 YMR120C, Contig c2412 44-1819 reverse complement           35   0.80 
YDR135C (YCF1) [981] chr4 complement(722998..727545) Vacuolar gl...    34   0.99 
KLLA0F17655g 1619715..1621487 highly similar to sp|P38009 Saccha...    33   2.8  
YER142C (MAG1) [1571] chr5 complement(455141..456031) DNA-3-meth...    32   3.2  
CAGL0L08932g complement(974259..975197) highly similar to tr|Q12...    31   7.2  
Kwal_33.13461                                                          32   7.6  
AGL006C [4305] [Homologous to ScYPL004C - SH] (712798..713715) [...    31   9.3  

>KLLA0D15136g complement(1276819..1281594) similar to sp|Q03018
            Saccharomyces cerevisiae YGR098c ESP1 required for sister
            chromatid separation singleton, hypothetical start
          Length = 1591

 Score = 3130 bits (8114), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1522/1566 (97%), Positives = 1522/1566 (97%)

Query: 1    MKGVLSDMKVDNRVRRPLNAGSTKYDTEWQATSNSSKITTAQENNTNSLIDWKKLYDFVD 60
            MKGVLSDMKVDNRVRRPLNAGSTKYDTEWQATSNSSKITTAQENNTNSLIDWKKLYDFVD
Sbjct: 1    MKGVLSDMKVDNRVRRPLNAGSTKYDTEWQATSNSSKITTAQENNTNSLIDWKKLYDFVD 60

Query: 61   NKSKDFENYIQVNDSFIQLYRQLIWRHQLKKLQELPKKHMNWIIFLMERNKLTQASNQIL 120
            NKSKDFENYIQVNDSFIQLYRQLIWRHQLKKLQELPKKHMNWIIFLMERNKLTQASNQIL
Sbjct: 61   NKSKDFENYIQVNDSFIQLYRQLIWRHQLKKLQELPKKHMNWIIFLMERNKLTQASNQIL 120

Query: 121  MLYNETNLIKAKGIDDVLLSDFSAGNENYLATLKVITMQLILKTGTTERHAESLLECFAH 180
            MLYNETNLIKAKGIDDVLLSDFSAGNENYLATLKVITMQLILKTGTTERHAESLLECFAH
Sbjct: 121  MLYNETNLIKAKGIDDVLLSDFSAGNENYLATLKVITMQLILKTGTTERHAESLLECFAH 180

Query: 181  DTRYLLKDPNVKVHALVKLILNFFTLLTGFKPLFGLKFVQYVNQFKLEFGNYIKNMDSST 240
            DTRYLLKDPNVKVHALVKLILNFFTLLTGFKPLFGLKFVQYVNQFKLEFGNYIKNMDSST
Sbjct: 181  DTRYLLKDPNVKVHALVKLILNFFTLLTGFKPLFGLKFVQYVNQFKLEFGNYIKNMDSST 240

Query: 241  FQRQITKLLRKDISVNCHIYLPKYYDEYTKHMENDQVNLTEFLRTDVIGKDVCTEIRNQL 300
            FQRQITKLLRKDISVNCHIYLPKYYDEYTKHMENDQVNLTEFLRTDVIGKDVCTEIRNQL
Sbjct: 241  FQRQITKLLRKDISVNCHIYLPKYYDEYTKHMENDQVNLTEFLRTDVIGKDVCTEIRNQL 300

Query: 301  RLQSFSAGKIDALLRPFLYQAALNKSSSRLCDSLIISVNNSIKDLNEEAVIYVLVYLSKI 360
            RLQSFSAGKIDALLRPFLYQAALNKSSSRLCDSLIISVNNSIKDLNEEAVIYVLVYLSKI
Sbjct: 301  RLQSFSAGKIDALLRPFLYQAALNKSSSRLCDSLIISVNNSIKDLNEEAVIYVLVYLSKI 360

Query: 361  FLSFEDFKRTDNVAAVLYNCFVTKRKLLFLEHAAMVNYRAYLRTSNILEHFKKFERIIGC 420
            FLSFEDFKRTDNVAAVLYNCFVTKRKLLFLEHAAMVNYRAYLRTSNILEHFKKFERIIGC
Sbjct: 361  FLSFEDFKRTDNVAAVLYNCFVTKRKLLFLEHAAMVNYRAYLRTSNILEHFKKFERIIGC 420

Query: 421  CQDRNVQKLLFSYVCNVFMIFKENTLQDMWNLTRKSLVPCFRRMKLDKFEIFNFSSEPML 480
            CQDRNVQKLLFSYVCNVFMIFKENTLQDMWNLTRKSLVPCFRRMKLDKFEIFNFSSEPML
Sbjct: 421  CQDRNVQKLLFSYVCNVFMIFKENTLQDMWNLTRKSLVPCFRRMKLDKFEIFNFSSEPML 480

Query: 481  CLLYSGSHFSYQFKWSHLCQMLTDIVTDVKQSDLQIDMKINTLDSFSKYEVLIKSMFCLN 540
            CLLYSGSHFSYQFKWSHLCQMLTDIVTDVKQSDLQIDMKINTLDSFSKYEVLIKSMFCLN
Sbjct: 481  CLLYSGSHFSYQFKWSHLCQMLTDIVTDVKQSDLQIDMKINTLDSFSKYEVLIKSMFCLN 540

Query: 541  SEMNRNSCLKLQKVSNIYLEKWVNKGNETKXXXXXXXXXXXXXXXXXQNKIYKLTAEICT 600
            SEMNRNSCLKLQKVSNIYLEKWVNKGNETK                 QNKIYKLTAEICT
Sbjct: 541  SEMNRNSCLKLQKVSNIYLEKWVNKGNETKLSDLELMLLESMMPFLLQNKIYKLTAEICT 600

Query: 601  QLRSVQRYASIPDLISYWLLESYVGLQIGPKVELSIMETVSALKYQPSSFTEMNVDQLHT 660
            QLRSVQRYASIPDLISYWLLESYVGLQIGPKVELSIMETVSALKYQPSSFTEMNVDQLHT
Sbjct: 601  QLRSVQRYASIPDLISYWLLESYVGLQIGPKVELSIMETVSALKYQPSSFTEMNVDQLHT 660

Query: 661  TLCILLTQVLWKKDIETFNKLIHDDLTRFRPNLFDIQNKTKMPVAEYLKILMLNIKITRC 720
            TLCILLTQVLWKKDIETFNKLIHDDLTRFRPNLFDIQNKTKMPVAEYLKILMLNIKITRC
Sbjct: 661  TLCILLTQVLWKKDIETFNKLIHDDLTRFRPNLFDIQNKTKMPVAEYLKILMLNIKITRC 720

Query: 721  ASILQLSQNNVYMSLKECKRSLKICRLLIKKEAVLSAKYRFEVISLLDDIFQRIISIYVH 780
            ASILQLSQNNVYMSLKECKRSLKICRLLIKKEAVLSAKYRFEVISLLDDIFQRIISIYVH
Sbjct: 721  ASILQLSQNNVYMSLKECKRSLKICRLLIKKEAVLSAKYRFEVISLLDDIFQRIISIYVH 780

Query: 781  TGIFKDCAFFITEYQEVIGSLDNPTALFNMFSCLCSYYQLIEESENASLSLTKMNAAFDQ 840
            TGIFKDCAFFITEYQEVIGSLDNPTALFNMFSCLCSYYQLIEESENASLSLTKMNAAFDQ
Sbjct: 781  TGIFKDCAFFITEYQEVIGSLDNPTALFNMFSCLCSYYQLIEESENASLSLTKMNAAFDQ 840

Query: 841  IDGSANIEALATFLYFNKESEKLNNSMRLFFGDDVFISDIVEYWLLRSCQKTSTETTRKD 900
            IDGSANIEALATFLYFNKESEKLNNSMRLFFGDDVFISDIVEYWLLRSCQKTSTETTRKD
Sbjct: 841  IDGSANIEALATFLYFNKESEKLNNSMRLFFGDDVFISDIVEYWLLRSCQKTSTETTRKD 900

Query: 901  FEAMVCMNNAKILYNKVQKQMATDTFFRSMGESVMAIPACYDCDSISVDGRHKSLSLTSV 960
            FEAMVCMNNAKILYNKVQKQMATDTFFRSMGESVMAIPACYDCDSISVDGRHKSLSLTSV
Sbjct: 901  FEAMVCMNNAKILYNKVQKQMATDTFFRSMGESVMAIPACYDCDSISVDGRHKSLSLTSV 960

Query: 961  QTLKSVNDSPRPSSLTPRGKSLAYSFDRSTAINNLQMTDRFIQNADIKALKAHEIRELAS 1020
            QTLKSVNDSPRPSSLTPRGKSLAYSFDRSTAINNLQMTDRFIQNADIKALKAHEIRELAS
Sbjct: 961  QTLKSVNDSPRPSSLTPRGKSLAYSFDRSTAINNLQMTDRFIQNADIKALKAHEIRELAS 1020

Query: 1021 LHSLTLSLFFNMSTKTRLESQLGQNFRLRDHPRSLSLLYEKAFSDMGTEIYDSFIPETIA 1080
            LHSLTLSLFFNMSTKTRLESQLGQNFRLRDHPRSLSLLYEKAFSDMGTEIYDSFIPETIA
Sbjct: 1021 LHSLTLSLFFNMSTKTRLESQLGQNFRLRDHPRSLSLLYEKAFSDMGTEIYDSFIPETIA 1080

Query: 1081 TESVEMSECNMNLATIHSEFGKKWSHLSFNVVEIDICQLTGDLLITRFDTVXXXXXXXXX 1140
            TESVEMSECNMNLATIHSEFGKKWSHLSFNVVEIDICQLTGDLLITRFDTV         
Sbjct: 1081 TESVEMSECNMNLATIHSEFGKKWSHLSFNVVEIDICQLTGDLLITRFDTVRNKHLHLRL 1140

Query: 1141 XXXXXXSRDLSEEVLGFEAALDELNHIISSNNCXXXXXXXXXXXXKEQRKNWWDERYALN 1200
                  SRDLSEEVLGFEAALDELNHIISSNNC            KEQRKNWWDERYALN
Sbjct: 1141 PLNRHNSRDLSEEVLGFEAALDELNHIISSNNCTTSIEVTSVITTKEQRKNWWDERYALN 1200

Query: 1201 NRLQTLLTKIEDSWFCGFKGVFNPRIVDQQQFEIFKKGFQSILHTHLPSRKSSRQSDSFL 1260
            NRLQTLLTKIEDSWFCGFKGVFNPRIVDQQQFEIFKKGFQSILHTHLPSRKSSRQSDSFL
Sbjct: 1201 NRLQTLLTKIEDSWFCGFKGVFNPRIVDQQQFEIFKKGFQSILHTHLPSRKSSRQSDSFL 1260

Query: 1261 QVDNMLIELFVLLDVINQPTEKAVSMMEDLIYFVFDILLFHGEQNAYDEIDVNLMHVKFE 1320
            QVDNMLIELFVLLDVINQPTEKAVSMMEDLIYFVFDILLFHGEQNAYDEIDVNLMHVKFE
Sbjct: 1261 QVDNMLIELFVLLDVINQPTEKAVSMMEDLIYFVFDILLFHGEQNAYDEIDVNLMHVKFE 1320

Query: 1321 ELLQEYNAESKTKDQTLDHTFLILGNKCHSIPWESLDFLKSISISRVPSIKMLDELLTKH 1380
            ELLQEYNAESKTKDQTLDHTFLILGNKCHSIPWESLDFLKSISISRVPSIKMLDELLTKH
Sbjct: 1321 ELLQEYNAESKTKDQTLDHTFLILGNKCHSIPWESLDFLKSISISRVPSIKMLDELLTKH 1380

Query: 1381 SELSPCVNVSENLSFVLNPGNDLGRTETVFSSEFIAMASRTNSKAFIGKPPTVDEFFHSV 1440
            SELSPCVNVSENLSFVLNPGNDLGRTETVFSSEFIAMASRTNSKAFIGKPPTVDEFFHSV
Sbjct: 1381 SELSPCVNVSENLSFVLNPGNDLGRTETVFSSEFIAMASRTNSKAFIGKPPTVDEFFHSV 1440

Query: 1441 ADSNLFVYVGHSGGEQYVKLKDLRKCNHLAPSLLLGCSSAHLKYCGTFESSGTIYSYLLG 1500
            ADSNLFVYVGHSGGEQYVKLKDLRKCNHLAPSLLLGCSSAHLKYCGTFESSGTIYSYLLG
Sbjct: 1441 ADSNLFVYVGHSGGEQYVKLKDLRKCNHLAPSLLLGCSSAHLKYCGTFESSGTIYSYLLG 1500

Query: 1501 GSPMVVGNLWDVTDKDTDKLSVSVFEKTGFFNSKPISRTDESDATIKQFLNVSEAISQSR 1560
            GSPMVVGNLWDVTDKDTDKLSVSVFEKTGFFNSKPISRTDESDATIKQFLNVSEAISQSR
Sbjct: 1501 GSPMVVGNLWDVTDKDTDKLSVSVFEKTGFFNSKPISRTDESDATIKQFLNVSEAISQSR 1560

Query: 1561 DECNMK 1566
            DECNMK
Sbjct: 1561 DECNMK 1566

>AAR089C [275] [Homologous to ScYGR098C (ESP1) - SH] (500951..505807)
            [4857 bp, 1618 aa]
          Length = 1618

 Score = 1024 bits (2648), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 583/1541 (37%), Positives = 891/1541 (57%), Gaps = 72/1541 (4%)

Query: 71   QVNDSFIQLYRQLIWRHQLKKLQELPKKHMNWIIFLMERNKLTQASNQILMLYNETNLIK 130
            +V ++   LYR+L  RHQL ++ E+ ++HM  ++ L+E  +   A+ +++ LYN+TN   
Sbjct: 77   KVREALTGLYRELKQRHQLGRVAEVSRQHMGVVVRLLEAGQDAAAAREVVALYNQTNYRP 136

Query: 131  AKGIDDVLLSDFSAGNENYLATLKVITMQLILKTGTTERHAESLLECFAHDTRYLLKDPN 190
            A G+ DVL++DF   NE YL+T K++ MQLI++    E HAE+++  FA D RY+L+DP 
Sbjct: 137  AGGLGDVLMADFGVSNERYLSTAKILAMQLIIRMRQVESHAETVVRIFAADERYILRDPK 196

Query: 191  VKVHALVKLILNFFTLLTGFKPLFGLKFVQYVNQFKLEFGNYIKNMDSSTFQRQITKLLR 250
            +KVH +VKLILNFF+LL  +K LF LKF+QYV+QF+L+F  YIKNMD + FQ+Q+ K   
Sbjct: 197  LKVHTVVKLILNFFSLLPQYKVLFALKFLQYVSQFRLDFSTYIKNMDLAKFQKQVLKFAG 256

Query: 251  KDISVNCHIYLPKYYDEYTKHMEN----------------------DQVNLTEFL---RT 285
              +  +   +L  YY  Y++HM +                      D + L + L   RT
Sbjct: 257  AGLESSLP-FLDIYYRSYSQHMTSIGKLMWQDFRVPDRGDTKLNPEDPIILQQILHGRRT 315

Query: 286  ------DVIGKDVCTEIRNQLRLQSFSAGKIDA-LLRPFLYQAALNKSSSRLCDSLIISV 338
                  D   K + T++   +       G +   +L   L +  L K+   L D + I +
Sbjct: 316  LDNAEFDAYTKHITTKLSKGVSPTDAFLGALKVYILNCSLKRLRLQKAHVILLDKIAIFI 375

Query: 339  NNSIKDLNEEAVIYVLVYLSKIFLSFEDFKRTDNVAAVLYNCFVTKRKLLFLEHAAMVNY 398
            N ++  ++ E++  +L  L++ F+  +++KR +NV  + +N +V  +    +  AA +  
Sbjct: 376  NTNVVHVSVESIHTILKSLAEYFIDAKEYKRLNNVVNISFNAYVMYKHESLIRLAADLEL 435

Query: 399  RAYLRTSNILEHFKKFERIIGCCQDRNVQKLLFSYVCNVFMIFKENTLQDMWNLTRKSLV 458
              ++        F KFE+ I      ++   LF    NV+++F + +L  +W++     +
Sbjct: 436  FLFMSVKQDWSMFTKFEKFISVASG-DISVSLFEQCFNVYVMFADPSLAGLWDVCLNKSL 494

Query: 459  PCFRRMKLDKFEIFNFSSEPMLCLLYSG---SHFSYQFK-WSHLCQMLTDIVTDV-KQSD 513
             CF+++ L  +  F  SSEPML L+YSG     F+  +  W+ L +ML   +  V K   
Sbjct: 495  KCFKKLGLTSYTDFKASSEPMLVLVYSGFVSDIFTIPYNGWAPLSKMLFMALNGVYKFGY 554

Query: 514  LQIDMKINTLDSFSKYEVLIKSMFCLNSEMNRNSCLKLQKVSNIYLEKWVNK-GNETKXX 572
            + +D KI ++D  +KYE+LIKS + LN EM  +  L+L K++N+Y+ +WV+    + +  
Sbjct: 555  MDVDCKIKSVDVLAKYEMLIKSTYSLNMEMETHGTLQLSKIANMYVSRWVSSLPTDERIS 614

Query: 573  XXXXXXXXXXXXXXXQNKIYKLTAEICTQLRS-VQRYASIPDLISYWLLESYVGLQIGPK 631
                            NK +K   E+C  L+S  + Y S  + I  WLLE+Y  L++   
Sbjct: 615  GLEVRFVKALVQYLRFNKFHKKLIELCQLLKSKGEYYESFKNDIRVWLLEAYTALKM--- 671

Query: 632  VELSIMETVSALKYQPS-SFTEMNVDQLHTTLCILLTQVLWKKDIETFNKLIHDDLTRFR 690
            V+ + ++  S LK   S S      D L+  L   L  + W++D ++FN L+ + L   +
Sbjct: 672  VQATKLQIQSVLKIHSSFSIERATFDSLYEYLYARLLIISWERDNDSFNHLVQE-LRVSQ 730

Query: 691  PNLFDIQNKTKMPVAEYLKILMLNIKITRCASILQLSQNNVYMSLKECKRSLKICRLLIK 750
             N FDI N + +PV+++LK+L+LNI+I + AS+LQ   NN++ SL E K++LK+C+ LIK
Sbjct: 731  TNFFDINNNSNLPVSQFLKLLLLNIRIEKLASLLQFHNNNMFESLLEAKKALKLCQSLIK 790

Query: 751  KEAVLSAKYRFEVISLLDDIFQRIISIYVHTGIFKDCAFFITEYQEVIGSLDNPTALFNM 810
            K+  LS  +R EVISLL D+F ++I IY+  G+ KDC F++ ++  V+G L + T +++ 
Sbjct: 791  KQQKLSQFHRLEVISLLQDLFAQVIGIYIQVGVSKDCEFYVKDFMRVVGELQDWTPIYD- 849

Query: 811  FSCLC---SYYQLIEESENASLSLTKMNAAFDQIDGSANIEALATFLYFNKESEKLNNSM 867
              CLC    YY+L E+++ AS +L+++N  FD +DGS NI+ALA F+Y+N E +KL NS+
Sbjct: 850  --CLCFVYDYYKLTEQNQLASATLSRLNRTFDMLDGSENIDALAKFMYYNDEPDKLRNSL 907

Query: 868  RLFFGDDVFISDIVEYWLLRSCQKTSTETTRKDFEAMVCMNNAKILYNKVQKQMATDTFF 927
             LFF  D+  + +V+ W LR          +   +A+  +N +  LY ++ KQM  D FF
Sbjct: 908  ALFFSGDLEDTFLVDEWNLRLGIVIENTREQPQLKALSDVNKSNELYLRILKQMELDPFF 967

Query: 928  RSMGESVMAIPACYDCDSISVDGRHKSLSLTSVQTLKSVNDSPRPSSLTPRGKSLAYSFD 987
             +M ESV+AIP+C+   S  V+    ++S        S   SPRPSSLTPRGK L   FD
Sbjct: 968  SNMCESVIAIPSCF---SPKVEEIRPAVS-NVWSPAGSPYHSPRPSSLTPRGKCLRQKFD 1023

Query: 988  RSTAINNLQMTDRFIQNADIKALKAHEIRELASLHSLTLSLFFNMSTKTRLESQLGQNFR 1047
            RS AINNLQM  R I++ ++  ++ HE+ + + L+SL+LS   N+S+KT     L + F 
Sbjct: 1024 RSNAINNLQMIKRLIESVNLDEMQNHEVSKTSCLYSLSLSFLSNISSKTDFRHALIKRFT 1083

Query: 1048 LRDHPRSLSLLYEKAFSDMGTEIYDSFIPETIATESVEMSECNMNLATIHSEFGKKWSHL 1107
            + + P+ + + Y+K FS MG E+Y SF+P  + +           +  I + F   W   
Sbjct: 1084 MAELPKYMPMYYDKMFSRMGNEVYGSFMPMEVKSMCTPFFTVQQKVDGIQTNFN-SWDE- 1141

Query: 1108 SFNVVEIDICQLTGDLLITRFDTVXXXXXXXXXXXXXXXSRDLSEEVLGFEAALDELNHI 1167
             F  + +DIC+  GDLL+++  +                SRDLS+E L F   ++ELN I
Sbjct: 1142 PFQAISVDICKYNGDLLLSKVVSTTGKHFHLRLPLNRHESRDLSQETLTFALLMEELNDI 1201

Query: 1168 ISSNNCXXXXXXXXXXXXKEQRKNWWDERYALNNRLQTLLTKIEDSWFCGFKGVFNPRIV 1227
            I  NN             KE R+ WW+ERY+L+ R+  L+ +IEDSW CGF G F+ + +
Sbjct: 1202 IEKNNRTTSIEVTSVIKTKEDRREWWEERYSLDKRMCDLMRRIEDSWICGFCGFFSQKQL 1261

Query: 1228 DQQQFEIFKKGFQSILHTHLPSRKSSRQSDSFLQVDNMLIELFVLLDVINQPTEKAVSMM 1287
            D+  F +FK GFQ +L  +LP+R+       FLQVD+ ++ELF+ +D    P EK V  M
Sbjct: 1262 DKNHFALFKLGFQKVLQQNLPTRRQYGNPSMFLQVDDFILELFLKVDWDALPHEKKVEFM 1321

Query: 1288 EDLIYFVFDILLFHGEQNAYDEIDVNLMHVKFEELLQEYNAESKTKDQTLDHTFLILGNK 1347
            EDLIYF+FDILLFHGE+NAYDEIDV+L+H++ EEL+ +Y+A++    + L HTFL++ ++
Sbjct: 1322 EDLIYFIFDILLFHGEENAYDEIDVHLIHIQLEELIHDYHAKAPEAPR-LGHTFLVISSE 1380

Query: 1348 CHSIPWESLDFLKSISISRVPSIKMLDELLTK-HSELSPCVNVSENLSFVLNPGNDLGRT 1406
            C  +PWESL      S+SRVPSI  L ELLTK   E+SP +N+   LS VLNP  DL RT
Sbjct: 1381 CSLVPWESLSIFSDASVSRVPSINFLHELLTKFRGEISPKINLDSRLSIVLNPHGDLTRT 1440

Query: 1407 ETVFSSEFIAMASRTNSKAFI-GKPPTVDEFFHSVADSNLFVYVGHSGGEQYVKLKDLRK 1465
            E  F   F  +     S   + G  P  DEF   + +S+ F+Y+GH GGEQY + K L+ 
Sbjct: 1441 ELRFKEHFTRLCCDLGSTRIVTGSKPEEDEFVRMITNSSTFIYIGHGGGEQYFRSKTLKL 1500

Query: 1466 CNHLAPSLLLGCSSAHLKYCGTFESSGTIYSYLLGGSPMVVGNLWDVTDKDTDKLSVSVF 1525
             ++ APS LLGCSSA++   G  E S  +YSYLLGGSPMV+GNLWDVTDKD D  + ++ 
Sbjct: 1501 QDNAAPSFLLGCSSAYMIQYGKLEPSSVLYSYLLGGSPMVIGNLWDVTDKDIDAFTEAMS 1560

Query: 1526 EKTGFFNSKPISRTDESDATIKQFLNVSEAISQSRDECNMK 1566
             K G F S+             +FLNVSEA+S SRD C+++
Sbjct: 1561 HKLGIFPSQR-----------DRFLNVSEAVSSSRDVCHLR 1590

>Scas_716.27
          Length = 1620

 Score =  892 bits (2304), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 536/1578 (33%), Positives = 878/1578 (55%), Gaps = 96/1578 (6%)

Query: 52   WKKLYDFVDNKSKDFENYIQVNDSFIQLYRQLIWRHQLKKLQELPKKHMNWIIFLMERNK 111
            +K++ +F+  +S       +++  F  LYR+L  RH L+ L+ L K+H+  ++ L+  N 
Sbjct: 58   YKQISEFIKAQSLQKPQIERIHAVFTTLYRELNRRHLLRHLRALVKEHLIVVVKLINNNF 117

Query: 112  LTQASNQILMLYNETNLIKAKGIDDVLLSDFSAGNENYLATLKVITMQLILKTGTTERHA 171
               + + IL LYN TNL KA  + DV+L+DFS  NE YL+TLK+++ Q+ILK    + + 
Sbjct: 118  YDYSQSGILCLYNTTNLFKAHDLKDVILADFSESNEFYLSTLKILSFQVILKKKNLKMYE 177

Query: 172  ESLLECFAHDTRYLLKDPNVKVHALVKLILNFFTLLTGFKPLFGLKFVQYVNQFKLEFGN 231
            +++++ F+HD RY+LKDPN+K+H +VKL+LNFF++L  FK LFGLKF+QY+ QF L F  
Sbjct: 178  DTIIQAFSHDERYILKDPNIKIHTVVKLLLNFFSILPTFKTLFGLKFLQYIKQFNLSFQT 237

Query: 232  YIKNMDSSTFQRQITKLLRKDISVNCHIYLPKYYDEYTKHMENDQVNLTEFLRTDVIGKD 291
            YIKNMDS TF++Q+ +   K+I      YL  YY  Y+K       +LT+ + TD +G+D
Sbjct: 238  YIKNMDSITFEKQLVRYGSKNIQ-QLKPYLNSYYINYSKF----NSHLTKLMLTDFVGRD 292

Query: 292  VCTEIR-----------------------------------------NQLRLQSFSAGKI 310
            + +  +                                         +Q+ L +  A   
Sbjct: 293  LQSHKKTFALLKDHKEISSTSTECYCCLSHSQMDNFVISCHALMSNNDQIHLHTIDAVTF 352

Query: 311  D-ALLRPFLYQAALNKSSSRLCDSLIISVNNSIKDLNEEAV--IYVLVYLSKIFLSFEDF 367
              +++R   +    NK    L DS +I +N+ +K L +  +  + ++  L+++ + ++++
Sbjct: 353  GWSIIRSENFPR--NKKMLALLDSTLIFLNSQMKHLEKMQISLVKLIKMLAEVCMDYQEY 410

Query: 368  KRTDNVAAVLYNCFVTKRKLLFLEHAAMVNYRAYL---RTSNILEHFKKFERIIGCCQDR 424
            KR  NV  V +NCFV  R   FL+  A +  + YL     S   +  +KFE+ IG   ++
Sbjct: 411  KRMTNVINVSFNCFVFFRNFDFLKLTAELESKHYLVCHDKSQWKKLIQKFEKFIGSAPEQ 470

Query: 425  NVQKLLFSYVCNVFMIFKENTLQDMWNLTRKSLVPCFRRMKLDKFEIFNFSSEPMLCLLY 484
              +  LFSYV N F++F +++L  +   T    + CF R+KL  F  F+  SEPML +LY
Sbjct: 471  YQKIELFSYVFNTFLLFNDDSLSFVVEFTETIFLRCFSRLKLTYFIDFHDVSEPMLSILY 530

Query: 485  SGSHFS--YQFKWSHLCQMLTDIVTD-VKQSDLQIDMKINTLDSFSKYEVLIKSMFCLNS 541
              S  +      W++L +ML   V+   + + + I+          KY+ LIKS++ LN 
Sbjct: 531  GNSSITNIPHGDWNNLTEMLFFCVSGRFEINAININQVTTKWYYLYKYKDLIKSIYVLNL 590

Query: 542  EMNRNSCLKLQKVSNIYLEKWVNKGN--ETKXXXXXXXXXXXXXXXXXQNKIYKLTAEIC 599
            +M ++S   L ++++ Y+ KWV K +                       N   K    + 
Sbjct: 591  DMKKHSSSNLSQLTSSYISKWVQKTSLLNEGISSIEVTFITMLFQYLGFNNFNKCILTLS 650

Query: 600  TQLRS-VQRYASIPDLISYWLLESYVGLQIGPKV--ELSIMETVSALKYQPSSFTEMNVD 656
              LR  +  +A +   IS W ++S + LQ+  ++  E  ++ T++       ++T   ++
Sbjct: 651  AALRDHINYFAPLKLEISRWNIQSSINLQLMEQINDEAKLLSTIAP------TYTICKLE 704

Query: 657  QLHTTLCILLTQVLWKKDIETFNKLIHDDLTRFRPNLFDIQNKTKMPVAEYLKILMLNIK 716
            +L T L   L    W  D E F +L  ++L   R  +FD+ N++KMP ++Y+K+L+   K
Sbjct: 705  KLLTFLEAKLDVFTWTNDYEGFQELFMEELPSVRLEVFDLNNQSKMPASQYIKVLLFMTK 764

Query: 717  ITRCASILQLSQNNVYMSLKECKRSLKICRLLIKKEAVLSAKYRFEVISLLDDIFQRIIS 776
            +   +S L L+++++  S+ E KR+LK+   LIKK+  LS   R  +I+L+ + F ++I 
Sbjct: 765  LFNHSSRLHLARDDITASVIESKRALKLATSLIKKQNKLSQSSRIRLINLVLNSFTQLIE 824

Query: 777  IYVHTGIFKDCAFFITEYQEVIGSLDNPTALFNMFSCLCSYYQLIEESENASLSLTKMNA 836
            IY+  G+ K+  ++  +  +VI  L  P+ ++     L +YY+L++      ++L K N 
Sbjct: 825  IYIRLGLAKEADYYADQLSKVICDLGEPSVVYRGLHFLHNYYKLVKHEALEIITLQKANK 884

Query: 837  AFDQIDGSANIEALATFLYFNKESEKLNNSMRLFFGDDVFISDIVEYWLLRSCQKTSTET 896
             FD +DG ++IE++  FL+ N E +K++ S+ LFF DD   S +  YW L+  +      
Sbjct: 885  TFDYLDGESDIESVLMFLFDNSEFKKISESLNLFFQDDFNNSFLPLYWQLKMGRPIDDSL 944

Query: 897  TRKDFEAMVCMNNAKILYNKVQKQMATDTFFRSMGESVMAIPACYDCDSISVDGRHKSLS 956
                 ++   +   +  Y  V  Q+ +D FF+++ ES++A+PA  +  +   DG   ++ 
Sbjct: 945  CLTTLKSTNSIKKLERDYKHVLGQLESDPFFKNLFESILAVPAVTNIHNTQSDG---TMC 1001

Query: 957  LTSVQTLK----SVNDSPRPSSLTPRGKSLAYSFDRSTAINNLQMTDRFIQNADIKALKA 1012
            L    T K     VNDSPRPS++TP+ K+L   FD++ A++NL      I++ +++ L  
Sbjct: 1002 LMETPTKKKLAFKVNDSPRPSNMTPKSKNLKQKFDKAVALSNLNRIKCCIEDLNLELLNH 1061

Query: 1013 HEIRELASLHSLTLSLFFNMSTKTRLESQLGQNFRLRDHPRSLSLLYEKAFSDMGTEIYD 1072
             ++  ++SL SLT+++  N+S     ++ L Q F L D P+ + + Y+K  S +  ++Y 
Sbjct: 1062 GDLLNISSLFSLTVTMLSNISKNALEDATLFQRFNLIDLPKRVPMYYDKLLSSIDDDLYT 1121

Query: 1073 --SFIPETIATESVEMSECNMNLATIHSEFGKKWSHLSFNVVEIDICQLTGDLLITRFDT 1130
                +P +   E     +  ++L         ++  LSF+V+ IDIC +TG+LL+++   
Sbjct: 1122 DIKLLPFSSNHEQTRKKQALLSLNE-----STEFCGLSFDVITIDICSITGNLLLSKLSA 1176

Query: 1131 VXXXXXXXXXXXXXXXSRDLSEEVLGFEAALDELNHIISSNNCXXXXXXXXXXXXKEQRK 1190
                             RDL    L F  A+ EL +II  +N             KE RK
Sbjct: 1177 TNGHKSHLSIPLNRANLRDLDAYSLTFVEAVKELAYIIDESNSTTSVEVTSSIKTKEDRK 1236

Query: 1191 NWWDERYALNNRLQTLLTKIEDSWFCGFKGVFNPRIVDQQQFEIFKKGFQSILHTHLPSR 1250
             WW  RY L+NRL +LL  IE SWF G KG+F+  +VD   FE FKK F  ILH++LPSR
Sbjct: 1237 TWWKSRYELDNRLSSLLHNIETSWFAGLKGLFDQSVVDPSLFEEFKKKFYGILHSNLPSR 1296

Query: 1251 KSSRQSDSFLQVDNMLIELFVLLDVINQPTEKAVSMMEDLIYFVFDILLFHGEQNAYDEI 1310
            K   +  +FLQ+++ +IELF+ LD      ++ +SM+ED+IYF  DILLF GE+NAYDEI
Sbjct: 1297 KQMGKPMTFLQINDWIIELFLKLD---PQDDEFISMIEDMIYFTLDILLFQGEENAYDEI 1353

Query: 1311 DVNLMHVKFEELLQEYNAESKTKDQTLDHTFLILGNKCHSIPWESLDFLKSISISRVPSI 1370
            D++++H++ EE ++ Y+++  +    +DHTFL++G+ CH+ PWESL F+  +S+SR+PSI
Sbjct: 1354 DLSMVHIQLEEQIKRYHSKVISNSHKVDHTFLVIGSACHTFPWESLSFMNDLSLSRIPSI 1413

Query: 1371 KMLDELLTKHSE-LSPCVNVSENLSFVLNPGNDLGRTETVFSSEF-IAMASRTNSKAFIG 1428
            K L+  +T+H E L   V ++E +S +LNP  DL RTE  F   F   +A R +S   + 
Sbjct: 1414 KWLESAITRHYEQLIKGVPLTEKISMILNPHGDLERTELRFRETFETIVAKRPSSSLIVN 1473

Query: 1429 KPPTVDEFFHSVADSNLFVYVGHSGGEQYVKLKDLRKCNHLAPSLLLGCSSAHLKYCGTF 1488
            + P  ++  H +++ NLF+YVGH GGEQYV+ +++++C+++ PS LLGCSSA LKY G  
Sbjct: 1474 EKPDEEKMLHMMSNCNLFIYVGHGGGEQYVRTREIKRCDNVGPSFLLGCSSASLKYYGGL 1533

Query: 1489 ESSGTIYSYLLGGSPMVVGNLWDVTDKDTDKLSVSVFEKTGFFNSKPISRTDESDATIKQ 1548
            E +GT+ SYLL GSP+V+GNLWDVTDKD DK S SVFEK G      +   DE    I  
Sbjct: 1534 EPTGTVNSYLLAGSPLVLGNLWDVTDKDIDKFSQSVFEKIGL-----VMGEDE----IIH 1584

Query: 1549 FLNVSEAISQSRDECNMK 1566
              ++S A+++SR  C++K
Sbjct: 1585 KRSISRAVNESRQLCHLK 1602

>Kwal_55.20535
          Length = 1636

 Score =  827 bits (2136), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 544/1583 (34%), Positives = 836/1583 (52%), Gaps = 98/1583 (6%)

Query: 47   NSLIDWKKLYDFVDNKSKDFENYIQVNDSFIQLYRQLIWRHQLKKLQELPKKHMNWIIFL 106
            NS I  K++ DF+       E+  +V+  F +LYR  +W+HQ   ++EL K++M  II +
Sbjct: 64   NSDIIRKRVRDFLQRPC--IEDVQEVSLGFKRLYRTYLWKHQFNLVKELVKQNMLAIIKI 121

Query: 107  MERNKLTQASNQILMLYNETNLIKAKGIDDVLLSDFSAGNENYLATLKVITMQLILKTGT 166
            +E      A  ++L +YNETN  KA+ ++  LL+D +  N+ YL+ LK++ +Q+I+K   
Sbjct: 122  VELQSYDAAVQEVLNIYNETNHHKAESLEQFLLADLTTSNDYYLSALKLLALQIIIKGKR 181

Query: 167  TERHAESLLECFAHDTRYLLKDPNVKVHALVKLILNFFTLLTGFKPLFGLKFVQYVNQFK 226
             + + E++L+ FA+D+RY+L+   +K+  L K++LNFF+LL  FK LF LKF+QYV QF 
Sbjct: 182  QDFYGETILKLFANDSRYILRTEKIKIQPLTKILLNFFSLLPDFKALFSLKFMQYVKQFD 241

Query: 227  LEFGNYIKNMDSSTFQRQITKLLRKDISVNCHIYLPKYYDEYTKH-------MENDQVNL 279
            L F +YIKNMD   FQ  I    ++      + +L  +Y  Y+++       M +D VN 
Sbjct: 242  LNFESYIKNMDMPKFQEMILIWAQRS-PTKTNGFLGLFYSSYSQYFQSVDKIMLHDLVNP 300

Query: 280  TEFLRTDVIGKD--------------------------VCTEIRNQLRLQSFSAGKIDAL 313
            +   R  VI K                           +   I +QL  + F + K+  L
Sbjct: 301  SSRDRIKVISKGFNSLSSHEWSQGIETFTNLSIIERNSLLEFIESQLEEKKFDSQKVAIL 360

Query: 314  LRPFLYQAALNKSSS------RLCDSLIISVNNSIKDLNEEAVIYVLVYLSKIFLSFEDF 367
            LR FL Q A N+ S       R+ D + + +N+++  L+   V  +L  +  + +   + 
Sbjct: 361  LRWFL-QLANNELSPATRQLWRIVDRITVFINSNLHSLSIHIVKELLDIIYDLCIVNLEP 419

Query: 368  KRTDNVAAVLYNCFVTKRKLLFLEHAAMVNY-RAYLRTSNILEHFKKFERIIGCCQDRNV 426
            KR  NVA V +N F+  +  +F+  AA  +  R  +     L+   + E+ +    + + 
Sbjct: 420  KRLLNVANVAFNSFIVFKNDIFVLQAAKFDLARQTIFKQGGLD-LTRLEKFLSSASNGHR 478

Query: 427  QKLLFSYVCNVFMIFKENTLQDMWNLTRKSLVPCFRRMKLDKFEIFNFSSEPMLCLLYSG 486
             KL F+ V NVF  F+  +L  +  +T +    C R + +      + +SE M+CLL + 
Sbjct: 479  IKL-FTDVFNVFTCFEYESLGSLTEVTSR-FAKCLRSVNIRASTELSGASELMICLLSTL 536

Query: 487  SHFSYQFK--WSHLCQMLTDIVTDVKQSDLQIDMKINTLDSFSKYEVLIKSMFCLNSEMN 544
                      WS L +ML   +T+  + + + +   +TLD    YEVLIK+++ L  E+ 
Sbjct: 537  RPLEPDSISCWSPLTRMLYHSLTNYAKDNNKTEKCRDTLDPLKHYEVLIKTIYSLGLEIK 596

Query: 545  RNSCLKLQKVSNIYLEKWVNKGN--ETKXXXXXXXXXXXXXXXXXQNKIYKLTAEICTQL 602
            ++S   L KVS+ + E WV + N  E+                   NK +K   ++   L
Sbjct: 597  KSSSHCLAKVSDNFTENWVKRLNFRESTMISLEYSAIRTLFGYLRFNKFHKKVIDLALAL 656

Query: 603  RSVQR--YASIPDLISYWLLESYVGLQIGPKVELSIMETVSALK--YQPSSFTEMNVDQL 658
            ++     Y    +     L+  YVGLQ+  +    I+E  S L    Q      +  DQ+
Sbjct: 657  KNSPHPYYEYCAENAQEQLIRGYVGLQMKTR----ILEGCSELMRLAQNPRLENLKRDQI 712

Query: 659  HTTLCILLTQVLWKKDIETFNKLIHDDLTRFRPNLFDIQNKTKMPVAEYLKILMLNIKIT 718
                   L    WK+D +TFNK+  + L    P + D+ N  K+P   YLK L+L+I I 
Sbjct: 713  FMYAETQLEICFWKRDFDTFNKIFVEGLPITNPEVMDVTNTLKLPTKLYLKCLVLSINIV 772

Query: 719  RCASILQLSQNNVYMSLKECKRSLKICRLLIKKEAVLSAKYRFEVISLLDDIFQRIISIY 778
              AS LQ+   N+  +L E KRS+K+C+ L+KK   L  + +++V++ L   F  II+IY
Sbjct: 773  GIASNLQIHAGNLIEALVEAKRSIKLCQTLLKKVTQLDQEIKWKVLTSLGTAFANIINIY 832

Query: 779  VHTGIFKDCAFFITEYQEVIGSLDNPTALFNMFSCLCSYYQLIEESENASLSLTKMNAAF 838
               G+ +DC F++TEY  V  S+ +P  +         YY+L ++   A   L K N  F
Sbjct: 833  TQLGVSRDCDFYVTEYLRVSCSMKDPVVIHECLQKCVGYYRLTDQLSLADALLRKANGIF 892

Query: 839  DQIDGSANIEALATFLYFNKESEKLNNSMRLFFGDDVFISDIVEYWLLRSCQKTSTETTR 898
            +Q+DGS N + LA FL  N E EKL NS+RLFF D    S +V+ W L      +     
Sbjct: 893  NQLDGSENFDDLALFLLNNGEHEKLANSLRLFFKDYFSESLLVDIWSLALGGTLNRYHED 952

Query: 899  KDFEAMVCMNNAKILYNKVQKQMATDTFFRSMGESVMAIPAC---------YDCDSISVD 949
                 +  +N  K LY K+ KQM TD FF S+ ESV  IP+C         +   S+   
Sbjct: 953  ATLRRLSGINEGKQLYEKISKQMDTDAFFGSVKESVTTIPSCVLPALEVRKHPATSVCEF 1012

Query: 950  G---RHKSLSLTSVQTLKSVNDSPRPSSLTPRGKSLAYSFDRSTAINNLQMTDRFIQNAD 1006
            G   ++K +  T++       +SPRPSSLTPRGKSL   FDR+ A+N+L+   R + +  
Sbjct: 1013 GTPTKNKGIPFTNL-------NSPRPSSLTPRGKSLKQKFDRAKALNDLETVKRLVGSLS 1065

Query: 1007 IKALKAHEIRELASLHSLTLSLFFNMSTKTRLESQLGQNFRLRDHPRSLSLLYEKAFSDM 1066
               +K +EI E + L+SL LSL  +++T     S + Q   L + P+   L ++K  S  
Sbjct: 1066 TDGMKNYEIVEASDLYSLVLSLLSSITTSRLSSSAIEQMLTLAELPKMRPLHFDKILSSQ 1125

Query: 1067 GTEIYDSFIPETIATESVEMSECNMNLATIHSEFGKKWSHLSFNVVEIDICQLTGDLLIT 1126
            G EIY SFIP  +  + + +     ++    ++         FNVV ID+C +TGDL++T
Sbjct: 1126 GNEIYGSFIPLQVDCKRISIDNQLQDIVRNQTDMSFNSDPHLFNVVCIDVCGITGDLILT 1185

Query: 1127 RFDTVXXXXXXXXXXXXXXXSRDLSEEVLGFEAALDELNHIISSNNCXXXXXXXXXXXXK 1186
            R D+                SRD+ E  L F  A++EL  II  +N             K
Sbjct: 1186 RTDSGRNKVMCLRLPLSRGSSRDVDEVALSFHDAMEELKSIIKESNITTSSDVTAAINTK 1245

Query: 1187 EQRKNWWDERYALNNRLQTLLTKIEDSWFCGFKGVFNPRIVDQQQFEIFKKGFQSILHTH 1246
            + RK WW  RY L+ RL+ L+ KIE+SWF GFK  F    ++Q+  + F+   + IL   
Sbjct: 1246 DDRKQWWQRRYDLDARLRNLILKIENSWFSGFKTFFKQETIEQRHLDRFRVKLEEILQES 1305

Query: 1247 LPSRKSSRQSDSFLQVDNMLIELFVLLDVINQPTEKA-VSMMEDLIYFVFDILLFHGEQN 1305
            LP+RK      +F ++D+++++LF+ LD    P++   + MMEDLI+FVFD+LLFHGE+N
Sbjct: 1306 LPTRKQFGNPANFFRIDDVVLDLFLKLD----PSDSDFMEMMEDLIFFVFDLLLFHGEEN 1361

Query: 1306 AYDEIDVNLMHVKFEELLQEYNAESKTKDQTLDHTFLILGNKCHSIPWESLDFLKSISIS 1365
            AYDEIDVN++H++ EE ++E+        + L HTFL++ +  H +PWESL+FL   SIS
Sbjct: 1362 AYDEIDVNMIHIQIEEFIKEFRTTVPPPPK-LAHTFLVVCSAGHLMPWESLEFLAKNSIS 1420

Query: 1366 RVPSIKMLDELLTKHSEL-SPCVNVSENLSFVLNPGNDLGRTETVFSSEFIAMASRT-NS 1423
            R+PS ++L +L+ K   L SP V + +N+S +LNP  DL RT+  F   F    S    S
Sbjct: 1421 RIPSTQILFDLIEKEQHLISPLVELEQNISVILNPDGDLVRTQADFICPFEEWCSHAPGS 1480

Query: 1424 KAFIGKPPTVDEFFHSVADSNLFVYVGHSGGEQYVKLKDLRKCNHLAPSLLLGCSSAHLK 1483
            +  +G+ P    F   +  +  F+YVGH GGEQ+V+LK +++ N +APS LLGCSSA+++
Sbjct: 1481 RLIVGEKPDEKTFLEMLTKAKTFIYVGHGGGEQFVRLKKIKQQNCIAPSFLLGCSSAYMQ 1540

Query: 1484 YCGTFESSGTIYSYLLGGSPMVVGNLWDVTDKDTDKLSVSVFEKTGFFNSKPISRTDESD 1543
              G  E SG  YSYLLGGS MVVGNLWDVTDKD DK S ++FEK G      + R +E  
Sbjct: 1541 NFGKLEPSGIAYSYLLGGSSMVVGNLWDVTDKDIDKFSRTMFEKLG------LVREEEET 1594

Query: 1544 ATIKQFLNVSEAISQSRDECNMK 1566
             T      VS+A++ +R  C +K
Sbjct: 1595 YT------VSDAVASARYSCQLK 1611

>YGR098C (ESP1) [2058] chr7 complement(682568..687460) Separin protein
            required for Mcd1p and Rec8p cleavage and sister
            chromatid separation during mitosis and meiosis, also
            cleaves Slk19p and Mcd1p, also involved in regulation of
            spindle pole body duplication [4893 bp, 1630 aa]
          Length = 1630

 Score =  798 bits (2060), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 538/1605 (33%), Positives = 853/1605 (53%), Gaps = 110/1605 (6%)

Query: 31   ATSNSSKITTAQENNTNSLIDWKKLYDFVDNKSKDFENYIQVNDSFIQLYRQLIWRHQLK 90
            A+SNS  I  A  NN   + D+ K+    +N     E+   V+ S   +Y  L   H   
Sbjct: 49   ASSNSIGIL-AMHNNI--IRDFTKIAS--NNIDLAIEDITTVDHSLNSIYSLLKSHHMWG 103

Query: 91   KLQELPKKHMNWIIFLMERNKLTQASNQILMLYNETNLIKAKGIDDVLLSDFSAGNENYL 150
             +    K+H+  I+ L+  N L  AS++I+ L+NETNL +A  + ++LL+DFS  N+ YL
Sbjct: 104  HINSTVKQHLMIIVKLINNNALGLASSEIIFLFNETNLFQAHSLKNILLADFSTWNDYYL 163

Query: 151  ATLKVITMQLILKTGTTERHAESLLECFAHDTRYLLKDPNVKVHALVKLILNFFTLLTGF 210
            + LK++ +Q+ILK    + +   +LE F+HD RYLLKDPN+K HAL K++L+FF++ T  
Sbjct: 164  SNLKILALQIILKRKLVDEYLPHILELFSHDKRYLLKDPNLKAHALTKIVLSFFSVTTSC 223

Query: 211  KPLFGLKFVQYVNQFKLEFGNYIKNMDSSTFQRQITKLLRKDISVNCHIYLPKYYDEYTK 270
            K LFGLKF+QY+ QFKL F  +I N+    F + +      ++  N  IYL  +Y  Y+ 
Sbjct: 224  KVLFGLKFLQYIKQFKLPFKKFISNITVECFSKNLLHKNYLEMGPN-KIYLNSFYLSYSM 282

Query: 271  HMEN-DQVNLTEFLRTDVIGK------------DVCTEIRNQLRLQSFSAGKIDALLRP- 316
              +  D++ L + L  +   +            + C    N+L     S   ++ +L   
Sbjct: 283  LYDGLDKIMLLDILSYEETTEVQRAIKSKKEFNEYCNMSENRLLWSCISVDDLNVILENA 342

Query: 317  --FLYQAALNKSSSRLC-----------------------DSLIISVNNSIKDLNEEAVI 351
              FL     + S++  C                       D  +I +N++IK +N+E+  
Sbjct: 343  TNFLQNKGKHISATLKCLVCLWSTIRLEGLPKNKDILRQFDCTVIYINSNIKSINDESAA 402

Query: 352  YVLV----YLSKIFLSFEDFKRTDNVAAVLYNCFVTKRKLLFLEHAAMVNYRAYLRTSNI 407
             +L      LS+I + +++ KR  N+ +VL+N  V     LF  H+ ++   A L  SN+
Sbjct: 403  ALLSELLGVLSEICIDYKEPKRLSNIISVLFNASV-----LFKSHSFLLK-TANLEISNV 456

Query: 408  L---------EHFKKFERIIGCCQDRNVQKLLFSYVCNVFMIFKENTLQDMWNLTRKSLV 458
            L             KFE+ I   Q    +  +FS + NV+ + + +TL  +++  + + +
Sbjct: 457  LISNDSKTSHRTILKFEKFISSAQSAQKKIEIFSCLFNVYCMLRNDTLSFVFDFCQNAFI 516

Query: 459  PCFRRMKLDKFEIFNFSSEPMLCLLYSGSHFS--YQFKWSHLCQMLTDIVTDVKQSD-LQ 515
             CF R+K+ KF  F+ SSE ML +LY  S         WS L +M+   +  +   D L+
Sbjct: 517  HCFTRLKITKFIEFSNSSEIMLSVLYGNSSIENIPSENWSQLSRMIFCSLRGIFDLDPLE 576

Query: 516  IDMKINTLDSFSKYEVLIKSMFCLNSEMNRNSCLKLQKVSNIYLEKWVNKGNET--KXXX 573
            ++   + L   +KYE+LI+ ++ LN +M+++    L K++ +Y+ KW+ K +E   +   
Sbjct: 577  LNNTFDKLHLLNKYELLIRIVYLLNLDMSKHLTTNLSKITKLYINKWLQKSDEKAERISS 636

Query: 574  XXXXXXXXXXXXXXQNKIYKLTAEICTQLRSVQRY-ASIPDLISYWLLESYVGLQIGPKV 632
                           N   KL+ E+   ++S ++Y +SI      +LLE+Y+ L +   +
Sbjct: 637  FEMDFVKMLLCYLNFNNFDKLSIELSLCIKSKEKYYSSIVPYADNYLLEAYLSLYM---I 693

Query: 633  ELSIMETVSALKYQPSSFTEMNVDQLHTTLCILLTQVLWKKDIETFNKLIHDDLTRFRPN 692
            + ++M      K    S  ++    LH +   L+   LW  D+  F       L   +P 
Sbjct: 694  DDALMMKNQLQKTMNLSTAKIEQALLHAS--SLINVHLWDSDLTAFQIYFGKTLPAMKPE 751

Query: 693  LFDIQNKTKMPVAEYLKILMLNIKITRCASILQLSQNNVYMSLKECKRSLKICRLLIKKE 752
            LFDI N   +P++ Y+K+++LNIKI   ++ L +   NV  ++ +C+++  +   L+KK+
Sbjct: 752  LFDINNDHNLPMSLYIKVILLNIKIFNESAKLNIKAGNVISAVIDCRKAQNLALSLLKKK 811

Query: 753  AVLSAKYRFEVISLLDDIFQRIISIYVHTGIFKDCAFFITEYQEVIGSLDNPTALFNMFS 812
              LS   R  ++  L   F ++I I++  G  +DC F+  E   +I  L+ P  ++    
Sbjct: 812  NKLSQGSRLALLKSLSFSFFQLIKIHIRIGSARDCEFYSKELSRIISDLEEPIIVYRCLH 871

Query: 813  CLCSYYQLIEESENASLSLTKMNAAFDQIDGSANIEALATFLYFNKESEKLNNSMRLFFG 872
             L  YY + E++   +++L K N AFD +D  A+I +L  FLY NKE  KL  S+ L+FG
Sbjct: 872  FLHRYYMITEQTCLQNITLGKANKAFDYLDAEADITSLTMFLYDNKEFVKLEQSLVLYFG 931

Query: 873  DDVFISDIVEYWLLRSCQKTSTETTRKDFEAMVCMNNAKILYNKVQKQMATDTFFRSMGE 932
            D +  + +   W L   +         ++     +N    ++ KV  Q+  D FF+ M E
Sbjct: 932  DQLEKTFLPNLWKLHLGKDIDDSICLSEYMPKNVINRVHNMWQKVMSQLEEDPFFKGMFE 991

Query: 933  SVMAIPACYDCDSISVDGRHKSLSLTSVQTLKSVNDSPRPSSLTPRGKSLAYSFDRSTAI 992
            S + IP+       ++              LK + DSPR SS+TPRGK++   FDR  AI
Sbjct: 992  STLGIPSSLPVIPSTMPNNILKTPSKHSTGLK-LCDSPRSSSMTPRGKNIRQKFDRIAAI 1050

Query: 993  NNLQMTDRFIQNADIKALKAHEIRELASLHSLTLSLFFNMSTKTRLESQLGQNFRLRDHP 1052
            + L+     +++  +  L  HE+ +++SL SLTL++  N+++    ES L  NF L D P
Sbjct: 1051 SKLKQMKELLESLKLDTLDNHELSKISSLSSLTLTILSNITSIHNAESSLITNFSLTDLP 1110

Query: 1053 RSLSLLYEKAFSDMGTEIYDSF------IPETIA--TESVEMSECNMNLATIHSEFGKKW 1104
            R + LL++K  +++  + Y  F       P  I+  TES+ +S    +L           
Sbjct: 1111 RHMPLLFDKVLNNIDNKNYREFRVSSLIAPNNISTITESIRVSAAQKDLME--------- 1161

Query: 1105 SHLSFNVVEIDICQLTGDLLITRFDTVXXXXXXXXXXXXXXXSRDLSEEVLGFEAALDEL 1164
            S+L+ NV+ ID C +TG+LL+++ +                 SRDL E  L F  A  +L
Sbjct: 1162 SNLNINVITIDFCPITGNLLLSKLEPRRKRRTHLRLPLIRSNSRDLDEVHLSFPEATKKL 1221

Query: 1165 NHIISSNNCXXXXXXXXXXXXKEQRKNWWDERYALNNRLQTLLTKIEDSWFCGFKGVFNP 1224
              II+ +N             +E+RK+WW  RY L+ R+Q LL  IE+SWF G +G F+P
Sbjct: 1222 LSIINESNQTTSVEVTNKIKTREERKSWWTTRYDLDKRMQQLLNNIENSWFNGVQGFFSP 1281

Query: 1225 RIVDQQQFEIFKKGFQSILHTHLPSRKSSRQSDSFLQVDNMLIELFVLLDVINQPTE-KA 1283
             +VD   FE FK  F  ILH +LPSRK       F++V++ +IELF+ L+    P E   
Sbjct: 1282 EVVDNSLFEKFKDKFYEILHQNLPSRKLYGNPAMFIKVEDWVIELFLKLN----PQEIDF 1337

Query: 1284 VSMMEDLIYFVFDILLFHGEQNAYDEIDVNLMHVKFEELLQEYNAESKTKDQTLDHTFLI 1343
            +S MEDLIYFV DILLFHGE+NAYDEID +++HV+ EE +++Y A   T   ++ HTFL+
Sbjct: 1338 LSKMEDLIYFVLDILLFHGEENAYDEIDFSMLHVQLEEQIKKYRATMTT--NSIFHTFLV 1395

Query: 1344 LGNKCHSIPWESLDFLKSISISRVPSIKMLDELLTK-HSELSPCVNVSENLSFVLNPGND 1402
            + + CH  PWE L FLK +SI+RVPS   L++LL++ H +L   V + +N+S +LNP  D
Sbjct: 1396 VSSSCHLFPWECLSFLKDLSITRVPSYVCLNKLLSRFHYQLPLQVTIEDNISMILNPNGD 1455

Query: 1403 LGRTETVFSSEFIAMA-SRTNSKAFIGKPPTVDEFFHSVADSNLFVYVGHSGGEQYVKLK 1461
            L RTE+ F   F  +  ++ +S+  + + P  +     + +SNLFVY+GH GGEQYV+ K
Sbjct: 1456 LSRTESKFKGMFQKIIDAKPSSQLVMNEKPEEETLLKMLQNSNLFVYIGHGGGEQYVRSK 1515

Query: 1462 DLRKCNHLAPSLLLGCSSAHLKYCGTFESSGTIYSYLLGGSPMVVGNLWDVTDKDTDKLS 1521
            +++KC  +APS LLGCSSA +KY G  E +GTIY+YLLGG PMV+GNLWDVTDKD DK S
Sbjct: 1516 EIKKCTKIAPSFLLGCSSAAMKYYGKLEPTGTIYTYLLGGCPMVLGNLWDVTDKDIDKFS 1575

Query: 1522 VSVFEKTGFFNSKPISRTDESDATIKQFLNVSEAISQSRDECNMK 1566
              +FEK GF       R +  D      L+VS A+S+SR  C+++
Sbjct: 1576 EELFEKMGF-------RCNTDDLN-GNSLSVSYAVSKSRGVCHLR 1612

>CAGL0G03223g complement(300119..304933) similar to sp|Q03018
            Saccharomyces cerevisiae YGR098c ESP1 required for sister
            chromatid separation, hypothetical start
          Length = 1604

 Score =  363 bits (932), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 267/925 (28%), Positives = 444/925 (48%), Gaps = 50/925 (5%)

Query: 658  LHTTLCILLTQVLWKKDIETF---NKLIHDDLTRFRPNLFDIQNKTKMPVAEYLKILMLN 714
            ++  L + L    W+   E F   N+ +  D+   + ++ D     K  + +Y + L+ N
Sbjct: 697  IYNHLIMSLLYASWEDSPELFTSSNERVPKDI---KEHILDFSTNDKSNLNKYFQKLIFN 753

Query: 715  IKITRCASILQLSQNNVY-MSLKECKRSLKICRLLIKKEAVLSAKYRFEVISLLDDIFQR 773
            IK     + L L+Q   Y  +++  K+ LKI + ++K    L    R  V++ L   +  
Sbjct: 754  IKFANYYASL-LNQKKCYSYAVEVSKKGLKIGKSVLKIIEKLDLNDRLTVLNQLVSSYSN 812

Query: 774  IISIYVHTGIFKDCAFFITEYQEVIGSLDNPTALFNMFSCLCSYYQLIEESENASLSLTK 833
            +I IY   G+ K   ++  E  +++   D P  LF++   L  +Y    + ++A      
Sbjct: 813  LIKIYTAVGLAKGAQYYCKEVTKLLPVFDQPIFLFSVHVLLFEFYLENGDYDSALTHKKN 872

Query: 834  MNAAFDQIDGSANIEALATFLYFNKESEKLNNSMRLFFGDDVFISDIVEYWLLR---SCQ 890
             N  FD ++   +I    +FLY N+E +K+  S+RL+FG D+  +D    W L+    C 
Sbjct: 873  ANYVFDNLNAEHDIINTTSFLYINEEYDKIQESLRLYFGYDLNDTDFFLSWKLKLGNICD 932

Query: 891  KTSTETTRKDFEAMVCMNNAKILYNKVQKQMATDTFFRSMGESVMAIPACYDCDSISVDG 950
            +  T+ +  +F   +   N +++      ++  D F +S+ E+++A   C    S+S   
Sbjct: 933  ECPTQYSNMNFFNKIVHINQRLVL-----EIDADPFLKSLNETILANLNCVSPGSLSNIL 987

Query: 951  RHKSLSLTSVQTLKSVNDSPRPSSLTPRGKSLAYSFDRS-TAINNL--QMTDRFIQNADI 1007
                +S  S     ++    RP+S       +    D   T  N +  ++T+R +     
Sbjct: 988  DVGMISSNSTNRSSNMTPKRRPTSFKTNKHIVMDILDEFFTTFNAMRQELTERNV----- 1042

Query: 1008 KALKAHEIRELASLHSLTLSLFFNMSTKTRLESQLGQNFRLRDHPRSLSLLYEKAFSDMG 1067
              LK  +I  L   + ++L L    S K  +E  + Q   L + P  ++  YE   +D  
Sbjct: 1043 -ILKVSDIYRLNYFYLISL-LSVPESRKQLIEETITQ---LNELPSEITHTYESLLADKN 1097

Query: 1068 TEIYDSFIPETIATESVEMSECNMNLATIHSEFGKK----WSHLSFNVVEIDICQLTGDL 1123
             +IY   I E  ++    M   N+ L     + GK       +++  V+ IDIC+LT  L
Sbjct: 1098 CDIYGKTIFELESSNYEIMKSKNVTL-NWEEQIGKDRLLDLCNITVEVICIDICKLTNTL 1156

Query: 1124 LITRFDTVXXXXXXXXXXXXXXXSRDLSEEVLGFEAALDELNHIISSNNCXXXXXXXXXX 1183
            +I R   +               SRDL  + L F+ A + L  II+ +N           
Sbjct: 1157 IIRRISNLDSKNIMAKIPIDRNVSRDLDADSLTFQQASESLQKIINDSNESVSKNVTETI 1216

Query: 1184 XXKEQRKNWWDERYALNNRLQTLLTKIEDSWFCGFKGVFNPRIVDQQQFEIFKKGFQSIL 1243
              K   +NWW  RY L+  L  L+ +IE +W  G  G+ N    D+     F+    +IL
Sbjct: 1217 KDKNDVRNWWKRRYDLDELLGNLIERIEKTWLNGLSGILNGLYCDKDALLEFQSKITAIL 1276

Query: 1244 HTHLPSRKSSRQSDSFLQVDNMLIELFVLLDVINQPTEKAVSMMEDLIYFVFDILLFHGE 1303
            +  LPSR++     +FLQ+D  +I L +    ++       + +ED+IYF+ D L   GE
Sbjct: 1277 NQILPSRRNCCNRANFLQLDEWIISLLL---DLDPSDLGFFTALEDVIYFILDTLSHKGE 1333

Query: 1304 QNAYDEIDVNLMHVKFEELLQEYNAESKTKDQTLDHTFLILGNKCHSIPWESLDFLKSIS 1363
            +NAYDEID  L+HV  EE +++     K   + ++HTFL++G  CH+ PWE +  LK  S
Sbjct: 1334 ENAYDEIDFGLLHVLLEEEIRKVRVNKKLFTK-IEHTFLVVGPSCHTFPWEIMKPLKGRS 1392

Query: 1364 ISRVPSIKMLDELLTK-HSELSPCVNVSENLSFVLNPGNDLGRTETVFSSEFIAMA-SRT 1421
            ++RVPS+ +L  LL+     L   +  + ++S +LN  +DL RTE  F   F  +  SR 
Sbjct: 1393 VTRVPSLTILSNLLSSIKGNLPVKIERTNDISMILNSNSDLVRTEKTFKDIFERIQDSRA 1452

Query: 1422 NSKAFIGKPPTVDEFFHSVADSNLFVYVGHSGGEQYVKLKDLRKCNHLAPSLLLGCSSAH 1481
             S+  + + PT +E+   + +S +F+YVGH GGEQYV+   + +C+ L P  L+GCSSA 
Sbjct: 1453 GSRLLVNQKPTEEEYMDYLTNSKVFLYVGHGGGEQYVRNCTIERCDKLPPVFLMGCSSAA 1512

Query: 1482 LKYCGTFESSGTIYSYLLGGSPMVVGNLWDVTDKDTDKLSVSVFEKTGFFNSKPISRTDE 1541
             K  G    +    SY+ G S MV+GNLWDVTDKD DK S+ + EK    ++KP      
Sbjct: 1513 TKLNGNLNPNCVAESYMYGNSVMVLGNLWDVTDKDIDKFSIEMLEKCNLLDAKP------ 1566

Query: 1542 SDATIKQFLNVSEAISQSRDECNMK 1566
             +  I     V +A++ SR  C++K
Sbjct: 1567 -NTVIT---GVPQAVADSRTVCHLK 1587

 Score =  112 bits (280), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 97/161 (60%)

Query: 87  HQLKKLQELPKKHMNWIIFLMERNKLTQASNQILMLYNETNLIKAKGIDDVLLSDFSAGN 146
           H L+ +  + K+H+  I+ L+  N L  AS  I+ LYN TN      I  +LL D++  N
Sbjct: 84  HGLRVINLITKQHLLLIVKLINGNCLNSASRNIISLYNNTNRNSISEIQQLLLCDYTKNN 143

Query: 147 ENYLATLKVITMQLILKTGTTERHAESLLECFAHDTRYLLKDPNVKVHALVKLILNFFTL 206
           + YL++LK++ +Q +LK         S+++ FA+D + LL+D  +K + ++KLILN+++ 
Sbjct: 144 KEYLSSLKILVLQTLLKKHDVSESIISVIKLFAYDRKLLLEDHKLKKNTVIKLILNYYSK 203

Query: 207 LTGFKPLFGLKFVQYVNQFKLEFGNYIKNMDSSTFQRQITK 247
              ++ LFGLKF+QY+ QF   +  +IKNM    F +Q+ +
Sbjct: 204 FKEYRLLFGLKFLQYIAQFNFRYDEFIKNMTRDAFLQQLGR 244

>CAGL0L04136g complement(482826..485315) similar to sp|P53540
           Saccharomyces cerevisiae YNL126w SPC98 spindle pole body
           component, start by similarity
          Length = 829

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 45/93 (48%), Gaps = 18/93 (19%)

Query: 157 TMQLILKTGTTERHAESLLECFAHDTRYLLKDPNVKVHALVKLILNFFT----------- 205
           ++ L+L+T       +++++ FA D  +LL  P      L KLI NF +           
Sbjct: 6   SLSLLLETYLPPEFPDTVIQLFAKDVLFLLSSPYKNKQQLSKLIENFQSKIPVTLRHRNT 65

Query: 206 ---LLTGFKPLFGL----KFVQYVNQFKLEFGN 231
              LL+  +PLF +    + + YVN+ ++E+ +
Sbjct: 66  LPKLLSSLEPLFSMSNEQEMLNYVNELQMEYSD 98

>Kwal_27.12514
          Length = 958

 Score = 34.7 bits (78), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 39/70 (55%), Gaps = 8/70 (11%)

Query: 743 KICRLLIKKEAVLSAKYRFEVISLLDDIFQRIISIYVHTGIFKDCAFFITEYQEVIGSLD 802
           ++C++++  E++    ++     LLD + QR IS     G+ K  AF + EY +++ S  
Sbjct: 502 RLCQIVVNNESL----HQLTCNHLLDYLLQRNIS----EGLAKTAAFLLGEYADLVASKV 553

Query: 803 NPTALFNMFS 812
           +   LFN+F+
Sbjct: 554 SCGDLFNLFT 563

>Sklu_2412.1 YMR120C, Contig c2412 44-1819 reverse complement
          Length = 591

 Score = 34.7 bits (78), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 33/82 (40%), Gaps = 5/82 (6%)

Query: 1036 TRLESQLGQNFRLRDHPRSLSLLYEKAFS-DMGTEIYDSFIPETIATESVEMSECNMNLA 1094
            TRL      N  LR HPR L+  + K       +   D F+   I TE  E SE     A
Sbjct: 453  TRLAGDKADNLWLRQHPRVLAFKWAKGVKRPEKSNAIDLFVTGQIPTEEPEKSEYESKFA 512

Query: 1095 TIH----SEFGKKWSHLSFNVV 1112
             I     +E  K+W   S NV 
Sbjct: 513  EIPQPLTAEERKEWLSKSTNVA 534

>YDR135C (YCF1) [981] chr4 complement(722998..727545) Vacuolar
           glutathione S-conjugate transporter, member of the
           ATP-binding cassette (ABC) superfamily [4548 bp, 1515
           aa]
          Length = 1515

 Score = 34.3 bits (77), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 41/85 (48%), Gaps = 3/85 (3%)

Query: 614 LISYWLLESYVGLQIGPKVELSIMETVSALKYQPSSFTEMNVDQLHTTLCILLTQVLWKK 673
           L+ YWL E++        + + I  T   + Y   +   + + Q+ T   ILL + L KK
Sbjct: 135 LLFYWLFETFGNF--AKLINILIRHTYEGIWYSGQTGFILTLFQVITCASILLLEALPKK 192

Query: 674 DIETFNKLIHDDLTRFRPNLFDIQN 698
            +   ++ IH  LTR +PN +D  N
Sbjct: 193 PLMP-HQHIHQTLTRRKPNPYDSAN 216

>KLLA0F17655g 1619715..1621487 highly similar to sp|P38009
            Saccharomyces cerevisiae YMR120c ADE17
            5-aminoimidazole-4-carboxamide ribotide transformylase,
            start by similarity
          Length = 590

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 29/74 (39%), Gaps = 5/74 (6%)

Query: 1036 TRLESQLGQNFRLRDHPRSLSLLYEKAFS-DMGTEIYDSFIPETIATESVEMSECNMNLA 1094
            TRL      N+ LR HPR L   + K       +   D F+   I TE  E SE      
Sbjct: 452  TRLAGDKADNWWLRQHPRVLGFKWAKGVKRPEKSNAIDLFVTGQIPTEEPEKSEYESKFE 511

Query: 1095 TIH----SEFGKKW 1104
            TI     +E  K W
Sbjct: 512  TIPEPLTAEEKKSW 525

>YER142C (MAG1) [1571] chr5 complement(455141..456031)
           DNA-3-methyladenine glycosylase, excises
           3-methyladenine, 7-methyladenine, 3-methylguanine and
           7-methylguanine from alkylation-damaged DNA [891 bp, 296
           aa]
          Length = 296

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 37/74 (50%), Gaps = 13/74 (17%)

Query: 364 FEDFKRTDNVAAVLYNCFVTKRKLLFLEHAAMVNYRAYLRTSNILEHFKKFERIIGCCQD 423
           FEDFK     A +   C ++KRK+++LE  A+             E +K  E++ G  Q 
Sbjct: 123 FEDFKDPAKCAEIA-KCGLSKRKMIYLESLAVY----------FTEKYKDIEKLFG--QK 169

Query: 424 RNVQKLLFSYVCNV 437
            N ++++ S V NV
Sbjct: 170 DNDEEVIESLVTNV 183

>CAGL0L08932g complement(974259..975197) highly similar to tr|Q12230
            Saccharomyces cerevisiae YPL004c or sp|P53252
            Saccharomyces cerevisiae YGR086c, start by similarity
          Length = 312

 Score = 31.2 bits (69), Expect = 7.2,   Method: Composition-based stats.
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 1511 DVTDKDTDKLSVSVFEKTGFFNSKPISRTDESDATIKQFLNVSEAISQSRD 1561
            DV+D  TDKL V +FE  G    + I + D+   T+K   N+  ++  SRD
Sbjct: 96   DVSDV-TDKLGVLIFE-LGELQDQFIDKYDQYRVTMKSIRNIEASVQPSRD 144

>Kwal_33.13461
          Length = 2197

 Score = 31.6 bits (70), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 53/225 (23%), Positives = 90/225 (40%), Gaps = 34/225 (15%)

Query: 289  GKDVCTEI--RNQLRLQSFSAGKIDALLRPFLYQAALNKSSSRLCDSLIISVNNSIKDLN 346
            G   CT+I   +Q  LQ++S   I + L P +YQ   +     + DS+I +  +  +++N
Sbjct: 1894 GGRACTQILETDQQDLQAYSQWHIRSFL-PLIYQQEFDDWVIIILDSMIKAKESYYQNVN 1952

Query: 347  EEAVIYVLVYLSKIFLSFEDFKRTDNVAAVLYNCFVTKRKLLFLEHAA--MVNYRAYLRT 404
            +   +  L    K     ED    D +   L   F  + K+  ++     + N + ++  
Sbjct: 1953 QSQRLTQLTRGQKA----ED----DELGGALAG-FTNRFKVPIVKRVQKLLQNQKDFILD 2003

Query: 405  SNILEHFKKFERIIGCCQDRNVQKLLFSYVCNVFMIFKENTLQDMWNLTRKSLVPCFRRM 464
             N    +K         + RN    L   +C++ M+ KE TL+          V   R+ 
Sbjct: 2004 PNFSSDYKSPNLPGSHLKVRNPLLELVKSLCHIMMLSKEQTLE----------VRALRKD 2053

Query: 465  KLDKFEIFNFSSEPMLCLLYSGSHFSYQFKWSHL----CQMLTDI 505
             L  FE+  F  E          + SY  K S+L    C  +TDI
Sbjct: 2054 LLKIFEMREFDWESEF------KNPSYSLKVSNLACEHCAFITDI 2092

>AGL006C [4305] [Homologous to ScYPL004C - SH] (712798..713715) [918
            bp, 305 aa]
          Length = 305

 Score = 30.8 bits (68), Expect = 9.3,   Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 1511 DVTDKDTDKLSVSVFEKTGFFNSKPISRTDESDATIKQFLNVSEAISQSRD 1561
            DV+D  TDKL V ++E  G    + I + D+   T+K   N+  ++  SRD
Sbjct: 96   DVSDV-TDKLGVLIYE-LGELQDQFIDKYDQYRVTVKSIRNIEASVQPSRD 144

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.135    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 48,996,594
Number of extensions: 2144064
Number of successful extensions: 6589
Number of sequences better than 10.0: 34
Number of HSP's gapped: 6761
Number of HSP's successfully gapped: 36
Length of query: 1566
Length of database: 16,596,109
Length adjustment: 115
Effective length of query: 1451
Effective length of database: 12,615,039
Effective search space: 18304421589
Effective search space used: 18304421589
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 68 (30.8 bits)