Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0D15059g32832316090.0
Sklu_1468.23183017921e-105
YPR114W3153097275e-95
CAGL0B04191g2972976473e-83
Kwal_55.205563102806483e-83
Scas_705.193243206286e-80
AAR085W3052945641e-70
Sklu_1942.42903012957e-31
Sklu_1914.22722762071e-18
KLLA0D10868g2832612036e-18
Kwal_55.197662702301973e-17
Scas_691.232732741841e-15
CAGL0H00572g2822731753e-14
YJR116W2791631612e-12
ABR162W2712571551e-11
YPL123C (RNY1)43454663.0
YIL026C (IRR1)115059653.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D15059g
         (323 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D15059g 1270160..1271146 similar to sgd|S0006318 Saccharomy...   624   0.0  
Sklu_1468.2 YPR114W, Contig c1468 762-1718                            309   e-105
YPR114W (YPR114W) [5535] chr16 (753297..754244) Protein of unkno...   284   5e-95
CAGL0B04191g 408700..409593 similar to tr|Q06107 Saccharomyces c...   253   3e-83
Kwal_55.20556                                                         254   3e-83
Scas_705.19                                                           246   6e-80
AAR085W [271] [Homologous to ScYPR114W - SH] complement(495296.....   221   1e-70
Sklu_1942.4 , Contig c1942 3428-4300 reverse complement               118   7e-31
Sklu_1914.2 YJR116W, Contig c1914 2139-2957                            84   1e-18
KLLA0D10868g complement(926978..927829) similar to sp|P47153 Sac...    83   6e-18
Kwal_55.19766                                                          80   3e-17
Scas_691.23                                                            75   1e-15
CAGL0H00572g complement(55888..56736) similar to sp|P47153 Sacch...    72   3e-14
YJR116W (YJR116W) [3008] chr10 (640740..641579) Protein of unkno...    67   2e-12
ABR162W [755] [Homologous to ScYJR116W - SH] complement(706451.....    64   1e-11
YPL123C (RNY1) [5322] chr16 complement(317640..318944) Ribonucle...    30   3.0  
YIL026C (IRR1) [2639] chr9 complement(304475..307927) Component ...    30   3.7  

>KLLA0D15059g 1270160..1271146 similar to sgd|S0006318 Saccharomyces
           cerevisiae YPR114w, start by similarity
          Length = 328

 Score =  624 bits (1609), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/323 (95%), Positives = 307/323 (95%)

Query: 1   MSSSLFSSVVPAAVSEQIDLFTTYVMSLPPHPHLTEYVIPYLESNGWITSNVILSNLHTV 60
           MSSSLFSSVVPAAVSEQIDLFTTYVMSLPPHPHLTEYVIPYLESNGWITSNVILSNLHTV
Sbjct: 1   MSSSLFSSVVPAAVSEQIDLFTTYVMSLPPHPHLTEYVIPYLESNGWITSNVILSNLHTV 60

Query: 61  LYIAVGYHALFLLSQRVLFPPLASYRLSWDPETTKDQRKSKEKQHADLVNQSAVRLVSWI 120
           LYIAVGYHALFLLSQRVLFPPLASYRLSWDPETTKDQRKSKEKQHADLVNQSAVRLVSWI
Sbjct: 61  LYIAVGYHALFLLSQRVLFPPLASYRLSWDPETTKDQRKSKEKQHADLVNQSAVRLVSWI 120

Query: 121 QSLIVLYLSFEAIAYNNEKPDLNSHDRIFGMDPYNVKVCVFAIGYFLWDIYISLVYSTLP 180
           QSLIVLYLSFEAIAYNNEKPDLNSHDRIFGMDPYNVKVCVFAIGYFLWDIYISLVYSTLP
Sbjct: 121 QSLIVLYLSFEAIAYNNEKPDLNSHDRIFGMDPYNVKVCVFAIGYFLWDIYISLVYSTLP 180

Query: 181 FVLHGLISTVVYAIGLKPYINYYAGIFLMFELSNPFLNIRWFGIKYLPQLTKDCQTVMAK 240
           FVLHGLISTVVYAIGLKPYINYYAGIFLMFELSNPFLNIRWFGIKYLPQLTKDCQTVMAK
Sbjct: 181 FVLHGLISTVVYAIGLKPYINYYAGIFLMFELSNPFLNIRWFGIKYLPQLTKDCQTVMAK 240

Query: 241 XXXXXXXXXXXXXXXXFFLARICWGFYQFYQLCTDFYNIRNDPSFLPLETAIIVTGNLIL 300
                           FFLARICWGFYQFYQLCTDFYNIRNDPSFLPLETAIIVTGNLIL
Sbjct: 241 VCNVIQLVNNVVLILIFFLARICWGFYQFYQLCTDFYNIRNDPSFLPLETAIIVTGNLIL 300

Query: 301 DVLNLFWLSTMLSVAVRIIKKGG 323
           DVLNLFWLSTMLSVAVRIIKKGG
Sbjct: 301 DVLNLFWLSTMLSVAVRIIKKGG 323

>Sklu_1468.2 YPR114W, Contig c1468 762-1718
          Length = 318

 Score =  309 bits (792), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 153/301 (50%), Positives = 204/301 (67%)

Query: 23  TYVMSLPPHPHLTEYVIPYLESNGWITSNVILSNLHTVLYIAVGYHALFLLSQRVLFPPL 82
           +Y+  LPPHP ++  V+P+L  +  +TS  IL+NLHT+LY+A  Y  +F++SQ  +FP L
Sbjct: 6   SYIADLPPHPLISNKVVPFLLEHKIVTSANILANLHTILYVAAAYQLVFVISQWFVFPLL 65

Query: 83  ASYRLSWDPETTKDQRKSKEKQHADLVNQSAVRLVSWIQSLIVLYLSFEAIAYNNEKPDL 142
             ++LS   E+ +   K   K+++ L+NQSAV  VS +QS ++LYLSF ++   N     
Sbjct: 66  VRWKLSSAGESLEKDNKIYNKEYSSLLNQSAVHFVSLVQSFVILYLSFGSMQSINRYTHP 125

Query: 143 NSHDRIFGMDPYNVKVCVFAIGYFLWDIYISLVYSTLPFVLHGLISTVVYAIGLKPYINY 202
           ++  R+F     N  VC+FA+GYF+WD  IS+VYS+ PFVLHG ISTV++ IGLKPYIN+
Sbjct: 126 SAGARVFASSRENDIVCIFAVGYFIWDTLISMVYSSFPFVLHGAISTVMFLIGLKPYINF 185

Query: 203 YAGIFLMFELSNPFLNIRWFGIKYLPQLTKDCQTVMAKXXXXXXXXXXXXXXXXFFLARI 262
           YA IFL+FELSNPFLN RWFGIKY PQLT+  + ++ K                FFLARI
Sbjct: 186 YAPIFLLFELSNPFLNFRWFGIKYFPQLTEANRGLVTKILNIVQLVNNAVLITMFFLARI 245

Query: 263 CWGFYQFYQLCTDFYNIRNDPSFLPLETAIIVTGNLILDVLNLFWLSTMLSVAVRIIKKG 322
            WG+++  +LC DFY I + P FL LET I+VTGNLILDVLN  W + MLSVA RII KG
Sbjct: 246 FWGWWKIGELCWDFYQIYDQPQFLALETGIVVTGNLILDVLNAVWFAKMLSVAKRIISKG 305

Query: 323 G 323
           G
Sbjct: 306 G 306

>YPR114W (YPR114W) [5535] chr16 (753297..754244) Protein of unknown
           function, has low similarity to uncharacterized C.
           albicans Orf6.7788p [948 bp, 315 aa]
          Length = 315

 Score =  284 bits (727), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 143/309 (46%), Positives = 201/309 (65%), Gaps = 19/309 (6%)

Query: 25  VMSLPPHPHLTEYVIPYLESNGWITSNVILSNLHTVLYIAVGYHALFLLSQRVLFPPLAS 84
           ++SLP        VIP+L +   I S  ILSNLH++ Y+A+ YH  FL  + +LFP L  
Sbjct: 4   LLSLPQPELFKTTVIPFLANRNIIKSEAILSNLHSIFYVAIFYHIWFLFGKWILFPHLVK 63

Query: 85  YRLSWDPE--TTKDQRKSKEKQ-------HADLVNQSAVRLVSWIQSLIVLYLSFEAI-- 133
           ++L +D +    KD++ + E+Q       +  L+NQS+V L+S +QS++VLY S + +  
Sbjct: 64  WKLDYDQKHNVKKDEKTTSERQAQHYKKKYTSLINQSSVHLISLLQSIVVLYYSLKFLLD 123

Query: 134 AYNNEKPDLNSHDRIFGMDPYNVKVCVFAIGYFLWDIYISLVYSTLPFVLHGLISTVVYA 193
              + +P   SH R+F  +     +C+FAIGYF+WDIYIS +YST PFV+HG+ISTVV+ 
Sbjct: 124 PKASAEPYQTSHSRVFTENRDTQVICIFAIGYFVWDIYISTMYSTFPFVVHGIISTVVFC 183

Query: 194 IGLKPYINYYAGIFLMFELSNPFLNIRWFGIKYLPQLTKDCQTVMAKXXXXXXXXXXXXX 253
           IGLKPYI YYA +FLMFELSNP LN RWFGIK+LPQ +K C  ++               
Sbjct: 184 IGLKPYIQYYAPVFLMFELSNPSLNFRWFGIKFLPQKSKFCSLLLL--------LNNLTL 235

Query: 254 XXXFFLARICWGFYQFYQLCTDFYNIRNDPSFLPLETAIIVTGNLILDVLNLFWLSTMLS 313
              FF ARI WG++Q  +LC DFY +RN+P FL  +T +I+ GN +LD+LN+ W STM+S
Sbjct: 236 MVVFFAARIAWGWFQIGKLCYDFYQVRNEPGFLVFDTIVILAGNFVLDILNVIWFSTMVS 295

Query: 314 VAVRIIKKG 322
           VA +++KKG
Sbjct: 296 VAAKVLKKG 304

>CAGL0B04191g 408700..409593 similar to tr|Q06107 Saccharomyces
           cerevisiae YPR114w, hypothetical start
          Length = 297

 Score =  253 bits (647), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 135/297 (45%), Positives = 190/297 (63%), Gaps = 15/297 (5%)

Query: 26  MSLPPHPHLTEYVIPYLESNGWITSNVILSNLHTVLYIAVGYHALFLLSQRVLFPPLASY 85
           + +P        VIP+L     + S  ILSNLH+++Y+A+GY   FL ++ +LFPPL  +
Sbjct: 11  LDIPSPTIFDAKVIPFLRDYNIVKSEAILSNLHSIIYVALGYQMWFLATRWLLFPPLTKW 70

Query: 86  RLSWDPETTKDQRKSKEKQHADLVNQSAVRLVSWIQSLIVLYLSFEAIAYNNEKPDLNS- 144
           RLS   +   D++K+K+     L  ++A+  VS++Q+L+V+YLS   +   ++  + ++ 
Sbjct: 71  RLS-HSKVPNDEKKAKK-----LNIEAAIHFVSFLQTLVVVYLSLIFLCDGDKTSNYDTV 124

Query: 145 HDRIFGMDPYNVKVCVFAIGYFLWDIYISLVYSTLPFVLHGLISTVVYAIGLKPYINYYA 204
           + RIFG       + V+AIGYF+WD+YIS+++STLPFVLHG+ISTVV+ IGLKPYI YYA
Sbjct: 125 NARIFGRSRDTEIITVYAIGYFVWDVYISVLHSTLPFVLHGIISTVVFTIGLKPYIQYYA 184

Query: 205 GIFLMFELSNPFLNIRWFGIKYLPQLTKDCQTVMAKXXXXXXXXXXXXXXXXFFLARICW 264
            +FLMFELSNPFLN+RWFG+KYLP   + C   +                     ARI W
Sbjct: 185 PVFLMFELSNPFLNLRWFGLKYLPTENRVCSIALLINNLLLLIFFFS--------ARIAW 236

Query: 265 GFYQFYQLCTDFYNIRNDPSFLPLETAIIVTGNLILDVLNLFWLSTMLSVAVRIIKK 321
           G+YQ  +L  DFY +  DP FL L+++IIV GNL+LDVLN  W  TMLSVA  +I K
Sbjct: 237 GWYQIGKLTWDFYTVHTDPRFLWLDSSIIVGGNLVLDVLNAIWFGTMLSVAFNVITK 293

>Kwal_55.20556
          Length = 310

 Score =  254 bits (648), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 130/280 (46%), Positives = 181/280 (64%), Gaps = 12/280 (4%)

Query: 48  ITSNVILSNLHTVLYIAVGYHALFLLSQRVLFPPLASYRLSWDPETTKDQRKSKEKQHAD 107
           I+S  IL++LH++LY+A+ YHA+FL S+ +LFPP+A  RL    E  K  R  +     D
Sbjct: 28  ISSPKILAHLHSILYVALAYHAVFLASKWILFPPVARLRLC--SENGKPDRGVRR----D 81

Query: 108 LVNQSAVRLVSWIQSLIVLYLS---FEAIAYNNEKPDLNSHDRIFGMDPYNVKVCVFAIG 164
           L+NQSA+  VS +QS ++LYL    ++    N   P      R+F  D +   +C+FAIG
Sbjct: 82  LINQSALHFVSLVQSGVILYLCLTYWQTHGPNTTHP--TPEMRVFHHDVHTDTICIFAIG 139

Query: 165 YFLWDIYISLVYSTLPFVLHGLISTVVYAIGLKPYINYYAGIFLMFELSNPFLNIRWFGI 224
           YF+WD  IS+ YS+ PFVLHG++S  ++ IGL  YI +YA  FL+FELSNPFLN+RWFGI
Sbjct: 140 YFVWDAVISVFYSSAPFVLHGVVSAAMFCIGLDNYIQFYAPAFLLFELSNPFLNLRWFGI 199

Query: 225 KYLPQLTKDC-QTVMAKXXXXXXXXXXXXXXXXFFLARICWGFYQFYQLCTDFYNIRNDP 283
           KY PQL++    + + +                FF ARI WG++Q + LC DF+++R+DP
Sbjct: 200 KYFPQLSEGTPASALVRFLNFFQLINNIVLILVFFGARIAWGWHQIFHLCCDFWHVRHDP 259

Query: 284 SFLPLETAIIVTGNLILDVLNLFWLSTMLSVAVRIIKKGG 323
            FLPL+T II++GN +LDVLNL W   ML+VA RI+ K G
Sbjct: 260 RFLPLQTLIIISGNFVLDVLNLVWFCKMLAVAKRIVSKRG 299

>Scas_705.19
          Length = 324

 Score =  246 bits (628), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 129/320 (40%), Positives = 191/320 (59%), Gaps = 21/320 (6%)

Query: 14  VSEQIDLFTTYVMSLPPHPHLTEYVIPYLESNGWITSNVILSNLHTVLYIAVGYHALFLL 73
           ++  +D     ++ LP       YV+  L+SN  ++S  IL+NLH+++Y+A+ YH  FL+
Sbjct: 4   IASILDRTMDCLLELPQPVIFKTYVLDVLQSNNLVSSPAILNNLHSIIYVALFYHMWFLI 63

Query: 74  SQRVLFPPLASYRLSWDPETTKD-----------QRKSKEKQHADLVNQSAVRLVSWIQS 122
           ++ ++FPP    ++ WD E  K+           + +S +K++  LV Q ++  +S +Q 
Sbjct: 64  AKYIIFPPFVKLKMQWDQEEEKNTSAKTRKHKLHKHQSPKKRYNSLVIQCSIHFISLLQC 123

Query: 123 LIVLYLSFEAIAYNNEKPDL--NSHDRIFGMDPYNVKVCVFAIGYFLWDIYISLVYSTLP 180
           + VLY S   +    +  ++  +S  R+FG       VC+FAIGYFLWD  IS+ YS++ 
Sbjct: 124 VFVLYPSLSILLNPAKSSEIFYDSEARVFGTTRDTEVVCIFAIGYFLWDSVISMFYSSIA 183

Query: 181 FVLHGLISTVVYAIGLKPYINYYAGIFLMFELSNPFLNIRWFGIKYLPQLTKDCQTVMAK 240
           FVLHG++S  VY IGLKPYI YYA +F+MFELSNPFLN RWFGIK LP           K
Sbjct: 184 FVLHGIVSAAVYFIGLKPYIQYYAPVFMMFELSNPFLNFRWFGIKLLPSNN--------K 235

Query: 241 XXXXXXXXXXXXXXXXFFLARICWGFYQFYQLCTDFYNIRNDPSFLPLETAIIVTGNLIL 300
                           FFLARI +G++Q   +  D+Y +RNDP F+  ++ +IV GNLIL
Sbjct: 236 FIDYLLLFNNLLLMIIFFLARIVYGWFQIGMIVYDYYTVRNDPRFILFDSVVIVGGNLIL 295

Query: 301 DVLNLFWLSTMLSVAVRIIK 320
           DVLN  WLSTM+ VA++++K
Sbjct: 296 DVLNAIWLSTMVKVAIKLLK 315

>AAR085W [271] [Homologous to ScYPR114W - SH]
           complement(495296..496213) [918 bp, 305 aa]
          Length = 305

 Score =  221 bits (564), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 114/294 (38%), Positives = 169/294 (57%), Gaps = 18/294 (6%)

Query: 26  MSLPPHPHLTEYVIPYLESNGWITSNVILSNLHTVLYIAVGYHALFLLSQRVLFPPLASY 85
           +  P HP + E ++P+L  +G + S  +LS++H V+Y+A+ YH  +L+ + +LFP L  +
Sbjct: 8   LGAPVHPLIGEQLVPFLRRHGVVRSEEMLSHMHLVIYVALFYHCCYLVGKHMLFPGLVRW 67

Query: 86  RLSWDPETTKDQRKSKEKQHADLVNQSAVRLVSWIQSLIVLYLSFEAIAYNNEKPDLNSH 145
           R +  P+               L+ QSA+  VS +QS+++L L + +   +         
Sbjct: 68  RRAVAPQ--------------RLLVQSAIHWVSLVQSVVILTLCYASWPLHTRATHPRPE 113

Query: 146 DRIFGMDPYNVKVCVFAIGYFLWDIYISLVYSTLPFVLHGLISTVVYAIGLKPYINYYAG 205
           DR+F   P N  +  FA+GYFLWD  ISL +S++ F LHG +STVV+ IG+ PYINYYAG
Sbjct: 114 DRVFATTPVNSVLASFALGYFLWDTVISLRHSSVAFALHGAVSTVVFLIGMTPYINYYAG 173

Query: 206 IFLMFELSNPFLNIRWFGIKYLPQLTKD----CQTVMAKXXXXXXXXXXXXXXXXFFLAR 261
           +FL+FELSNPFLN  WF   YLP  ++         + +                FF AR
Sbjct: 174 MFLLFELSNPFLNGHWFARHYLPLGSQTHPHAGDARLVRWSARFALANDLVFFTVFFCAR 233

Query: 262 ICWGFYQFYQLCTDFYNIRNDPSFLPLETAIIVTGNLILDVLNLFWLSTMLSVA 315
           I +G+Y+  +L  DFY +R DP F+P  TA I+ GNL+L+VLN  W  TM+ +A
Sbjct: 234 IAYGYYKIGELALDFYRVRADPRFMPYGTAFILGGNLVLNVLNAIWFRTMVCMA 287

>Sklu_1942.4 , Contig c1942 3428-4300 reverse complement
          Length = 290

 Score =  118 bits (295), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 97/301 (32%), Positives = 150/301 (49%), Gaps = 38/301 (12%)

Query: 33  HLTEYVIPYLESNGWI-----TSNVILSNLHTVLYIAVGYHALFLLSQRVLFPPLASYRL 87
           H  E+ +    S  WI      + +++ +L+ ++   + Y  ++L S+  + P L   R+
Sbjct: 8   HWLEFPLVNSLSTSWILKYYPQAFLLVVHLNEIIASVLFYQLVYLSSKAFIGPWLVPSRI 67

Query: 88  SWDPETTKDQRKSKEKQHADLVNQSAVRLVSWIQSLIVLYLSFEAIAYNNEKPDLNSHDR 147
                     RK   ++  D  +    R+VS++Q+L++LYL +         P+L S DR
Sbjct: 68  ---------YRKLTPQEKIDFHS----RVVSFVQTLLILYLIWPLF----HDPEL-SKDR 109

Query: 148 IFGMDPYNVKVCVFAIGYFLWDIYISLVYST---LPFVLHGLISTVVYAIGLKPYINYYA 204
           I G  PY+  V   A GYF+WD  +S+ + +   LPFV+HGL+S  V+ I  +P+I YY+
Sbjct: 110 INGYTPYSGFVSAMASGYFIWDTILSIRFYSVFGLPFVVHGLVSASVFLISFQPFILYYS 169

Query: 205 GIFLMFELSNPFLNIRWFGIKYLPQ----LTKDCQTVMA----KXXXXXXXXXXXXXXXX 256
            IFL+FELS PFLNI W  +++ P     L KD +   A                     
Sbjct: 170 PIFLLFELSTPFLNIHW-CLEFFPSKWAALNKDEKQEEAIFFESKLKPLKLVNGFVFMVT 228

Query: 257 FFLARICWGFYQFYQLCTDFYNIRNDPSFLPLETAIIVTGNLILDVLNLFWLSTMLSVAV 316
           FFL RI WG    Y L  DF   R+   + P    II+ GN +++ LNL+W   M+ +AV
Sbjct: 229 FFLVRIIWGLTNSYWLFKDFIQFRSQVHW-PFALVIIL-GNSVMNCLNLYWFGKMI-MAV 285

Query: 317 R 317
           R
Sbjct: 286 R 286

>Sklu_1914.2 YJR116W, Contig c1914 2139-2957
          Length = 272

 Score = 84.3 bits (207), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 77/276 (27%), Positives = 132/276 (47%), Gaps = 35/276 (12%)

Query: 49  TSNVILSNLHTVLYIAVGYHALFLLSQRVLFPPLASY--RLSWDPETTKDQRKSKEKQHA 106
           + N+ L +LH ++   V Y       Q +L+P +A +  RL +    T+ + + K K + 
Sbjct: 14  SDNLYLVHLHEIVLSFVFY-------QFILYPIIAPWLNRLFFGKHYTELESR-KTKLNF 65

Query: 107 DLVNQSAVRLVSWIQSLIVLYLSFEAIAYNNEKPDLNSHDRIFGMDPYNVKVCVFAIGYF 166
           D+     V +   I SL+++Y     I +     ++ ++      DPY+  V    +GYF
Sbjct: 66  DI---HTVSMFQCILSLVLIY----PILFTPLSLNIATY-----YDPYSSLVSSLTMGYF 113

Query: 167 LWDIYISLVYSTL---PFVLHGLISTVVYAIGLKPYINYYAGIFLMFELSNPFLNIRWFG 223
           +WD+ + L + +L    F+ H   S  V+   L+P+   + G FL+FE S PF+NI W  
Sbjct: 114 MWDLCVCLRHFSLFGVGFLGHACASLFVFYSTLRPFCQSWVGKFLIFEASTPFVNINW-- 171

Query: 224 IKYLPQLTKDCQTVMAKXXXXXXXXXXXXXXXXFFLARICWGFYQFYQLCTDFYNIRND- 282
             Y+ QL++     +                  FFL RI WGF     L  + + + +  
Sbjct: 172 --YISQLSRTSSKPVVP--AWFNVLNGILLIGVFFLVRIVWGFTAILLLLREMWKVWDQL 227

Query: 283 PSFLPLETAIIVTGNLILDVLNLFWLSTMLSVAVRI 318
           P +L L    I+  N++LD LN+FWLS M+ +A ++
Sbjct: 228 PQWLLLS---IIGINILLDSLNVFWLSKMIKIAKKL 260

>KLLA0D10868g complement(926978..927829) similar to sp|P47153
           Saccharomyces cerevisiae YJR116w, start by similarity
          Length = 283

 Score = 82.8 bits (203), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 74/261 (28%), Positives = 111/261 (42%), Gaps = 43/261 (16%)

Query: 71  FLLSQRVLFPPLASYRLSWDPETTKDQRKSKEKQHADLVNQSAVRLVSWIQSLIVLYL-- 128
           F++ Q +L+P +      W  +    +R   +K + D      +  VS IQS++ LYL  
Sbjct: 42  FVVYQFILYPFVVPKLNEWFFKEHYTERDEPDKINFD------IHTVSMIQSVVSLYLIW 95

Query: 129 -------SFEAIAYNNEKPDLNSHDRIFGMDPYNVKVCVFAIGYFLWDIYISLVYSTL-- 179
                   F    Y N                Y   V   +IGYF+WD+YI L Y  L  
Sbjct: 96  PLLWIPFGFNVATYYNS---------------YASMVSAVSIGYFMWDLYICLRYFKLFG 140

Query: 180 -PFVLHGLISTVVYAIGLKPYINYYAGIFLMFELSNPFLNIRWFGIKYLPQLTKDCQTVM 238
             F+ H + +  V  I L P    + G FL FE S PF+NI W    Y+ QL++     +
Sbjct: 141 IGFLFHAVAAFAVLTITLHPVCQAWIGRFLSFEASTPFVNINW----YIIQLSRGSSKQV 196

Query: 239 AKXXXXXXXXXXXXXXXXFFLARICWGFYQFYQLCTDFYNIRNDPSFLPL-ETAIIVTGN 297
                             FF  R+ WGF     L  + + + +    +PL  TA+I+  N
Sbjct: 197 VP--TWFNVLNGFLLISVFFFVRLVWGFVAVAILIYEMWQVWDQ---IPLYMTAVILGIN 251

Query: 298 LILDVLNLFWLSTMLSVAVRI 318
           + LD LN+ W S ML +A ++
Sbjct: 252 VSLDFLNIHWFSKMLKIAKKM 272

>Kwal_55.19766
          Length = 270

 Score = 80.5 bits (197), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 65/230 (28%), Positives = 111/230 (48%), Gaps = 19/230 (8%)

Query: 98  RKSKEKQHADLVNQSAVRLVSWIQSLIVLYLSFEAIAYNNEKPDLNSHDRIFGMDPYNVK 157
           R+  E ++ +      +  VS +Q ++ L L++  I +      L ++      DPY   
Sbjct: 52  RRYTELENRNTKLNFDIHTVSMVQCVVSLGLTWP-ILWQPLSLSLGTYQ-----DPYTSM 105

Query: 158 VCVFAIGYFLWDIYISLVYSTL---PFVLHGLISTVVYAIGLKPYINYYAGIFLMFELSN 214
           V     GYF+WD+++ L +  L    F+ H + +  V+ + L+P+   + G FL+FE S 
Sbjct: 106 VAAVTCGYFIWDLWVCLRHLKLFGLGFLGHAVAALYVFVLALRPFGQGWVGKFLIFEAST 165

Query: 215 PFLNIRWFGIKYLPQLTKDCQTVMAKXXXXXXXXXXXXXXXXFFLARICWGFYQFYQLCT 274
           PF+N+ WF    + QLT++    +                  FF+ R+ WGF     L  
Sbjct: 166 PFVNVNWF----ISQLTREAGRPVVP--MWLNAINGALLIVVFFVVRVLWGFSAIILLIG 219

Query: 275 DFYNIRND-PSFLPLETAIIVTGNLILDVLNLFWLSTMLSVAVRIIKKGG 323
             +  R + P+++P+    IV  NL LD LNLFWL+ M+ +A ++ K G 
Sbjct: 220 KLWQARAELPTWIPMT---IVPLNLALDALNLFWLTKMVQIARKMAKGGA 266

>Scas_691.23
          Length = 273

 Score = 75.5 bits (184), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 68/274 (24%), Positives = 119/274 (43%), Gaps = 31/274 (11%)

Query: 49  TSNVILSNLHTVLYIAVGYHALFLLSQRVLFPPLASYRLSWDPETTKDQRKSKEKQHADL 108
           + N+ LS+ H + Y  V Y+    +  +++ P L          + KD+    +      
Sbjct: 18  SENLYLSHAHEIFYSFVFYN----VCHQIVAPILNRMFFRSHYSSIKDKYVKVDFD---- 69

Query: 109 VNQSAVRLVSWIQSLIVLYLSFEAIAYNNEKPDLNSHDRIFGMDPYNVKVCVFAIGYFLW 168
                V  VS IQ+ + L++ +  +   N    +  H       P    V    IGYFLW
Sbjct: 70  -----VHTVSMIQAAVSLFIIWPTLFLPNNLNVVTYHG------PLTSMVASLTIGYFLW 118

Query: 169 DIYISLVYSTL---PFVLHGLISTVVYAIGLKPYINYYAGIFLMFELSNPFLNIRWFGIK 225
           D+ + + Y  +    F+ H + S  V  + LKP+   + G FL++E S PF+NI W+ I+
Sbjct: 119 DLLVCIRYFRVYGFEFLAHAVGSLYVMLLVLKPFCQPWVGKFLLYEASTPFVNINWYIIQ 178

Query: 226 YLPQLTKDCQTVMAKXXXXXXXXXXXXXXXXFFLARICWGFYQFYQLCTDFYNIRNDPSF 285
               +TK C   M                  F L R+CWG      L    + I++    
Sbjct: 179 LTDPITKKCIIPM-----WINVLNGLVLMATFGLVRLCWGSIATLILGRQMWLIKDQ--- 230

Query: 286 LPLETAI-IVTGNLILDVLNLFWLSTMLSVAVRI 318
           LP  ++I ++  N++++ +N  W S M+ +A ++
Sbjct: 231 LPRTSSIAMLVLNVVMNSMNFMWFSKMIRIAKKL 264

>CAGL0H00572g complement(55888..56736) similar to sp|P47153
           Saccharomyces cerevisiae YJR116w, start by similarity
          Length = 282

 Score = 72.0 bits (175), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 70/273 (25%), Positives = 121/273 (44%), Gaps = 29/273 (10%)

Query: 50  SNVILSNLHTVLYIAVGYHALFLLSQRVLFPPLASYRLSWDPETTKDQRKSKEKQHADLV 109
            N+ L++LH ++Y  + Y     + Q  + P +  Y      +   D    K K   D  
Sbjct: 27  DNLWLAHLHEIVYAFIFYQ----VCQYTIAPKINRYFFG---KHYSDITDKKLKLDFD-- 77

Query: 110 NQSAVRLVSWIQSLIVLYLSFEAIAYNNEKPDLNSHDRIFGMDPYNVKVCVFAIGYFLWD 169
               V  VS IQ++I + +    +A      DLN    +   +P+   V   + GYF+WD
Sbjct: 78  ----VHTVSMIQAVISIAILLPVLAL---PFDLNIATYV---NPWCSMVSALSCGYFVWD 127

Query: 170 IYISLVYSTL---PFVLHGLISTVVYAIGLKPYINYYAGIFLMFELSNPFLNIRWFGIKY 226
           + + L + ++    F+ H + S VV    L P+   + G +L+FE S PF+N+ W+ I+ 
Sbjct: 128 LALCLRHFSIYGFEFLFHAVGSLVVMLAILTPFCQPWVGKYLLFEASTPFVNMNWYTIQL 187

Query: 227 LPQLTKDCQTVMAKXXXXXXXXXXXXXXXXFFLARICWGFYQFYQLCTDFYNIRNDPSFL 286
             +       V+                  FF  RI WG+     L   F+  R +   L
Sbjct: 188 NHKHKSSSGPVIPN---WLNMINGLLLLLTFFGVRIVWGWSCNLLLLRQFWRARYE---L 241

Query: 287 P-LETAIIVTGNLILDVLNLFWLSTMLSVAVRI 318
           P L  A++++ N+ + +LN+ W S ML +A ++
Sbjct: 242 PYLAGAVVLSLNITMSLLNVLWFSKMLKIAKKM 274

>YJR116W (YJR116W) [3008] chr10 (640740..641579) Protein of unknown
           function, has moderate similarity to uncharacterized C.
           albicans Orf6.7788p [840 bp, 279 aa]
          Length = 279

 Score = 66.6 bits (161), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 44/163 (26%), Positives = 78/163 (47%), Gaps = 14/163 (8%)

Query: 164 GYFLWDIYISLVYSTL---PFVLHGLISTVVYAIGLKPYINYYAGIFLMFELSNPFLNIR 220
           GYF+WD+ + + Y  L    F  H + S  V  + L+P+   + G FL++E S PF+NI 
Sbjct: 121 GYFIWDLTMCVRYFKLYGLEFTGHAIGSVYVMLLSLRPFCQPWIGRFLIYEASTPFVNIN 180

Query: 221 WFGIKYLPQLTKDCQTVMAKXXXXXXXXXXXXXXXXFFLARICWGFYQFYQLCTDFYNIR 280
           WF    + Q     +  +                  FF+ RICWG      L    + +R
Sbjct: 181 WF----IMQCNAKSKNSIP---LWFNVVNGLLLMTVFFVVRICWGSIASALLFRQMWKVR 233

Query: 281 NDPSFLPLETAI-IVTGNLILDVLNLFWLSTMLSVAVRIIKKG 322
           ++   LP  +A+ +++ N+ +++LN+ W   M+ +A ++ K  
Sbjct: 234 DE---LPKFSAVTMMSLNIFMNLLNVLWFKKMIRIAKKLAKPA 273

>ABR162W [755] [Homologous to ScYJR116W - SH]
           complement(706451..707266) [816 bp, 271 aa]
          Length = 271

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 62/257 (24%), Positives = 107/257 (41%), Gaps = 30/257 (11%)

Query: 71  FLLSQRVLFPPLASY--RLSWDPETTKDQRKSKEKQHADLVNQSAVRLVSWIQSLIVLYL 128
           FL+ Q VL+P +A    R+ +    T+   +++            +  VS +Q+++ + +
Sbjct: 29  FLMYQFVLYPVVAPAVNRMIFGQHYTRAAPRTRANFD--------IHTVSTVQAVLCVGM 80

Query: 129 SFEAIAYNNEKPDLNSHDRIFGM-DPYNVKVCVFAIGYFLWDIYISLVYSTL---PFVLH 184
            +  +      P       +FG  D Y   V    +GYF+WD+Y+   Y  +    F+ H
Sbjct: 81  IWPLLRLPAALP-------VFGFYDEYASLVAATMVGYFVWDVYLCTRYLAVFGPGFLGH 133

Query: 185 GLISTVVYAIGLKPYINYYAGIFLMFELSNPFLNIRWFGIKYLPQLTKDCQTVMAKXXXX 244
            L S  V    L P    + G FL+FE S P +N+ WF    + QL +   +  A     
Sbjct: 134 ALGSLAVLLSALTPAFQPWLGKFLIFEASTPLVNVNWF----ITQLARGSTS--AVVPRW 187

Query: 245 XXXXXXXXXXXXFFLARICWGFYQFYQLCTDFYNIRNDPSFLPLETAIIVTG-NLILDVL 303
                       FF  RI WG      +  D+Y  R      P    ++V   N  + +L
Sbjct: 188 LPVVNGLLLLVTFFCVRIVWGVMAL--IAMDYYVWRQWGPETPKLVGLLVPAINFFMTLL 245

Query: 304 NLFWLSTMLSVAVRIIK 320
           N +W   M+ +A ++++
Sbjct: 246 NFYWFYKMVRIAKKMVR 262

>YPL123C (RNY1) [5322] chr16 complement(317640..318944) Ribonuclease
           of the ribonuclease T2 family [1305 bp, 434 aa]
          Length = 434

 Score = 30.0 bits (66), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 8/54 (14%)

Query: 263 CWGFYQFYQLCT------DFYNIRNDPSFLPLETAIIVTGNLILDVLNLFWLST 310
           C G YQ  Q C       D Y + +D  F   +T++ ++G  +L+ L+L+W S 
Sbjct: 94  CHGGYQ--QFCNRSLQIDDVYYLLHDKKFNNNDTSLQISGEKLLEYLDLYWKSN 145

>YIL026C (IRR1) [2639] chr9 complement(304475..307927) Component of
           cohesin complex, required for sister chromatid cohesion
           during DNA replication [3453 bp, 1150 aa]
          Length = 1150

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 29/59 (49%), Gaps = 6/59 (10%)

Query: 266 FYQFYQLCTDFYNIRNDPSFLPLET----AIIVTGNLILDVLNLFWLSTMLSVAVRIIK 320
           +  F +  T    + ND   L +E+      IVTGNL+LD+L   WLS+     +R  +
Sbjct: 235 YQNFAEFMTKLLEVANDLQLLYVESDEDDTQIVTGNLVLDLLT--WLSSFSVCKIRCFR 291

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.327    0.141    0.441 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,061,396
Number of extensions: 406976
Number of successful extensions: 1368
Number of sequences better than 10.0: 23
Number of HSP's gapped: 1346
Number of HSP's successfully gapped: 24
Length of query: 323
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 221
Effective length of database: 13,065,073
Effective search space: 2887381133
Effective search space used: 2887381133
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 61 (28.1 bits)