Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0D14971g1091107553930.0
Sklu_1989.21104106144740.0
AAR034W1098108543380.0
YGR094W (VAS1)1104107543360.0
Kwal_23.39721100106243280.0
Scas_705.211061104043100.0
CAGL0G03091g1105104042970.0
Scas_716.31*101997432960.0
Scas_97.1*26125210761e-139
YBL076C (ILS1)10729284567e-46
CAGL0G03311g10729224522e-45
Scas_599.1310719374398e-44
Kwal_27.1081110998534192e-41
KLLA0E20625g10739334121e-40
CAGL0L12606g9829383889e-38
AER394W10729153881e-37
Scas_568.310018263682e-35
AGL247C9888533682e-35
KLLA0D11858g9908143469e-33
YPL040C (ISM1)10028723423e-32
Kwal_27.118279858183395e-32
KLLA0E05269g8753862475e-21
YLR382C (NAM2)8943982233e-18
AER043C8734632127e-17
Kwal_26.93748844602101e-16
CAGL0H05049g9078252047e-16
Scas_719.59393971983e-15
AAL088W110458940.006
AAL133W56780860.046
Scas_650.7111951840.10
YGR171C (MSM1)57549830.11
Kwal_33.1531558334830.11
Sklu_2298.2109651830.15
KLLA0D06105g109551820.16
CAGL0J03652g109351820.17
YPL160W (CDC60)109051800.27
Sklu_2399.657436790.32
KLLA0F14971g56819780.52
Scas_620.757649770.68
CAGL0I08723g58453750.95
Sklu_2219.672367741.6
Kwal_26.8831916127722.4
Kwal_23.5635333147685.5
KLLA0C01936g64382687.3
Scas_719.84154469688.2
Kwal_14.118678189678.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D14971g
         (1075 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D14971g 1263323..1266598 highly similar to sp|P07806 Saccha...  2081   0.0  
Sklu_1989.2 YGR094W, Contig c1989 1283-4597 reverse complement       1727   0.0  
AAR034W [220] [Homologous to ScYGR094W (VAS1) - SH] complement(4...  1675   0.0  
YGR094W (VAS1) [2054] chr7 (672188..675502) Valyl-tRNA synthetas...  1674   0.0  
Kwal_23.3972                                                         1671   0.0  
Scas_705.21                                                          1664   0.0  
CAGL0G03091g 286259..289576 highly similar to sp|P07806 Saccharo...  1659   0.0  
Scas_716.31*                                                         1274   0.0  
Scas_97.1*                                                            419   e-139
YBL076C (ILS1) [123] chr2 complement(81041..84259) Isoleucyl-tRN...   180   7e-46
CAGL0G03311g 315470..318688 highly similar to sp|P09436 Saccharo...   178   2e-45
Scas_599.13                                                           173   8e-44
Kwal_27.10811                                                         166   2e-41
KLLA0E20625g 1825036..1828257 highly similar to sp|P09436 Saccha...   163   1e-40
CAGL0L12606g 1353211..1356159 similar to sp|P48526 Saccharomyces...   154   9e-38
AER394W [2894] [Homologous to ScYBL076C (ILS1) - SH] complement(...   154   1e-37
Scas_568.3                                                            146   2e-35
AGL247C [4065] [Homologous to ScYPL040C (ISM1) - SH] (237045..24...   146   2e-35
KLLA0D11858g complement(1010259..1013231) similar to sp|P48526 S...   137   9e-33
YPL040C (ISM1) [5399] chr16 complement(475988..478996) Isoleucyl...   136   3e-32
Kwal_27.11827                                                         135   5e-32
KLLA0E05269g 476546..479173 similar to sp|P11325 Saccharomyces c...   100   5e-21
YLR382C (NAM2) [3761] chr12 complement(882067..884751) Leucyl-tR...    91   3e-18
AER043C [2548] [Homologous to ScYLR382C (NAM2) - SH] (711416..71...    86   7e-17
Kwal_26.9374                                                           86   1e-16
CAGL0H05049g complement(483870..486593) similar to sp|P11325 Sac...    83   7e-16
Scas_719.5                                                             81   3e-15
AAL088W [99] [Homologous to ScYPL160W (CDC60) - SH] complement(1...    41   0.006
AAL133W [54] [Homologous to ScYGR171C (MSM1) - SH] complement(11...    38   0.046
Scas_650.7                                                             37   0.10 
YGR171C (MSM1) [2124] chr7 complement(840827..842554) Methionyl-...    37   0.11 
Kwal_33.15315                                                          37   0.11 
Sklu_2298.2 YPL160W, Contig c2298 4548-7838                            37   0.15 
KLLA0D06105g complement(522480..525767) highly similar to sp|P26...    36   0.16 
CAGL0J03652g 346614..349895 highly similar to sp|P26637 Saccharo...    36   0.17 
YPL160W (CDC60) [5287] chr16 (246989..250261) Leucyl-tRNA synthe...    35   0.27 
Sklu_2399.6 YGR171C, Contig c2399 15064-16788                          35   0.32 
KLLA0F14971g complement(1386169..1387875) similar to sp|P22438 S...    35   0.52 
Scas_620.7                                                             34   0.68 
CAGL0I08723g 849045..850799 similar to sp|P22438 Saccharomyces c...    33   0.95 
Sklu_2219.6 YDL116W, Contig c2219 10146-12317 reverse complement       33   1.6  
Kwal_26.8831                                                           32   2.4  
Kwal_23.5635                                                           31   5.5  
KLLA0C01936g 153971..155902 similar to sp|P53835 Saccharomyces c...    31   7.3  
Scas_719.84                                                            31   8.2  
Kwal_14.1186                                                           30   8.8  

>KLLA0D14971g 1263323..1266598 highly similar to sp|P07806
            Saccharomyces cerevisiae YGR094w VAS1 valyl-tRNA
            synthetase, start by similarity
          Length = 1091

 Score = 2081 bits (5393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1013/1075 (94%), Positives = 1013/1075 (94%)

Query: 1    MLRLFPTRTFNLLRTQLLPTSSLSITIRKMSTEPKQDLPQVDEKTGEIIINPLKEDGTXX 60
            MLRLFPTRTFNLLRTQLLPTSSLSITIRKMSTEPKQDLPQVDEKTGEIIINPLKEDGT  
Sbjct: 1    MLRLFPTRTFNLLRTQLLPTSSLSITIRKMSTEPKQDLPQVDEKTGEIIINPLKEDGTQK 60

Query: 61   XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTEPIPEFVDKTVAGE 120
                                                         TEPIPEFVDKTVAGE
Sbjct: 61   SPKEIEKEKKKAEKLLKFAAKQAKQAQNQAGQAKNAAKKEKKKKETEPIPEFVDKTVAGE 120

Query: 121  KKILVSLDDPALKAYNPANVESSWYEWWNKSGFFEPEFTKDGKIKPEGVFTIPAPPPNVT 180
            KKILVSLDDPALKAYNPANVESSWYEWWNKSGFFEPEFTKDGKIKPEGVFTIPAPPPNVT
Sbjct: 121  KKILVSLDDPALKAYNPANVESSWYEWWNKSGFFEPEFTKDGKIKPEGVFTIPAPPPNVT 180

Query: 181  GSLHIGHALTIAIQDSLCRYYRMKGKTVLFLPGFDHAGIATQSVVEKQIWASEKKTRHDY 240
            GSLHIGHALTIAIQDSLCRYYRMKGKTVLFLPGFDHAGIATQSVVEKQIWASEKKTRHDY
Sbjct: 181  GSLHIGHALTIAIQDSLCRYYRMKGKTVLFLPGFDHAGIATQSVVEKQIWASEKKTRHDY 240

Query: 241  GREEFVDKVWEWKEEYHKKIKNQVKKLGASYDWSREAFTLDPKLSKAVVEAFVKLHEEGI 300
            GREEFVDKVWEWKEEYHKKIKNQVKKLGASYDWSREAFTLDPKLSKAVVEAFVKLHEEGI
Sbjct: 241  GREEFVDKVWEWKEEYHKKIKNQVKKLGASYDWSREAFTLDPKLSKAVVEAFVKLHEEGI 300

Query: 301  IYRAARLVNWSVKLNTAISNLEVENKDIKGKTLLSVPGYDEKVEFGVLTSFSYPVVGSDE 360
            IYRAARLVNWSVKLNTAISNLEVENKDIKGKTLLSVPGYDEKVEFGVLTSFSYPVVGSDE
Sbjct: 301  IYRAARLVNWSVKLNTAISNLEVENKDIKGKTLLSVPGYDEKVEFGVLTSFSYPVVGSDE 360

Query: 361  KLIVATTRPETMFGDTAVAIHPDDERYKHLHGHFVQHPFLNRKMPIVCDAEAVDMEFGTG 420
            KLIVATTRPETMFGDTAVAIHPDDERYKHLHGHFVQHPFLNRKMPIVCDAEAVDMEFGTG
Sbjct: 361  KLIVATTRPETMFGDTAVAIHPDDERYKHLHGHFVQHPFLNRKMPIVCDAEAVDMEFGTG 420

Query: 421  AVKITPAHDQNDYNTGLRHNLEVINTFTDDGLLNENCGPEWEGTRRFDARKLVIEKLKEK 480
            AVKITPAHDQNDYNTGLRHNLEVINTFTDDGLLNENCGPEWEGTRRFDARKLVIEKLKEK
Sbjct: 421  AVKITPAHDQNDYNTGLRHNLEVINTFTDDGLLNENCGPEWEGTRRFDARKLVIEKLKEK 480

Query: 481  GLFVGQKDNEMTIPTCSRSGDIIEPLLKPQWWVSQKQMAEEAIKVVRNGEITITPKSSES 540
            GLFVGQKDNEMTIPTCSRSGDIIEPLLKPQWWVSQKQMAEEAIKVVRNGEITITPKSSES
Sbjct: 481  GLFVGQKDNEMTIPTCSRSGDIIEPLLKPQWWVSQKQMAEEAIKVVRNGEITITPKSSES 540

Query: 541  EYFHWLENIQDWCISRQLWWGHRCPVYFVNIEGEENDRNDNSFWVSGRNLXXXXXXXXXX 600
            EYFHWLENIQDWCISRQLWWGHRCPVYFVNIEGEENDRNDNSFWVSGRNL          
Sbjct: 541  EYFHWLENIQDWCISRQLWWGHRCPVYFVNIEGEENDRNDNSFWVSGRNLEEAEAKAATK 600

Query: 601  XXXXXYTLEQDEDVLDTWFSSGLYPFSTLGWPDKTPDMSQFYPASMLETGWDILFFWVSR 660
                 YTLEQDEDVLDTWFSSGLYPFSTLGWPDKTPDMSQFYPASMLETGWDILFFWVSR
Sbjct: 601  FADKKYTLEQDEDVLDTWFSSGLYPFSTLGWPDKTPDMSQFYPASMLETGWDILFFWVSR 660

Query: 661  MILLGLKLTGSIPFKEVFCHSLVRDAQGRKMSKSLGNVVDPLDVISGIKLEDLHAKLLQG 720
            MILLGLKLTGSIPFKEVFCHSLVRDAQGRKMSKSLGNVVDPLDVISGIKLEDLHAKLLQG
Sbjct: 661  MILLGLKLTGSIPFKEVFCHSLVRDAQGRKMSKSLGNVVDPLDVISGIKLEDLHAKLLQG 720

Query: 721  NLDPREVEKAKNGQKESYPHGIPECGTDALRFALCAYTTGGRDINLDILRVEGYRKFCNK 780
            NLDPREVEKAKNGQKESYPHGIPECGTDALRFALCAYTTGGRDINLDILRVEGYRKFCNK
Sbjct: 721  NLDPREVEKAKNGQKESYPHGIPECGTDALRFALCAYTTGGRDINLDILRVEGYRKFCNK 780

Query: 781  IYQATKFALLRLGDDYKPPASEALSGNESLVEKWILHELTETAKNVNEAFEKRDFLNSTS 840
            IYQATKFALLRLGDDYKPPASEALSGNESLVEKWILHELTETAKNVNEAFEKRDFLNSTS
Sbjct: 781  IYQATKFALLRLGDDYKPPASEALSGNESLVEKWILHELTETAKNVNEAFEKRDFLNSTS 840

Query: 841  AIYEFWYLVCDVYIENSKYLIQEGTEVQQKSAKDTLYILIDNALKMIHPFMPFISEEMWQ 900
            AIYEFWYLVCDVYIENSKYLIQEGTEVQQKSAKDTLYILIDNALKMIHPFMPFISEEMWQ
Sbjct: 841  AIYEFWYLVCDVYIENSKYLIQEGTEVQQKSAKDTLYILIDNALKMIHPFMPFISEEMWQ 900

Query: 901  HLPRYASETSPTIVKSSYPTFKEEFHNPSAAKEYELILNVTKDARSLLAQYNILKNGKVF 960
            HLPRYASETSPTIVKSSYPTFKEEFHNPSAAKEYELILNVTKDARSLLAQYNILKNGKVF
Sbjct: 901  HLPRYASETSPTIVKSSYPTFKEEFHNPSAAKEYELILNVTKDARSLLAQYNILKNGKVF 960

Query: 961  VESANESYYSTVQSQKDSIVSLIKAIDEVSVVKSAADIPQGCVLQSVNPEVNVHVLVKGH 1020
            VESANESYYSTVQSQKDSIVSLIKAIDEVSVVKSAADIPQGCVLQSVNPEVNVHVLVKGH
Sbjct: 961  VESANESYYSTVQSQKDSIVSLIKAIDEVSVVKSAADIPQGCVLQSVNPEVNVHVLVKGH 1020

Query: 1021 VDIDAEISKVQKKLDKTLKSKSAIDKIVNSSDYEQKANDQVKQFNKERSEHAAAE 1075
            VDIDAEISKVQKKLDKTLKSKSAIDKIVNSSDYEQKANDQVKQFNKERSEHAAAE
Sbjct: 1021 VDIDAEISKVQKKLDKTLKSKSAIDKIVNSSDYEQKANDQVKQFNKERSEHAAAE 1075

>Sklu_1989.2 YGR094W, Contig c1989 1283-4597 reverse complement
          Length = 1104

 Score = 1727 bits (4474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 827/1061 (77%), Positives = 905/1061 (85%), Gaps = 2/1061 (0%)

Query: 15   TQLLPTSSLSITIRKMSTEPKQDLPQVDEKTGEIIINPLKEDGTXXXXXXXXXXXXXXXX 74
            T +L   S S    KM  + +Q+LP VD KTGEIIINPLKEDGT                
Sbjct: 30   TSILTHRSYSTNKNKMGAD-QQNLPPVDPKTGEIIINPLKEDGTAKTPKEIEKERKKAEK 88

Query: 75   XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTEPIPEFVDKTVAGEKKILVSLDDPALKA 134
                                            EPIPEFVDKTV GEKKILVSLDDPALKA
Sbjct: 89   LLKFAAKQAKKAAATKTASTAPKKEKKKKE-VEPIPEFVDKTVPGEKKILVSLDDPALKA 147

Query: 135  YNPANVESSWYEWWNKSGFFEPEFTKDGKIKPEGVFTIPAPPPNVTGSLHIGHALTIAIQ 194
            YNPANVESSWYEWW KSG FEPEFTKDGK+KPEG+F IPAPPPNVTG+LHIGHALTIAIQ
Sbjct: 148  YNPANVESSWYEWWVKSGLFEPEFTKDGKVKPEGLFCIPAPPPNVTGALHIGHALTIAIQ 207

Query: 195  DSLCRYYRMKGKTVLFLPGFDHAGIATQSVVEKQIWASEKKTRHDYGREEFVDKVWEWKE 254
            DSL RY RMKGKTVLFLPGFDHAGIATQSVVEKQIWA EKKTRHDYGREEFV KVWEWKE
Sbjct: 208  DSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEKQIWAKEKKTRHDYGREEFVGKVWEWKE 267

Query: 255  EYHKKIKNQVKKLGASYDWSREAFTLDPKLSKAVVEAFVKLHEEGIIYRAARLVNWSVKL 314
            EYH +IK Q+KKLGASYDW REAFTLDPKLS AV EAFV+LHEEGIIYRA+RL+NWSVKL
Sbjct: 268  EYHGRIKGQIKKLGASYDWKREAFTLDPKLSTAVTEAFVRLHEEGIIYRASRLINWSVKL 327

Query: 315  NTAISNLEVENKDIKGKTLLSVPGYDEKVEFGVLTSFSYPVVGSDEKLIVATTRPETMFG 374
            NTAISNLEVENKD+K +TLLSVPGYDEKVEFGVLTSF+Y VV SDEKLI+ATTRPETMFG
Sbjct: 328  NTAISNLEVENKDVKARTLLSVPGYDEKVEFGVLTSFAYQVVDSDEKLIIATTRPETMFG 387

Query: 375  DTAVAIHPDDERYKHLHGHFVQHPFLNRKMPIVCDAEAVDMEFGTGAVKITPAHDQNDYN 434
            DTA+A+HP+D RYKHLHG FVQHPFL RK+PIVCD+EAVDMEFGTGAVKITPAHDQNDYN
Sbjct: 388  DTAIAVHPEDPRYKHLHGKFVQHPFLPRKLPIVCDSEAVDMEFGTGAVKITPAHDQNDYN 447

Query: 435  TGLRHNLEVINTFTDDGLLNENCGPEWEGTRRFDARKLVIEKLKEKGLFVGQKDNEMTIP 494
            TG RHNLE IN  TDDGLLNENCGPEW G +RFDARK V+E+LK  GL++GQ+DNEMTIP
Sbjct: 448  TGKRHNLEFINILTDDGLLNENCGPEWCGMKRFDARKKVVEELKNAGLYIGQEDNEMTIP 507

Query: 495  TCSRSGDIIEPLLKPQWWVSQKQMAEEAIKVVRNGEITITPKSSESEYFHWLENIQDWCI 554
             CSRSGDIIEPLLKPQWWVSQ +MA+EAIK VRNG+ITITPKSSESEYFHWLENIQDWCI
Sbjct: 508  ICSRSGDIIEPLLKPQWWVSQTEMAKEAIKAVRNGDITITPKSSESEYFHWLENIQDWCI 567

Query: 555  SRQLWWGHRCPVYFVNIEGEENDRNDNSFWVSGRNLXXXXXXXXXXXXXXXYTLEQDEDV 614
            SRQLWWGHRCPVYFV IEGE+ND+ND  +WVSGR                 YTLEQDEDV
Sbjct: 568  SRQLWWGHRCPVYFVKIEGEDNDKNDGKYWVSGRTTEEAEEKAAKAFSGKKYTLEQDEDV 627

Query: 615  LDTWFSSGLYPFSTLGWPDKTPDMSQFYPASMLETGWDILFFWVSRMILLGLKLTGSIPF 674
            LDTWFSSGL+PFSTLGWP+KTPDM  FYP SMLETGWDILFFWVSRMILLGLKLTGSIPF
Sbjct: 628  LDTWFSSGLWPFSTLGWPEKTPDMENFYPFSMLETGWDILFFWVSRMILLGLKLTGSIPF 687

Query: 675  KEVFCHSLVRDAQGRKMSKSLGNVVDPLDVISGIKLEDLHAKLLQGNLDPREVEKAKNGQ 734
            KEVFCHSLVRDAQGRKMSKSLGNVVDPLDVI GIKLEDLHAKLL GNLDPREVEKAK GQ
Sbjct: 688  KEVFCHSLVRDAQGRKMSKSLGNVVDPLDVIGGIKLEDLHAKLLLGNLDPREVEKAKTGQ 747

Query: 735  KESYPHGIPECGTDALRFALCAYTTGGRDINLDILRVEGYRKFCNKIYQATKFALLRLGD 794
            KESYP+GIP+CGTDALRFALCAYTTGGRDINLDILRVEGYRKFCNKIYQATKFAL+RLGD
Sbjct: 748  KESYPNGIPQCGTDALRFALCAYTTGGRDINLDILRVEGYRKFCNKIYQATKFALMRLGD 807

Query: 795  DYKPPASEALSGNESLVEKWILHELTETAKNVNEAFEKRDFLNSTSAIYEFWYLVCDVYI 854
            DY+PPA E LSG ESLVE+WILH+LT  +K VNEA +KRDFLNSTSAIYEFWYL+CD+YI
Sbjct: 808  DYQPPAEEKLSGKESLVEQWILHKLTNYSKTVNEALDKRDFLNSTSAIYEFWYLICDIYI 867

Query: 855  ENSKYLIQEGTEVQQKSAKDTLYILIDNALKMIHPFMPFISEEMWQHLPRYASETSPTIV 914
            ENSK+LI EG+EV++KSA+DTLYIL+DNALKMIHPFMPFISEEMWQHLP+  SE SP+IV
Sbjct: 868  ENSKHLINEGSEVEKKSARDTLYILLDNALKMIHPFMPFISEEMWQHLPKRVSEVSPSIV 927

Query: 915  KSSYPTFKEEFHNPSAAKEYELILNVTKDARSLLAQYNILKNGKVFVESANESYYSTVQS 974
            K+SYP +K EF N  AA +YE +L+VTK+ARSLLAQY+ILKNGKVF+E+ N+S + T  S
Sbjct: 928  KASYPVYKAEFDNEKAATDYEFVLDVTKEARSLLAQYSILKNGKVFIETNNDSLFKTAAS 987

Query: 975  QKDSIVSLIKAIDEVSVVKSAADIPQGCVLQSVNPEVNVHVLVKGHVDIDAEISKVQKKL 1034
            QKDS+VSLIKAIDEV+VV+SA+D+P+G VLQ+V PEVNVHVLVKGHVDIDAEISK QKKL
Sbjct: 988  QKDSVVSLIKAIDEVTVVRSASDVPEGAVLQAVTPEVNVHVLVKGHVDIDAEISKTQKKL 1047

Query: 1035 DKTLKSKSAIDKIVNSSDYEQKANDQVKQFNKERSEHAAAE 1075
            +K  KSK  I+KI+NS DYE KAN+Q K+ NK + E+ AAE
Sbjct: 1048 EKAQKSKQGIEKIINSKDYEAKANEQAKESNKIKLENTAAE 1088

>AAR034W [220] [Homologous to ScYGR094W (VAS1) - SH]
            complement(402706..406002) [3297 bp, 1098 aa]
          Length = 1098

 Score = 1675 bits (4338), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 809/1085 (74%), Positives = 907/1085 (83%), Gaps = 13/1085 (1%)

Query: 1    MLR-LFPTRTFNLLRTQLL-PTSSLSITIR------KMSTEPKQDLPQVDEKTGEIIINP 52
            MLR    + +F+LL+ QL   T+  SI  R       MSTE  Q LP+VD   GEIIINP
Sbjct: 1    MLRSCLLSDSFHLLKQQLFRSTAPRSIFERIRPQSVAMSTE--QQLPEVD-ANGEIIINP 57

Query: 53   LKEDGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTEPIPEF 112
            LKEDG+                                               TE + EF
Sbjct: 58   LKEDGSPKTAKEVEKERKKAEKLLKFAAKQAKKAENKANQQKNQTKKEKKKKETEAVVEF 117

Query: 113  VDKTVAGEKKILVSLDDPALKAYNPANVESSWYEWWNKSGFFEPEFTKDGKIKPEGVFTI 172
            VD+TV GEKKIL SLDDPALKAYNPANVESSWY+WW KSGFFEPE TKDGKIKPEG+F I
Sbjct: 118  VDETVPGEKKILKSLDDPALKAYNPANVESSWYDWWVKSGFFEPELTKDGKIKPEGIFCI 177

Query: 173  PAPPPNVTGSLHIGHALTIAIQDSLCRYYRMKGKTVLFLPGFDHAGIATQSVVEKQIWAS 232
            PAPPPNVTG+LHIGHALTIAIQDSL RY RMKGKTVLFLPGFDHAGIATQSVVEKQIWA+
Sbjct: 178  PAPPPNVTGALHIGHALTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEKQIWAN 237

Query: 233  EKKTRHDYGREEFVDKVWEWKEEYHKKIKNQVKKLGASYDWSREAFTLDPKLSKAVVEAF 292
            EKKTRHDYGREEFV KVW+WKE YH KIK+QV++LGASYDWSREAFTLDP+LS++V EAF
Sbjct: 238  EKKTRHDYGREEFVKKVWDWKEVYHAKIKSQVQRLGASYDWSREAFTLDPELSRSVTEAF 297

Query: 293  VKLHEEGIIYRAARLVNWSVKLNTAISNLEVENKDIKGKTLLSVPGYDEKVEFGVLTSFS 352
            V+LHEEG+IYRA+RLVNWSVKLNTAISNLEVENK+I GKTLLSVPGYDEKVEFGVLTSF+
Sbjct: 298  VRLHEEGVIYRASRLVNWSVKLNTAISNLEVENKEIAGKTLLSVPGYDEKVEFGVLTSFA 357

Query: 353  YPVVGSDEKLIVATTRPETMFGDTAVAIHPDDERYKHLHGHFVQHPFLNRKMPIVCDAEA 412
            YPVV SDEKLI+ATTRPETMFGDTA+AIHPDD RYKHLHG FVQHPFL RKMPIVCDAEA
Sbjct: 358  YPVVDSDEKLIIATTRPETMFGDTAIAIHPDDPRYKHLHGKFVQHPFLPRKMPIVCDAEA 417

Query: 413  VDMEFGTGAVKITPAHDQNDYNTGLRHNLEVINTFTDDGLLNENCGPEWEGTRRFDARKL 472
            VDMEFGTGAVKITP HDQNDYNTG RH+LE+IN  TDDGLLNENCGPEW+G +RFDARK 
Sbjct: 418  VDMEFGTGAVKITPGHDQNDYNTGKRHDLEIINILTDDGLLNENCGPEWQGMKRFDARKR 477

Query: 473  VIEKLKEKGLFVGQKDNEMTIPTCSRSGDIIEPLLKPQWWVSQKQMAEEAIKVVRNGEIT 532
            VIEKL+E GLFV Q+DNEM IPTCSRSGD+IEP+LKPQWWVSQ +MA+EAI  V++G IT
Sbjct: 478  VIEKLQELGLFVSQQDNEMVIPTCSRSGDVIEPILKPQWWVSQGEMAKEAINAVKDGRIT 537

Query: 533  ITPKSSESEYFHWLENIQDWCISRQLWWGHRCPVYFVNIEGEENDRNDNSFWVSGRNLXX 592
            ITPKSS SEYFHWLENIQDWCISRQLWWGHRCPVYFVNIEG+E  RN+ ++WVSGRNL  
Sbjct: 538  ITPKSSASEYFHWLENIQDWCISRQLWWGHRCPVYFVNIEGKEQSRNEGTYWVSGRNLEE 597

Query: 593  XXXXXXXXXXXXXYTLEQDEDVLDTWFSSGLYPFSTLGWPDKTPDMSQFYPASMLETGWD 652
                         YTLEQDEDVLDTWFSSGL+PFSTLGWPDKTPDMS FYP SMLETGWD
Sbjct: 598  AQKKAAEKFPNEVYTLEQDEDVLDTWFSSGLWPFSTLGWPDKTPDMSTFYPFSMLETGWD 657

Query: 653  ILFFWVSRMILLGLKLTGSIPFKEVFCHSLVRDAQGRKMSKSLGNVVDPLDVISGIKLED 712
            IL+FWV+RMILLG+KLTG++PF EVFCHSLVRDAQGRKMSKSLGNVVDPL VI+G  LE+
Sbjct: 658  ILYFWVARMILLGIKLTGNVPFNEVFCHSLVRDAQGRKMSKSLGNVVDPLYVITGSSLEE 717

Query: 713  LHAKLLQGNLDPREVEKAKNGQKESYPHGIPECGTDALRFALCAYTTGGRDINLDILRVE 772
            LHA L +GNLDPREVEKAK GQKESYP+GIP+CGTDALRFALCAYTTGGRDINLDILRVE
Sbjct: 718  LHATLSKGNLDPREVEKAKAGQKESYPNGIPQCGTDALRFALCAYTTGGRDINLDILRVE 777

Query: 773  GYRKFCNKIYQATKFALLRLGDDYKPPASEALSGNESLVEKWILHELTETAKNVNEAFEK 832
            GYRKFCNKIYQATKFAL+RLGDDY PPA E LSGNESLVEKWILHEL+ TAK VNEAF+K
Sbjct: 778  GYRKFCNKIYQATKFALMRLGDDYVPPAEEQLSGNESLVEKWILHELSSTAKTVNEAFDK 837

Query: 833  RDFLNSTSAIYEFWYLVCDVYIENSKYLIQEGTEVQQKSAKDTLYILIDNALKMIHPFMP 892
            RDFL STSAIY+FWYL+CDVYIENSKYLIQEGT++++KSA+DTLY L+DNAL++IHPFMP
Sbjct: 838  RDFLTSTSAIYDFWYLICDVYIENSKYLIQEGTDLEKKSARDTLYTLVDNALRLIHPFMP 897

Query: 893  FISEEMWQHLPRYASETSPTIVKSSYPTFKEEFHNPSAAKEYELILNVTKDARSLLAQYN 952
            FISEEMWQHLP+ ASETS +IVK+ YP F+++F +  +A +Y L+L+ TK+ARSLLA+YN
Sbjct: 898  FISEEMWQHLPKRASETSESIVKAKYPVFRQDFFDEESAADYNLVLSATKEARSLLAEYN 957

Query: 953  ILKNGKVFVE--SANESYYSTVQSQKDSIVSLIKAIDEVSVVKSAADIPQGCVLQSVNPE 1010
            I+KNGKVF+E    N+  ++ + SQ  SIVSLIKAID+V+VV+SA +IP+GCVL SV P+
Sbjct: 958  IVKNGKVFIEVQGNNDKVFTCLNSQSASIVSLIKAIDQVTVVRSATEIPEGCVLSSVTPD 1017

Query: 1011 VNVHVLVKGHVDIDAEISKVQKKLDKTLKSKSAIDKIVNSSDYEQKANDQVKQFNKERSE 1070
            VNVH LVKG VDID EI K  KKLDK  KSK AI+K+V SSDYE KAN+Q K+ NK+R +
Sbjct: 1018 VNVHALVKGQVDIDTEIQKFNKKLDKAQKSKEAIEKVVGSSDYETKANEQAKKANKDRLD 1077

Query: 1071 HAAAE 1075
              AAE
Sbjct: 1078 SIAAE 1082

>YGR094W (VAS1) [2054] chr7 (672188..675502) Valyl-tRNA synthetase
            (mitochondrial and cytoplasmic forms are coded from the
            same gene), member of class I family of aminoacyl-tRNA
            synthetases [3315 bp, 1104 aa]
          Length = 1104

 Score = 1674 bits (4336), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 800/1075 (74%), Positives = 912/1075 (84%), Gaps = 2/1075 (0%)

Query: 1    MLRLFPTRTFNLLRTQLLPTSSLSITIRKMSTEPKQDLPQVDEKTGEIIINPLKEDGTXX 60
            +L     R+  L +   L  S     +R        +LP VD KTGE+IINPLKEDG+  
Sbjct: 16   LLNCHYRRSLPLCQNFSLKKSLTHNQVRFFKMSDLDNLPPVDPKTGEVIINPLKEDGSPK 75

Query: 61   XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTEPIPEFVDKTVAGE 120
                                                          EPIPEF+DKTV GE
Sbjct: 76   TPKEIEKEKKKAEKLLKFAAKQAKKNAAATTGASQKKPKKKKE--VEPIPEFIDKTVPGE 133

Query: 121  KKILVSLDDPALKAYNPANVESSWYEWWNKSGFFEPEFTKDGKIKPEGVFTIPAPPPNVT 180
            KKILVSLDDPALKAYNPANVESSWY+WW K+G FEPEFT DGK+KPEGVF IPAPPPNVT
Sbjct: 134  KKILVSLDDPALKAYNPANVESSWYDWWIKTGVFEPEFTADGKVKPEGVFCIPAPPPNVT 193

Query: 181  GSLHIGHALTIAIQDSLCRYYRMKGKTVLFLPGFDHAGIATQSVVEKQIWASEKKTRHDY 240
            G+LHIGHALTIAIQDSL RY RMKGKTVLFLPGFDHAGIATQSVVEKQIWA ++KTRHDY
Sbjct: 194  GALHIGHALTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEKQIWAKDRKTRHDY 253

Query: 241  GREEFVDKVWEWKEEYHKKIKNQVKKLGASYDWSREAFTLDPKLSKAVVEAFVKLHEEGI 300
            GRE FV KVWEWKEEYH +IKNQ++KLGASYDWSREAFTL P+L+K+V EAFV+LH+EG+
Sbjct: 254  GREAFVGKVWEWKEEYHSRIKNQIQKLGASYDWSREAFTLSPELTKSVEEAFVRLHDEGV 313

Query: 301  IYRAARLVNWSVKLNTAISNLEVENKDIKGKTLLSVPGYDEKVEFGVLTSFSYPVVGSDE 360
            IYRA+RLVNWSVKLNTAISNLEVENKD+K +TLLSVPGYDEKVEFGVLTSF+YPV+GSDE
Sbjct: 314  IYRASRLVNWSVKLNTAISNLEVENKDVKSRTLLSVPGYDEKVEFGVLTSFAYPVIGSDE 373

Query: 361  KLIVATTRPETMFGDTAVAIHPDDERYKHLHGHFVQHPFLNRKMPIVCDAEAVDMEFGTG 420
            KLI+ATTRPET+FGDTAVA+HPDD+RYKHLHG F+QHPFL RK+PI+ D EAVDMEFGTG
Sbjct: 374  KLIIATTRPETIFGDTAVAVHPDDDRYKHLHGKFIQHPFLPRKIPIITDKEAVDMEFGTG 433

Query: 421  AVKITPAHDQNDYNTGLRHNLEVINTFTDDGLLNENCGPEWEGTRRFDARKLVIEKLKEK 480
            AVKITPAHDQNDYNTG RHNLE IN  TDDGLLNE CGPEW+G +RFDARK VIE+LKEK
Sbjct: 434  AVKITPAHDQNDYNTGKRHNLEFINILTDDGLLNEECGPEWQGMKRFDARKKVIEQLKEK 493

Query: 481  GLFVGQKDNEMTIPTCSRSGDIIEPLLKPQWWVSQKQMAEEAIKVVRNGEITITPKSSES 540
             L+VGQ+DNEMTIPTCSRSGDIIEPLLKPQWWVSQ +MA++AIKVVR+G+ITITPKSSE+
Sbjct: 494  NLYVGQEDNEMTIPTCSRSGDIIEPLLKPQWWVSQSEMAKDAIKVVRDGQITITPKSSEA 553

Query: 541  EYFHWLENIQDWCISRQLWWGHRCPVYFVNIEGEENDRNDNSFWVSGRNLXXXXXXXXXX 600
            EYFHWL NIQDWCISRQLWWGHRCPVYF+NIEGEE+DR D  +WV+GR++          
Sbjct: 554  EYFHWLGNIQDWCISRQLWWGHRCPVYFINIEGEEHDRIDGDYWVAGRSMEEAEKKAAAK 613

Query: 601  XXXXXYTLEQDEDVLDTWFSSGLYPFSTLGWPDKTPDMSQFYPASMLETGWDILFFWVSR 660
                 +TLEQDEDVLDTWFSSGL+PFSTLGWP+KT DM  FYP SMLETGWDILFFWV+R
Sbjct: 614  YPNSKFTLEQDEDVLDTWFSSGLWPFSTLGWPEKTKDMETFYPFSMLETGWDILFFWVTR 673

Query: 661  MILLGLKLTGSIPFKEVFCHSLVRDAQGRKMSKSLGNVVDPLDVISGIKLEDLHAKLLQG 720
            MILLGLKLTGS+PFKEVFCHSLVRDAQGRKMSKSLGNV+DPLDVI+GIKL+DLHAKLLQG
Sbjct: 674  MILLGLKLTGSVPFKEVFCHSLVRDAQGRKMSKSLGNVIDPLDVITGIKLDDLHAKLLQG 733

Query: 721  NLDPREVEKAKNGQKESYPHGIPECGTDALRFALCAYTTGGRDINLDILRVEGYRKFCNK 780
            NLDPREVEKAK GQKESYP+GIP+CGTDA+RFALCAYTTGGRDINLDILRVEGYRKFCNK
Sbjct: 734  NLDPREVEKAKIGQKESYPNGIPQCGTDAMRFALCAYTTGGRDINLDILRVEGYRKFCNK 793

Query: 781  IYQATKFALLRLGDDYKPPASEALSGNESLVEKWILHELTETAKNVNEAFEKRDFLNSTS 840
            IYQATKFAL+RLGDDY+PPA+E LSGNESLVEKWILH+LTET+K VNEA +KRDFL STS
Sbjct: 794  IYQATKFALMRLGDDYQPPATEGLSGNESLVEKWILHKLTETSKIVNEALDKRDFLTSTS 853

Query: 841  AIYEFWYLVCDVYIENSKYLIQEGTEVQQKSAKDTLYILIDNALKMIHPFMPFISEEMWQ 900
            +IYEFWYL+CDVYIENSKYLIQEG+ +++KSAKDTLYIL+DNALK+IHPFMPFISEEMWQ
Sbjct: 854  SIYEFWYLICDVYIENSKYLIQEGSAIEKKSAKDTLYILLDNALKLIHPFMPFISEEMWQ 913

Query: 901  HLPRYASETSPTIVKSSYPTFKEEFHNPSAAKEYELILNVTKDARSLLAQYNILKNGKVF 960
             LP+ ++E + +IVK+SYP +  E+ +  +A  Y+L+LN+TK+ARSLL++YNILKNGKVF
Sbjct: 914  RLPKRSTEKAASIVKASYPVYVSEYDDVKSANAYDLVLNITKEARSLLSEYNILKNGKVF 973

Query: 961  VESANESYYSTVQSQKDSIVSLIKAIDEVSVVKSAADIPQGCVLQSVNPEVNVHVLVKGH 1020
            VES +E Y+ T + QKDSIVSLIKAIDEV+VV+ A++IP+GCVLQSVNPEVNVH+LVKGH
Sbjct: 974  VESNHEEYFKTAEDQKDSIVSLIKAIDEVTVVRDASEIPEGCVLQSVNPEVNVHLLVKGH 1033

Query: 1021 VDIDAEISKVQKKLDKTLKSKSAIDKIVNSSDYEQKANDQVKQFNKERSEHAAAE 1075
            VDIDAEI+KVQKKL+K  KSK+ I++ +NS DYE KAN Q K+ NK + ++  AE
Sbjct: 1034 VDIDAEIAKVQKKLEKAKKSKNGIEQTINSKDYETKANTQAKEANKSKLDNTVAE 1088

>Kwal_23.3972
          Length = 1100

 Score = 1671 bits (4328), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 798/1062 (75%), Positives = 895/1062 (84%), Gaps = 5/1062 (0%)

Query: 18   LPTSSLSITIRKMST----EPKQDLPQVDEKTGEIIINPLKEDGTXXXXXXXXXXXXXXX 73
            LP    S +IR  ST       + LP VD KTGEIIINPLKEDG+               
Sbjct: 24   LPFVGRSASIRLASTWNSIMSSEQLPPVDPKTGEIIINPLKEDGSEKTPKEIEKERKKAE 83

Query: 74   XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTEPIPEFVDKTVAGEKKILVSLDDPALK 133
                                                 EFVDKT AGEKKILVSL+DPALK
Sbjct: 84   KLLKFAAKQAKKAEAASKQAAAPKKEKKKKVVVPIP-EFVDKTAAGEKKILVSLEDPALK 142

Query: 134  AYNPANVESSWYEWWNKSGFFEPEFTKDGKIKPEGVFTIPAPPPNVTGSLHIGHALTIAI 193
            AYNPANVESSWY+WW KSGFFEPEFTK+G+IKPEG+F IPAPPPNVTG+LHIGH LTIAI
Sbjct: 143  AYNPANVESSWYDWWVKSGFFEPEFTKEGEIKPEGLFCIPAPPPNVTGALHIGHGLTIAI 202

Query: 194  QDSLCRYYRMKGKTVLFLPGFDHAGIATQSVVEKQIWASEKKTRHDYGREEFVDKVWEWK 253
            QDSL RY RMKGKTVLFLPGFDHAGIATQSVVEKQ+WA EKKTRHDYGRE FV+K+WEWK
Sbjct: 203  QDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEKQVWAKEKKTRHDYGREAFVEKIWEWK 262

Query: 254  EEYHKKIKNQVKKLGASYDWSREAFTLDPKLSKAVVEAFVKLHEEGIIYRAARLVNWSVK 313
            E+YHK+IKNQ+ KLGASYDWSREAFTL P+L+K+V EAFV+LHE+G+IYRA RLVNWSVK
Sbjct: 263  EDYHKRIKNQINKLGASYDWSREAFTLSPELTKSVTEAFVRLHEKGVIYRANRLVNWSVK 322

Query: 314  LNTAISNLEVENKDIKGKTLLSVPGYDEKVEFGVLTSFSYPVVGSDEKLIVATTRPETMF 373
            LNTAISNLEVENKDIK +TLLSVPGYDEKVEFGVLTSF+YPVV SDEKLIVATTRPETMF
Sbjct: 323  LNTAISNLEVENKDIKARTLLSVPGYDEKVEFGVLTSFAYPVVDSDEKLIVATTRPETMF 382

Query: 374  GDTAVAIHPDDERYKHLHGHFVQHPFLNRKMPIVCDAEAVDMEFGTGAVKITPAHDQNDY 433
            GDT VA+HPDD RYKHLHG FVQHPFL RK+PI CD+EAVDM FGTGAVK+TPAHDQNDY
Sbjct: 383  GDTGVAVHPDDPRYKHLHGKFVQHPFLPRKIPIFCDSEAVDMNFGTGAVKMTPAHDQNDY 442

Query: 434  NTGLRHNLEVINTFTDDGLLNENCGPEWEGTRRFDARKLVIEKLKEKGLFVGQKDNEMTI 493
            NTG RHNLE IN  TD GLLNENCGPEW G +RFDARK VIE LK+KGL++GQ+DNEMTI
Sbjct: 443  NTGKRHNLEFINVLTDTGLLNENCGPEWAGMKRFDARKNVIEALKQKGLYIGQEDNEMTI 502

Query: 494  PTCSRSGDIIEPLLKPQWWVSQKQMAEEAIKVVRNGEITITPKSSESEYFHWLENIQDWC 553
            PTCSRSGD+IEPLLKPQWWVSQ QMAE+AIK V++G ITITPKSSE+EYFHWLENIQDWC
Sbjct: 503  PTCSRSGDVIEPLLKPQWWVSQSQMAEKAIKAVKDGRITITPKSSEAEYFHWLENIQDWC 562

Query: 554  ISRQLWWGHRCPVYFVNIEGEENDRNDNSFWVSGRNLXXXXXXXXXXXXXXXYTLEQDED 613
            ISRQLWWGHRCPVYFV+IEG++ND+ D  +WVSGRNL               YTL+QDED
Sbjct: 563  ISRQLWWGHRCPVYFVDIEGQDNDQIDGEYWVSGRNLEEAEAKAAKKFPNAKYTLKQDED 622

Query: 614  VLDTWFSSGLYPFSTLGWPDKTPDMSQFYPASMLETGWDILFFWVSRMILLGLKLTGSIP 673
            VLDTWFSSGL+PFSTLGWPDKT D+SQFYP SMLETGWDILFFWVSRMILLGL+LTG IP
Sbjct: 623  VLDTWFSSGLWPFSTLGWPDKTKDLSQFYPFSMLETGWDILFFWVSRMILLGLELTGEIP 682

Query: 674  FKEVFCHSLVRDAQGRKMSKSLGNVVDPLDVISGIKLEDLHAKLLQGNLDPREVEKAKNG 733
            FKEVFCHSLVRDAQGRKMSKSLGNVVDPLDV+ GIKLEDLHAKLL GNLDPREVEKAK G
Sbjct: 683  FKEVFCHSLVRDAQGRKMSKSLGNVVDPLDVVCGIKLEDLHAKLLSGNLDPREVEKAKAG 742

Query: 734  QKESYPHGIPECGTDALRFALCAYTTGGRDINLDILRVEGYRKFCNKIYQATKFALLRLG 793
            QKESYP+GIP+CGTDALRFALCAYTTGGRDINLDILRVEGYRKFCNKIYQATKFAL+RLG
Sbjct: 743  QKESYPNGIPQCGTDALRFALCAYTTGGRDINLDILRVEGYRKFCNKIYQATKFALIRLG 802

Query: 794  DDYKPPASEALSGNESLVEKWILHELTETAKNVNEAFEKRDFLNSTSAIYEFWYLVCDVY 853
            +DY+PP+ E LSGNESLVEKWIL+++T  AK++NEA +KRDFL STS IYEFWYLVCDVY
Sbjct: 803  EDYQPPSMEKLSGNESLVEKWILNKMTNYAKSINEALDKRDFLTSTSGIYEFWYLVCDVY 862

Query: 854  IENSKYLIQEGTEVQQKSAKDTLYILIDNALKMIHPFMPFISEEMWQHLPRYASETSPTI 913
            IENSKYLI EGT+ ++KSAKDTLYILIDNAL++IHPFMPFISEEMWQ LP+  SE SPTI
Sbjct: 863  IENSKYLITEGTDAEKKSAKDTLYILIDNALRLIHPFMPFISEEMWQRLPKRTSEQSPTI 922

Query: 914  VKSSYPTFKEEFHNPSAAKEYELILNVTKDARSLLAQYNILKNGKVFVESANESYYSTVQ 973
            VK+SYP ++++F N  A +EYELIL+  K+ARSLLAQY ILKNGKVF+ES++++++ T  
Sbjct: 923  VKASYPVYRKDFDNQKAGEEYELILDTIKEARSLLAQYGILKNGKVFIESSSDAFFDTAV 982

Query: 974  SQKDSIVSLIKAIDEVSVVKSAADIPQGCVLQSVNPEVNVHVLVKGHVDIDAEISKVQKK 1033
            +QKDSIVSLIKAIDEV+VVK+ ++IP+G VLQ+V PEVNVHVLVKGHVDI++EISK + K
Sbjct: 983  TQKDSIVSLIKAIDEVTVVKNVSEIPEGAVLQAVTPEVNVHVLVKGHVDIESEISKTEGK 1042

Query: 1034 LDKTLKSKSAIDKIVNSSDYEQKANDQVKQFNKERSEHAAAE 1075
            L+K  K+K  IDKI+NS DYE+KAN+Q K  N  R ++  AE
Sbjct: 1043 LEKAQKTKEGIDKIMNSKDYEEKANEQAKASNLARLQNTLAE 1084

>Scas_705.21
          Length = 1061

 Score = 1664 bits (4310), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 794/1040 (76%), Positives = 891/1040 (85%), Gaps = 3/1040 (0%)

Query: 38   LPQVDEKTGEIIINPLKEDGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 97
            LP VD  TGE IINPLKEDGT                                       
Sbjct: 7    LPPVDPTTGEPIINPLKEDGTAKTPKEIEKEKKKAEKLLKFAAKQAKKKAAAATANPQKK 66

Query: 98   XXXXXXXXTEPIPEFVDKTVAGEKKILVSLDDPALKAYNPANVESSWYEWWNKSGFFEPE 157
                       IPEFVDKTV GEKK+LVSLDDP+LK+YNPANVESSWY+WW KSGFFEPE
Sbjct: 67   AKKPKKEAEP-IPEFVDKTVPGEKKVLVSLDDPSLKSYNPANVESSWYDWWVKSGFFEPE 125

Query: 158  FTKDGKIKPEGVFTIPAPPPNVTGSLHIGHALTIAIQDSLCRYYRMKGKTVLFLPGFDHA 217
            FT+DG+IKPEG+F IP PPPNVTG+LHIGHALTI+IQDSL RY RMKGKTVLFLPGFDHA
Sbjct: 126  FTEDGEIKPEGLFCIPCPPPNVTGALHIGHALTISIQDSLIRYNRMKGKTVLFLPGFDHA 185

Query: 218  GIATQSVVEKQIWASEKKTRHDYGREEFVDKVWEWKEEYHKKIKNQVKKLGASYDWSREA 277
            GIATQSVVEKQ+WA EKKTRHDYGR EFV+KVWEWK+EYH +IKNQ+K LGASYDW+REA
Sbjct: 186  GIATQSVVEKQMWAKEKKTRHDYGRTEFVNKVWEWKDEYHNRIKNQIKNLGASYDWTREA 245

Query: 278  FTLDPKLSKAVVEAFVKLHEEGIIYRAARLVNWSVKLNTAISNLEVENKDIKGKTLLSVP 337
            FTLDPKL+ AVVEAFV+LH++G IYRA+RLVNWSVKLNTAISNLEVENKD+KG+TLLSVP
Sbjct: 246  FTLDPKLTNAVVEAFVRLHDDGTIYRASRLVNWSVKLNTAISNLEVENKDVKGRTLLSVP 305

Query: 338  GYDEKVEFGVLTSFSYPVVGSD--EKLIVATTRPETMFGDTAVAIHPDDERYKHLHGHFV 395
             YDEKVEFGVLTSF+YPV  S+  EKLI+ATTRPET+FGDTA+A+HPDD RY HLHG FV
Sbjct: 306  NYDEKVEFGVLTSFAYPVADSETGEKLIIATTRPETLFGDTAIAVHPDDPRYTHLHGKFV 365

Query: 396  QHPFLNRKMPIVCDAEAVDMEFGTGAVKITPAHDQNDYNTGLRHNLEVINTFTDDGLLNE 455
            QHPFL RK+PIV D EAVDMEFGTGAVKITPAHDQNDY TG RHNLE IN  TD+GLLNE
Sbjct: 366  QHPFLPRKLPIVLDKEAVDMEFGTGAVKITPAHDQNDYQTGKRHNLEFINILTDNGLLNE 425

Query: 456  NCGPEWEGTRRFDARKLVIEKLKEKGLFVGQKDNEMTIPTCSRSGDIIEPLLKPQWWVSQ 515
            NCGPEWEG RRFDARK VIEKLKE GL++GQ+DNEMTIPTCSRSGDIIEPLLKPQWWV+Q
Sbjct: 426  NCGPEWEGMRRFDARKAVIEKLKEMGLYIGQEDNEMTIPTCSRSGDIIEPLLKPQWWVAQ 485

Query: 516  KQMAEEAIKVVRNGEITITPKSSESEYFHWLENIQDWCISRQLWWGHRCPVYFVNIEGEE 575
              MA+EAIKVV+NGE+TITPKSSE+EYFHWLENIQDWCISRQLWWGHRCPVYF+ IEG E
Sbjct: 486  GDMAKEAIKVVKNGEVTITPKSSEAEYFHWLENIQDWCISRQLWWGHRCPVYFIKIEGRE 545

Query: 576  NDRNDNSFWVSGRNLXXXXXXXXXXXXXXXYTLEQDEDVLDTWFSSGLYPFSTLGWPDKT 635
            +DRND +FWV+GRNL               +TLEQDEDVLDTWFSSGL+PFSTLGWP+KT
Sbjct: 546  DDRNDGTFWVAGRNLAEAEEKAKAKYPNEKFTLEQDEDVLDTWFSSGLWPFSTLGWPEKT 605

Query: 636  PDMSQFYPASMLETGWDILFFWVSRMILLGLKLTGSIPFKEVFCHSLVRDAQGRKMSKSL 695
             D+  FYP SMLETGWDILFFWVSRMILLGLKLTGS+PFKEVFCHSLVRDAQGRKMSKSL
Sbjct: 606  ADLEHFYPFSMLETGWDILFFWVSRMILLGLKLTGSVPFKEVFCHSLVRDAQGRKMSKSL 665

Query: 696  GNVVDPLDVISGIKLEDLHAKLLQGNLDPREVEKAKNGQKESYPHGIPECGTDALRFALC 755
            GNVVDPLDVISGIKLEDLHAKLL GNLDPREVEKAK GQKESYP+GIP+CGTDA+RFALC
Sbjct: 666  GNVVDPLDVISGIKLEDLHAKLLLGNLDPREVEKAKLGQKESYPNGIPQCGTDAMRFALC 725

Query: 756  AYTTGGRDINLDILRVEGYRKFCNKIYQATKFALLRLGDDYKPPASEALSGNESLVEKWI 815
            AYTTGGRDINLDILRVEGYRKFCNKIYQATKFAL+RLGDDY+PPA + LSG ESLVEKWI
Sbjct: 726  AYTTGGRDINLDILRVEGYRKFCNKIYQATKFALMRLGDDYQPPAEKHLSGKESLVEKWI 785

Query: 816  LHELTETAKNVNEAFEKRDFLNSTSAIYEFWYLVCDVYIENSKYLIQEGTEVQQKSAKDT 875
            LH+LT T+K VNEA EKRDFLNSTSAIYEFWYLVCDVYIENSKYLIQEG+  +QKSAKDT
Sbjct: 786  LHKLTTTSKVVNEALEKRDFLNSTSAIYEFWYLVCDVYIENSKYLIQEGSPEEQKSAKDT 845

Query: 876  LYILIDNALKMIHPFMPFISEEMWQHLPRYASETSPTIVKSSYPTFKEEFHNPSAAKEYE 935
            LY LI++ALK+IHPFMPFISEE+WQ LP+ A+ETS TIVK+SYP +++EF N SAA  YE
Sbjct: 846  LYTLIEDALKLIHPFMPFISEELWQRLPKRATETSNTIVKASYPVYEQEFDNESAANAYE 905

Query: 936  LILNVTKDARSLLAQYNILKNGKVFVESANESYYSTVQSQKDSIVSLIKAIDEVSVVKSA 995
            L+L+VTK+ARSLLA+YNILKNGKV+VES ++  + T  SQKDSIVS+IKAIDEV+VV+ +
Sbjct: 906  LVLDVTKEARSLLAEYNILKNGKVYVESNHDESFETTTSQKDSIVSMIKAIDEVTVVRKS 965

Query: 996  ADIPQGCVLQSVNPEVNVHVLVKGHVDIDAEISKVQKKLDKTLKSKSAIDKIVNSSDYEQ 1055
            ++IP+GCVL++VNP+VNVH+LVKGH+DI+AEI+KVQKKL+K  KSK  I++ +   DYE 
Sbjct: 966  SEIPEGCVLKAVNPDVNVHLLVKGHIDIEAEIAKVQKKLEKANKSKQNIEQTIGRKDYES 1025

Query: 1056 KANDQVKQFNKERSEHAAAE 1075
            KANDQ K+ NK + E++ AE
Sbjct: 1026 KANDQAKEANKVKLENSVAE 1045

>CAGL0G03091g 286259..289576 highly similar to sp|P07806 Saccharomyces
            cerevisiae YGR094w VAS1 valyl-tRNA synthetase,
            hypothetical start
          Length = 1105

 Score = 1659 bits (4297), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 777/1040 (74%), Positives = 896/1040 (86%), Gaps = 1/1040 (0%)

Query: 37   DLPQVDEKTGEIIINPLKEDGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXX 95
            +LP VD KTGE+IINPLKEDGT                                      
Sbjct: 50   NLPPVDPKTGEVIINPLKEDGTEKTPKEIEKEKKKAEKLLKFAAKQAKKKAASNAGGNSE 109

Query: 96   XXXXXXXXXXTEPIPEFVDKTVAGEKKILVSLDDPALKAYNPANVESSWYEWWNKSGFFE 155
                       EPIP FVD TV GEKKILVSLDDPALKAYNPANVESSWY+WW KSG F+
Sbjct: 110  KKEKKKAKKEVEPIPAFVDATVPGEKKILVSLDDPALKAYNPANVESSWYDWWVKSGAFD 169

Query: 156  PEFTKDGKIKPEGVFTIPAPPPNVTGSLHIGHALTIAIQDSLCRYYRMKGKTVLFLPGFD 215
            PEFT DGK+KPEG+F IPAPPPNVTG+LHIGHALTIAIQDSL RY RMKGKTVLFLPGFD
Sbjct: 170  PEFTADGKVKPEGLFCIPAPPPNVTGALHIGHALTIAIQDSLIRYNRMKGKTVLFLPGFD 229

Query: 216  HAGIATQSVVEKQIWASEKKTRHDYGREEFVDKVWEWKEEYHKKIKNQVKKLGASYDWSR 275
            HAGIATQSVVEKQ+WA EKKTRHD+GR +FV+KVWEWKEEYH++IKNQ+K LGASYDW+R
Sbjct: 230  HAGIATQSVVEKQLWAKEKKTRHDFGRTKFVEKVWEWKEEYHQRIKNQIKFLGASYDWNR 289

Query: 276  EAFTLDPKLSKAVVEAFVKLHEEGIIYRAARLVNWSVKLNTAISNLEVENKDIKGKTLLS 335
            EAFTLDP+LSK+VVEAFV+LH++G IYRAARLVNWSVKLNTAISNLEVENKD+KG+TLLS
Sbjct: 290  EAFTLDPQLSKSVVEAFVRLHDDGTIYRAARLVNWSVKLNTAISNLEVENKDVKGRTLLS 349

Query: 336  VPGYDEKVEFGVLTSFSYPVVGSDEKLIVATTRPETMFGDTAVAIHPDDERYKHLHGHFV 395
            VP YDEKVEFGVLTSF+YPV  SDEKL++ATTRPET+FGDTA+A+HPDD RYKHLHG FV
Sbjct: 350  VPNYDEKVEFGVLTSFAYPVADSDEKLVIATTRPETIFGDTAIAVHPDDARYKHLHGKFV 409

Query: 396  QHPFLNRKMPIVCDAEAVDMEFGTGAVKITPAHDQNDYNTGLRHNLEVINTFTDDGLLNE 455
            QHPFL RK+PI+CD+EAVDMEFGTGAVKITPAHDQNDYNTG RHNLE IN  TDDGLLNE
Sbjct: 410  QHPFLPRKLPIICDSEAVDMEFGTGAVKITPAHDQNDYNTGKRHNLEFINILTDDGLLNE 469

Query: 456  NCGPEWEGTRRFDARKLVIEKLKEKGLFVGQKDNEMTIPTCSRSGDIIEPLLKPQWWVSQ 515
            NCGPEW+G +RFDARK VIE +K+  L++GQ+DNEMTIPTCSRSGDIIEPLLKPQWWV+Q
Sbjct: 470  NCGPEWQGMKRFDARKKVIEDMKKLNLYIGQEDNEMTIPTCSRSGDIIEPLLKPQWWVAQ 529

Query: 516  KQMAEEAIKVVRNGEITITPKSSESEYFHWLENIQDWCISRQLWWGHRCPVYFVNIEGEE 575
             +MA++AIK V+NGEI I PKSSE+EYFHWLENIQDWCISRQLWWGHRCPVYF++IEG+E
Sbjct: 530  GEMAKDAIKAVKNGEIKIAPKSSEAEYFHWLENIQDWCISRQLWWGHRCPVYFIDIEGQE 589

Query: 576  NDRNDNSFWVSGRNLXXXXXXXXXXXXXXXYTLEQDEDVLDTWFSSGLYPFSTLGWPDKT 635
            NDRND ++WV+GR+L               +TL QDEDVLDTWFSSGL+PFSTLGWPDKT
Sbjct: 590  NDRNDGNYWVAGRDLAEAETKAKAKFPDAKFTLHQDEDVLDTWFSSGLWPFSTLGWPDKT 649

Query: 636  PDMSQFYPASMLETGWDILFFWVSRMILLGLKLTGSIPFKEVFCHSLVRDAQGRKMSKSL 695
             DM  FYP SMLETGWDILFFWV+RMILLG+KLTGS+PF EVFCHSLVRDAQGRKMSKSL
Sbjct: 650  KDMEDFYPFSMLETGWDILFFWVTRMILLGIKLTGSVPFNEVFCHSLVRDAQGRKMSKSL 709

Query: 696  GNVVDPLDVISGIKLEDLHAKLLQGNLDPREVEKAKNGQKESYPHGIPECGTDALRFALC 755
            GNVVDPLDVI+GIKLEDLHAKLL GNLDPREVEKAK GQKESYP+GIP+CGTDA+RFALC
Sbjct: 710  GNVVDPLDVITGIKLEDLHAKLLMGNLDPREVEKAKLGQKESYPNGIPQCGTDAMRFALC 769

Query: 756  AYTTGGRDINLDILRVEGYRKFCNKIYQATKFALLRLGDDYKPPASEALSGNESLVEKWI 815
            AYTTGGRDINLDILRVEGYRKFCNKIYQATKFAL+RLGDDY PPA E LSGNESLVEKWI
Sbjct: 770  AYTTGGRDINLDILRVEGYRKFCNKIYQATKFALMRLGDDYVPPAKEGLSGNESLVEKWI 829

Query: 816  LHELTETAKNVNEAFEKRDFLNSTSAIYEFWYLVCDVYIENSKYLIQEGTEVQQKSAKDT 875
            LH+LT+T++ VN+A EKRDFL STSAIYEFWYL+CDVYIENSK+LIQEG+++++KSA+DT
Sbjct: 830  LHKLTKTSQTVNDALEKRDFLTSTSAIYEFWYLICDVYIENSKHLIQEGSDLEKKSARDT 889

Query: 876  LYILIDNALKMIHPFMPFISEEMWQHLPRYASETSPTIVKSSYPTFKEEFHNPSAAKEYE 935
            LYIL+DNALK+IHPFMPFISEEMWQ +P+ ++ET  TIV++SYP +++ + +  +A  YE
Sbjct: 890  LYILLDNALKLIHPFMPFISEEMWQRIPKRSTETVNTIVRASYPVYQKVYDDEKSAASYE 949

Query: 936  LILNVTKDARSLLAQYNILKNGKVFVESANESYYSTVQSQKDSIVSLIKAIDEVSVVKSA 995
            L+L++TK+ARSLLA+YNILK GKVFVES +   + T QSQKDSIVSLIKAI+EV VV+SA
Sbjct: 950  LVLDITKEARSLLAEYNILKEGKVFVESDHTESFETAQSQKDSIVSLIKAINEVDVVRSA 1009

Query: 996  ADIPQGCVLQSVNPEVNVHVLVKGHVDIDAEISKVQKKLDKTLKSKSAIDKIVNSSDYEQ 1055
            ++IP+GCVL++VNP+VNVH+LVKGH+DIDAEI+KV+KK++K  K+K  I++I+N  DY+ 
Sbjct: 1010 SEIPEGCVLKAVNPQVNVHLLVKGHIDIDAEIAKVEKKIEKARKTKQGIEQIINGKDYDT 1069

Query: 1056 KANDQVKQFNKERSEHAAAE 1075
            KAN+Q K+ NK R E++ A+
Sbjct: 1070 KANEQAKEANKVRLENSIAD 1089

>Scas_716.31*
          Length = 1019

 Score = 1274 bits (3296), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 600/974 (61%), Positives = 763/974 (78%), Gaps = 15/974 (1%)

Query: 106  TEPIPEFVDKTVAGEKKILVSLDDPALKAYNPANVESSWYEWWNKSGFFEPEFTKDGKIK 165
            T P    +  +    KK+L  L+   LKAY+P   E +WY WW++ G F+PEFTKDGKIK
Sbjct: 27   TRPTRRLLTTSHPIVKKVLPPLNSIELKAYDPEICEKNWY-WWDQIGAFKPEFTKDGKIK 85

Query: 166  PEGVFTIPAPPPNVTGSLHIGHALTIAIQDSLCRYYRMKGKTVLFLPGFDHAGIATQSVV 225
             EG+F IPAPPPNVTG+LH+GHALTIAIQDSL RYYRMKGKTVLFLPGFDHAGIATQSVV
Sbjct: 86   AEGLFCIPAPPPNVTGALHLGHALTIAIQDSLIRYYRMKGKTVLFLPGFDHAGIATQSVV 145

Query: 226  EKQIWASEKKTRHDYGREEFVDKVWEWKEEYHKKIKNQVKKLGASYDWSREAFTLDPKLS 285
            EKQ+W  EKKTR+DYGR+ F+ K WEWKE+YHK+IKNQ+K+LGASYDWSREAFTLDPKLS
Sbjct: 146  EKQLWKQEKKTRYDYGRDGFIKKAWEWKEKYHKRIKNQLKRLGASYDWSREAFTLDPKLS 205

Query: 286  KAVVEAFVKLHEEGIIYRAARLVNWSVKLNTAISNLEVENKDIKGKTLLSVPGYDEKVEF 345
             AV EAFV+LH+ GIIYRA+RLVNWSVKL T ISNLEV+NK I G+TLL+VP Y +K+EF
Sbjct: 206  TAVKEAFVRLHDAGIIYRASRLVNWSVKLKTTISNLEVDNKIINGRTLLTVPDYKDKIEF 265

Query: 346  GVLTSFSYPVVGSD--EKLIVATTRPETMFGDTAVAIHPDDERYKHLHGHFVQHPFLNRK 403
            GVL   +YPV+ S+  E++IVATTRPET+FGD A+AIHP+D RYKHLHG FVQHP + +K
Sbjct: 266  GVLIYIAYPVIDSNTNERIIVATTRPETLFGDVAIAIHPEDSRYKHLHGKFVQHPLIPKK 325

Query: 404  MPIVCDAEAVDMEFGTGAVKITPAHDQNDYNTGLRHNLEVINTFTDDGLLNENCGPEWEG 463
            +PI+ DA AVDM FGTGAVKITPAHDQNDYN G RH+L+ +N FTDDGLLNENCG  WEG
Sbjct: 326  IPIILDATAVDMTFGTGAVKITPAHDQNDYNVGKRHSLQFVNIFTDDGLLNENCGSSWEG 385

Query: 464  TRRFDARKLVIEKLKEKGLFVGQKDNEMTIPTCSRSGDIIEPLLKPQWWVSQKQMAEEAI 523
             +RFDAR+LVI++LK KG F+ Q+DN M IP CSRSGD+IEPLLK     S K   +++ 
Sbjct: 386  LKRFDARQLVIDELKRKGFFMKQEDNPMIIPLCSRSGDVIEPLLKHNGG-SHKINGQDSD 444

Query: 524  KVVRNGEITITPKSSESEYFHWLENIQDWCISRQLWWGHRCPVYFVNIEGEEN----DRN 579
            +     EI  +  +++++YF WLENIQDWCISRQLWWGHRCPVYF+N+EG E+    +RN
Sbjct: 445  RYCGKREIRFSSSNTKNDYFRWLENIQDWCISRQLWWGHRCPVYFINVEGSEDSAAINRN 504

Query: 580  DNSFWVSGRNLXXXXXXXXXXXXXXXYTLEQDEDVLDTWFSSGLYPFSTLGWPDKTPDMS 639
            D  +WV+GRNL               ++LEQD+DVLDTWFSS L+PFSTLGWP+KT DM+
Sbjct: 505  DGKYWVAGRNLEEAVHKAAKKFPNKKFSLEQDQDVLDTWFSSALWPFSTLGWPNKTNDMN 564

Query: 640  QFYPASMLETGWDILFFWVSRMILLGLKLTGSIPFKEVFCHSLVRDAQGRKMSKSLGNVV 699
             FYP SMLETGWDILFFWV+RMI+LG+KLTGSIPFKEV+CHSLVRD +GRKMSKSLGNV+
Sbjct: 565  LFYPFSMLETGWDILFFWVTRMIMLGVKLTGSIPFKEVYCHSLVRDFEGRKMSKSLGNVI 624

Query: 700  DPLDVISGIKLEDLHAKLLQGNLDPREVEKAKNGQKESYPHGIPECGTDALRFALCAYTT 759
            DPLD+I+G  L++LH KL QGNLDP++++K K  QK+ YP GIP+CG+DALRFALCAYTT
Sbjct: 625  DPLDIINGCTLKELHEKLQQGNLDPKKIDKMKIEQKKMYPRGIPQCGSDALRFALCAYTT 684

Query: 760  GGRDINLDILRVEGYRKFCNKIYQATKFALLRLGDDYKPPASEALSGNESLVEKWILHEL 819
            GGRDINLDI RVEGYRKFCNKIYQATKF++ RLGDDY+PP+S     ++SLVEKWIL+++
Sbjct: 685  GGRDINLDISRVEGYRKFCNKIYQATKFSIQRLGDDYQPPSSTHTPASKSLVEKWILYQM 744

Query: 820  TETAKNVNEAFEKRDFLNSTSAIYEFWYLVCDVYIENSKYLIQEGTEVQQKSAKDTLYIL 879
              T   VN++FEKRDFL  TS IYE WY++CDVYIEN K+L  +   + +K+AKDTL+ L
Sbjct: 745  NNTIAIVNDSFEKRDFLTCTSKIYELWYMICDVYIENFKWLAND--TIMEKAAKDTLHTL 802

Query: 880  IDNALKMIHPFMPFISEEMWQHLPR-YASETSPTIVKSSYPTFKEEFHNPSAAKEYELIL 938
            I+N LKMIHPFMP++SEE+WQ LP     + S +I+K+ YPT  E+F+    AK+Y+ IL
Sbjct: 803  IENGLKMIHPFMPYLSEELWQRLPDGIGKDESSSIMKTLYPTPSEDFNYGKEAKQYDEIL 862

Query: 939  NVTKDARSLLAQYNILKNGKVFVESANESYYSTVQSQKDSIVSLIKAIDEVSVVKSAAD- 997
             + K  RSLL++YNI  N + F E  ++  +  V+++KD+I+S++K ++ +S +  A D 
Sbjct: 863  KIIKSMRSLLSEYNITANARFFFEILDDELFDIVRAEKDAILSVMKGVENISFLAVAPDR 922

Query: 998  --IPQGCVLQSVNPEVNVHVLVKG-HVDIDAEISKVQKKLDKTLKSKSAIDKIVNSSDYE 1054
              I   CV  S++ +VNV++LVKG + DI  E+SK  K+L+K     +A  +++ + D+ 
Sbjct: 923  QPIKNDCVSCSISSQVNVYLLVKGQYKDISKELSKQLKQLEKLNNIYAATQRMLTNKDFI 982

Query: 1055 QKANDQVKQFNKER 1068
            +KA++++++ N+++
Sbjct: 983  KKASEEIREMNEKK 996

>Scas_97.1*
          Length = 261

 Score =  419 bits (1076), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 197/252 (78%), Positives = 216/252 (85%), Gaps = 8/252 (3%)

Query: 339 YDEKVEFGVLTSFSYPVVGS--DEKLIVATTRPETMFGDTAVAIHPDDERYKHLHGHFVQ 396
           YDEKV +     F  P++ S  DEKLI+ATTRPETMF       HP+D RYKHLHG FVQ
Sbjct: 1   YDEKVNW-----FLTPLLSSRSDEKLIIATTRPETMFVH-CYCCHPEDPRYKHLHGKFVQ 54

Query: 397 HPFLNRKMPIVCDAEAVDMEFGTGAVKITPAHDQNDYNTGLRHNLEVINTFTDDGLLNEN 456
           HPFL RK+PIVCD+EAVDMEFGTGAVKITPAHDQNDYNTG RHNLE IN  TDDGLLNEN
Sbjct: 55  HPFLPRKLPIVCDSEAVDMEFGTGAVKITPAHDQNDYNTGKRHNLEFINILTDDGLLNEN 114

Query: 457 CGPEWEGTRRFDARKLVIEKLKEKGLFVGQKDNEMTIPTCSRSGDIIEPLLKPQWWVSQK 516
           CGPEW G +RFDARK V+E+LK  GL++GQ+DNEMTIP CSRSGDIIEPLLKPQWWVSQ 
Sbjct: 115 CGPEWCGMKRFDARKKVVEELKNAGLYIGQEDNEMTIPICSRSGDIIEPLLKPQWWVSQT 174

Query: 517 QMAEEAIKVVRNGEITITPKSSESEYFHWLENIQDWCISRQLWWGHRCPVYFVNIEGEEN 576
           +MA+EAIK VRNG+ITITPKSSESEYFHWLENIQDWCISRQLWWGHRCPVYFV IEGE+N
Sbjct: 175 EMAKEAIKAVRNGDITITPKSSESEYFHWLENIQDWCISRQLWWGHRCPVYFVKIEGEDN 234

Query: 577 DRNDNSFWVSGR 588
           D+ND  +WVSGR
Sbjct: 235 DKNDGKYWVSGR 246

>YBL076C (ILS1) [123] chr2 complement(81041..84259) Isoleucyl-tRNA
           synthetase, cytoplasmic, member of the class I aminoacyl
           tRNA synthetase family [3219 bp, 1072 aa]
          Length = 1072

 Score =  180 bits (456), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 216/928 (23%), Positives = 380/928 (40%), Gaps = 172/928 (18%)

Query: 157 EFTKDGKIKPEGVFTIPAPPPNVTGSLHIGHALTIAIQDSLCRYYRMKGKTVLFLPGFDH 216
           E TKD   KPE  F+    PP  TG+ H GH L   I+D + RY  M G  V    G+D 
Sbjct: 32  ELTKD---KPE--FSFFDGPPFATGTPHYGHILASTIKDIVPRYATMTGHHVERRFGWDT 86

Query: 217 AGIATQSVVEKQIWASEKKTRHDYGREEFVDKVWEWKEEYHKKIKNQVKKLGASYDWSRE 276
            G+  + +++K++  + K     YG E + ++       Y    +  + +LG   D+  +
Sbjct: 87  HGVPIEHIIDKKLGITGKDDVFKYGLENYNNECRSIVMTYASDWRKTIGRLGRWIDFDND 146

Query: 277 AFTLDPKLSKAVVEAFVKLHEEGIIYRAARLVNWSVKLNTAISNLEVEN--KDIKGKTLL 334
             T+ P   ++   AF +LHE+G +YR  +++ +S  L T +SN E +   KD+      
Sbjct: 147 YKTMYPSFMESTWWAFKQLHEKGQVYRGFKVMPYSTGLTTPLSNFEAQQNYKDVN----- 201

Query: 335 SVPGYDEKVEFGVLTSFSYPVVGSDEKLIVA-TTRPETMFGDTAVAIHPDDE-------- 385
                D  V  G      + V+G ++  +VA TT P T+  + ++ ++ D E        
Sbjct: 202 -----DPAVTIG------FNVIGQEKTQLVAWTTTPWTLPSNLSLCVNADFEYVKIYDET 250

Query: 386 --------------------------------------RYKHLHGHFVQHPFLNRKMPIV 407
                                                 +Y+ L  +F +  F      ++
Sbjct: 251 RDRYFILLESLIKTLYKKPKNEKYKIVEKIKGSDLVGLKYEPLFPYFAEQ-FHETAFRVI 309

Query: 408 CDAEAVDMEFGTGAVKITPAHDQNDYNTGLRHNL-----EVINTFTDDGLLNENCGPEWE 462
            D + V  + GTG V   PA  + D    L++ +      + N   D G   ++  P++E
Sbjct: 310 SD-DYVTSDSGTGIVHNAPAFGEEDNAACLKNGVISEDSVLPNAIDDLGRFTKDV-PDFE 367

Query: 463 GTRRFDARKLVIEKLKEKGLFVGQKDNEMTIPTCSRSGDIIEPLLK---PQWWVSQKQMA 519
           G    DA KL+I+ L   G  +       + P C RS     PLL    P W+V  K + 
Sbjct: 368 GVYVKDADKLIIKYLTNTGNLLLASQIRHSYPFCWRSD---TPLLYRSVPAWFVRVKNIV 424

Query: 520 EEAI-KVVRNGEITITPKSSESEYFHWLENIQDWCISRQLWWGHRCPVYFVNIEGEE--- 575
            + +  V+++  +  T K  E  + +W+ N +DW +SR  +WG   P++ V+ + EE   
Sbjct: 425 PQMLDSVMKSHWVPNTIK--EKRFANWIANARDWNVSRNRYWGTPIPLW-VSDDFEEVVC 481

Query: 576 -NDRNDNSFWVSGRNLXXXXXXXXXXXXXXXYT----LEQDEDVLDTWFSSGLYPFSTLG 630
                +       RN+                     L++ E+V D WF SG  P+++  
Sbjct: 482 VGSIKELEELTGVRNITDLHRDVIDKLTIPSKQGKGDLKRIEEVFDCWFESGSMPYASQH 541

Query: 631 WP-DKTPDMSQFYPASMLETGWDILFFWVSRMILLGLKLTGSIPFKEVFCHSLVRDAQGR 689
           +P + T    +  PA+ +  G D    W   + +LG  L GS+P+K V    +V  A GR
Sbjct: 542 YPFENTEKFDERVPANFISEGLDQTRGWFYTLAVLGTHLFGSVPYKNVIVSGIVLAADGR 601

Query: 690 KMSKSLGNVVDPLDVISGIKLEDLHAKLLQGNLDPREVEKAKNGQKESYPHGIPECGTDA 749
           KMSKSL N  DP  V++                                     + G DA
Sbjct: 602 KMSKSLKNYPDPSIVLN-------------------------------------KYGADA 624

Query: 750 LRFALCAYTTGGRDINLDILRV-------EGYRKFCNKI----YQATKF-----ALLRLG 793
           LR  L         IN  +L+        EG ++  +K+    + + KF     ALL+  
Sbjct: 625 LRLYL---------INSPVLKAESLKFKEEGVKEVVSKVLLPWWNSFKFLDGQIALLKKM 675

Query: 794 DDYKPPASEALSGNESLVEKWILHELTETAKNVNEAFEKRDFLNSTSAIYEFWYLVCDVY 853
            +      +++  +++++++WIL  +    + ++E   +         +  F   + + Y
Sbjct: 676 SNIDFQYDDSVK-SDNVMDRWILASMQSLVQFIHEEMGQYKLYTVVPKLLNFIDELTNWY 734

Query: 854 IE-NSKYLIQEGTEVQQKSAKDTLYILIDNALKMIHPFMPFISEEMWQHLPRYASET--- 909
           I  N + L  E        A ++L+  +   ++ + PF PF+SE ++  L  Y  E    
Sbjct: 735 IRFNRRRLKGENGVEDCLKALNSLFDALFTFVRAMAPFTPFLSESIYLRLKEYIPEAVLA 794

Query: 910 -----SPTIVKSSYPTFKEEFHNPSAAKEYELILNVTKDARSLLAQYNI-LKN--GKVFV 961
                  ++   SYP  K+E+ + +       + +V    R++  +  I LK     + +
Sbjct: 795 KYGKDGRSVHFLSYPVVKKEYFDEAIETAVSRMQSVIDLGRNIREKKTISLKTPLKTLVI 854

Query: 962 ESANESYYSTVQSQKDSIVSLIKAIDEV 989
             ++ESY   V++ K+ I+  +   D V
Sbjct: 855 LHSDESYLKDVEALKNYIIEELNVRDVV 882

>CAGL0G03311g 315470..318688 highly similar to sp|P09436
           Saccharomyces cerevisiae YBL076c ILS1 isoleucyl-tRNA
           synthetase, start by similarity
          Length = 1072

 Score =  178 bits (452), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 217/922 (23%), Positives = 375/922 (40%), Gaps = 140/922 (15%)

Query: 148 WNKSGFFEP--EFTKDGKIKPEGVFTIPAPPPNVTGSLHIGHALTIAIQDSLCRYYRMKG 205
           WN+   F    E TKD   KPE  F+    PP  TG+ H GH L   I+D + RY  M G
Sbjct: 21  WNEIDAFHRSMELTKD---KPE--FSFFDGPPFATGTPHYGHILASTIKDIVPRYATMTG 75

Query: 206 KTVLFLPGFDHAGIATQSVVEKQIWASEKKTRHDYGREEFVDKVWEWKEEYHKKIKNQVK 265
             V    G+D  G+  + +++K++    K+    YG + + ++       Y  + +  + 
Sbjct: 76  HHVERRFGWDTHGVPIEHIIDKKLGIKGKEDVFKYGLDNYNNECRAIVMTYADEWRKTIG 135

Query: 266 KLGASYDWSREAFTLDPKLSKAVVEAFVKLHEEGIIYRAARLVNWSVKLNTAISNLEVEN 325
           +LG   D+  +  T+ P   ++V  AF +LHE+G +YR  R++ +S  L T +SN E + 
Sbjct: 136 RLGRWIDFDNDYKTMYPSFMESVWWAFKQLHEKGQVYRGFRVMPYSTGLTTPLSNFEAQQ 195

Query: 326 --KDIKGKTLLSVPGYDEKVEFGVLTSFSYPVVGSDE-KLIVATTRPETMFGDTAVAIHP 382
             KD+           D  V  G      + V+G ++ KL+  TT P T+  + A+ ++P
Sbjct: 196 NYKDVN----------DPAVTIG------FNVIGQEKTKLVAWTTTPWTLPSNLALCVNP 239

Query: 383 DDERYK----HLHGHFVQ------------------------------------HPFLNR 402
           + E  K    +   +F+                                      P+   
Sbjct: 240 EFEYVKIYDENKDCYFILLESLIKTLYKKPAAEKYKIVEKIKGSELVGLKYEPIFPYFYE 299

Query: 403 KMP----IVCDAEAVDMEFGTGAVKITPAHDQNDYNTGLRHNL-----EVINTFTDDGLL 453
           +M      V   + V  + GTG V   P+  + DY   L + +        N   D+G  
Sbjct: 300 QMKETAFRVIAGDYVTADSGTGIVHNAPSFGEEDYAVCLENGVISEDTVAPNPVDDNGKF 359

Query: 454 NENCGPEWEGTRRFDARKLVIEKLKEKGLFVGQKDNEMTIPTCSRSGDIIEPLLK---PQ 510
             +   ++ G    DA KL+I+ L E G  +       + P C RS     PLL    P 
Sbjct: 360 TSDV-TDFAGIYVKDADKLIIKHLTETGNLLLASQIRHSYPFCWRSD---TPLLYRSVPA 415

Query: 511 WWVSQKQMAEEAIKVVRNGEITITPKSSESEYFHWLENIQDWCISRQLWWGHRCPVYFVN 570
           W+V  K++A + +  V N    +     E  + +W+ N +DW +SR  +WG   P++  +
Sbjct: 416 WFVRVKEIAPKMLDSVMNSH-WVPNTIKEKRFANWIANARDWNVSRNRYWGTPIPLWVSD 474

Query: 571 ----------IEGEENDRNDNSFWVSGRNLXXXXXXXXXXXXXXXYTLEQDEDVLDTWFS 620
                     IE  E      +     R+                  L++ E+V D WF 
Sbjct: 475 DFEEIVCVGSIEELEQLSGVKNITDLHRD---KIDHITIPSKMGKGDLKRIEEVFDCWFE 531

Query: 621 SGLYPFSTLGWP-DKTPDMSQFYPASMLETGWDILFFWVSRMILLGLKLTGSIPFKEVFC 679
           SG  P+++  +P + T   S   PA+ +  G D    W   + +LG  L G +P+K V  
Sbjct: 532 SGSMPYASQHYPFENTEKFSDRVPANFISEGLDQTRGWFYTLSVLGTHLFGEVPYKNVIV 591

Query: 680 HSLVRDAQGRKMSKSLGNVVDPLDVISGIKLEDLHAKLLQGNLDPREVEKAKNGQKESYP 739
             +V  + GRKMSKSL N  DP      I LE   A  L+  L    V KA++ + +   
Sbjct: 592 SGIVLASDGRKMSKSLKNYPDP-----NIVLEKYGADALRLYLINSPVLKAESLKFKE-- 644

Query: 740 HGIPECGTDALRFALCAYTTGGRDINLDILRVEGYRKFCNKIYQATKFALLRLGDDYKPP 799
            G+ E  T  L     +Y             +EG            + ALL+   D    
Sbjct: 645 EGVKEVVTKVLLPWWNSYKF-----------LEG------------QLALLKKTSDVDFK 681

Query: 800 ASEALSGNESLVEKWILHELTETAKNVNEAFEKRDFLNSTSAIYEFWYLVCDVYIE-NSK 858
               LS +++++++WIL  +    + +++             +  F   + + YI  N +
Sbjct: 682 YDPKLS-SDNVMDRWILASMQSLVQFIHQEMAVYKLYTVVPKLLHFIDELTNWYIRFNRR 740

Query: 859 YLIQEGTEVQQKSAKDTLYILIDNALKMIHPFMPFISEEMWQHLPRYASE--------TS 910
            L  E        A +TL+  +    + + PF PF+++ ++Q L  Y  E          
Sbjct: 741 RLKGENGVDDCLKALNTLFDALFTFARAMAPFTPFLADGIYQRLRAYIPEEVLAQFGQDG 800

Query: 911 PTIVKSSYPTFKEEFHNPSAAKEYELILNVTKDARSLLAQYNI-LKN--GKVFVESANES 967
            ++   SYP  ++E  + +       + +V    R++  +  I LK     + +  ++E+
Sbjct: 801 RSVHFLSYPEVRQELFDEAIETAVGRMQSVIDLGRNIREKKTISLKTPLKTLVILHSDET 860

Query: 968 YYSTVQSQKDSIVSLIKAIDEV 989
           Y   +++ K+ I+  +   D +
Sbjct: 861 YLKDIEALKNYIIEELNVRDVI 882

>Scas_599.13
          Length = 1071

 Score =  173 bits (439), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 211/937 (22%), Positives = 372/937 (39%), Gaps = 168/937 (17%)

Query: 147 WWNKSGFFEP--EFTKDGKIKPEGVFTIPAPPPNVTGSLHIGHALTIAIQDSLCRYYRMK 204
           +WN+   F    E TKD   KPE  F+    PP  TG+ H GH L   I+D + RY  M 
Sbjct: 20  YWNEIDAFHTSLELTKD---KPE--FSFFDGPPFATGTPHYGHILASTIKDIVPRYATMT 74

Query: 205 GKTVLFLPGFDHAGIATQSVVEKQIWASEKKTRHDYGREEFVDKVWEWKEEYHKKIKNQV 264
           G  V    G+D  G+  + +++K++    K+    YG + + ++       Y +  +  +
Sbjct: 75  GHHVERRFGWDTHGVPIEHIIDKKLGIKGKEDVFKYGIDNYNNECRSIVMTYAEDWRKTI 134

Query: 265 KKLGASYDWSREAFTLDPKLSKAVVEAFVKLHEEGIIYRAARLVNWSVKLNTAISNLEVE 324
            +LG   D+  +  T+ P   ++   AF +L E+  +YR  R++ +S  L T +SN E +
Sbjct: 135 GRLGRWIDFDNDYKTMYPSYMESTWWAFKQLFEKQQVYRGYRVMPYSTGLTTPLSNFEAQ 194

Query: 325 N--KDIKGKTLLSVPGYDEKVEFGVLTSFSYPVVGSDEKLIVA-TTRPETMFGDTAVAIH 381
              KD+           D  V  G      + V+G ++  +VA TT P T+  + A+ ++
Sbjct: 195 QNYKDVN----------DPAVTIG------FNVIGQEKTQLVAWTTTPWTLPSNMALCVN 238

Query: 382 PD------------------------------DERYK----------------HLHGHFV 395
           PD                              DE+YK                 L  +F 
Sbjct: 239 PDFEYVKIYDEKKDRYYILLESLIKSLYKKPKDEKYKVVEKIKGSDLVGLKYEPLFPYFA 298

Query: 396 QHPFLNRKMPIVCDAEAVDMEFGTGAVKITPAHDQNDYNTGLRHNL-----EVINTFTDD 450
           +  F +    ++ D   V  E GTG V   PA  + DY    R  +        N   D 
Sbjct: 299 EE-FKDTAFRVISDG-YVTSESGTGIVHNAPAFGEEDYTICTREGIVSEGANFPNPLDDL 356

Query: 451 GLLNENCGPEWEGTRRFDARKLVIEKLKEKGLFVGQKDNEMTIPTCSRSGDIIEPLLKPQ 510
           G        ++ G    DA KL+I+ L   G  +       + P C RS   +     P 
Sbjct: 357 GRFTSEV-TDFAGVYVKDADKLIIKHLTATGNMLYHTQIRHSYPFCWRSDTPLLYRAVPA 415

Query: 511 WWVSQKQMAEEAIKVVRNGEITITPKSSESEYFHWLENIQDWCISRQLWWGHRCPVYF-- 568
           W+V  + +  + ++ V      +     E  + +W+ N +DW +SR  +WG   P++   
Sbjct: 416 WFVRVRNIVPQMLESVEKSH-WVPNVIKEKRFANWIANARDWNVSRNRYWGTPIPLWVSD 474

Query: 569 ----VNIEGEENDRNDNSFWVSGRNLXXXXXXXXXX-XXXXXYTLEQDEDVLDTWFSSGL 623
               +   G   +    S     ++L                  L++ E+V D WF SG 
Sbjct: 475 DFKEIVCIGSVEELEKLSGVTGIKDLHRDTIDKLTIPSKQGKGELKRIEEVFDCWFESGS 534

Query: 624 YPFSTLGWP-DKTPDMSQFYPASMLETGWDILFFWVSRMILLGLKLTGSIPFKEVFCHSL 682
            P+++  +P + T   SQ  PA+ +  G D    W   + +LG  L GS+P+K V    +
Sbjct: 535 MPYASQHYPFENTEKFSQRVPANFISEGLDQTRGWFYTLSVLGTHLFGSVPYKNVIVSGI 594

Query: 683 VRDAQGRKMSKSLGNVVDPLDVISGIKLEDLHAKLLQGNLDPREVEKAKNGQKESYPHGI 742
           V  A GRKMSKSL N  DP  V+                                     
Sbjct: 595 VLAADGRKMSKSLKNYPDPNIVLV------------------------------------ 618

Query: 743 PECGTDALRFALCAYTTGGRDINLDILRV-------EGYRKFCNKI----YQATKF---- 787
            + G DALR  L         IN  +L+        EG ++  +K+    + + KF    
Sbjct: 619 -KYGADALRLYL---------INSPVLKAESLKFKEEGVKEVVSKVLLPWWNSFKFLDGQ 668

Query: 788 -ALLRLGDDYKPPASEALSGNESLVEKWILHELTETAKNVNEAFEKRDFLNSTSAIYEFW 846
            ALL+   D       +L  +++++++WIL  +    + +++             +  F 
Sbjct: 669 IALLKKTSDIDFKYDPSLM-SDNVMDRWILASMQSLVQFIHQEMGLYKLYTVVPRLLNFI 727

Query: 847 YLVCDVYIE-NSKYLIQEGTEVQQKSAKDTLYILIDNALKMIHPFMPFISEEMWQHLPRY 905
             + + YI  N + L  E        A ++L+  +   ++ + PF PF+++ ++  L  Y
Sbjct: 728 DELTNWYIRFNRRRLKGENGVEDCLKALNSLFEALFTFVRAMAPFTPFLADTIYLKLKEY 787

Query: 906 A--------SETSPTIVKSSYPTFKEEFHN---PSAAKEYELILNVTKDAR--SLLAQYN 952
                    ++   ++   SYP  +EE  +    +A    + ++++ ++ R   +++   
Sbjct: 788 IPADVLAKYTKDGRSVHFLSYPVVREELFDEAIETAVARMQSVIDLGRNIREKKMISLKT 847

Query: 953 ILKNGKVFVESANESYYSTVQSQKDSIVSLIKAIDEV 989
            LK   + +   +E+Y   V++ KD I   +   D +
Sbjct: 848 PLKT--LVILHGDEAYLKDVEALKDYITEELNVRDVI 882

>Kwal_27.10811
          Length = 1099

 Score =  166 bits (419), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 196/853 (22%), Positives = 347/853 (40%), Gaps = 129/853 (15%)

Query: 148 WNKSGFFEPEFTKDGKIKPEGVFTIPAPPPNVTGSLHIGHALTIAIQDSLCRYYRMKGKT 207
           WN+   F+    K  + KPE  F+    PP  TG+ H GH LT  ++D + RY  M G  
Sbjct: 48  WNEIDAFQTSL-KLTEGKPE--FSFFDGPPFATGTPHYGHILTSTVKDVVPRYASMNGFH 104

Query: 208 VLFLPGFDHAGIATQSVVEKQIWASEKKTRHDYGREEFVDKVWEWKEEYHKKIKNQVKKL 267
           V    G+D  G+  + +++K++  + K+  +  G +++ D+       Y ++ +  + ++
Sbjct: 105 VERRFGWDTHGLPIEHIIDKKLGITCKEDVYKMGIDKYNDECRAIVMMYAEEWRKTIGRM 164

Query: 268 GASYDWSREAFTLDPKLSKAVVEAFVKLHEEGIIYRAARLVNWSVKLNTAISNLEVEN-- 325
           G   D+  +  T+ P   ++   AF +L E+G +YR  +++ +S    T +SN E +   
Sbjct: 165 GRWIDFDNDYKTMYPSFMESTWWAFKQLFEKGQVYRGYKVMPYSTGCTTPLSNFEAQQNY 224

Query: 326 KDIKGKTLLSVPGYDEKVEFGVLTSFSYPVVGSDEK-LIVATTRPETMFGDTAVAIHP-- 382
           KD+           D  V +G      + V+G D   L+V TT P T+  + AV ++   
Sbjct: 225 KDVS----------DPAVTWG------FRVIGMDNTYLVVWTTTPWTIPSNLAVCVNAEF 268

Query: 383 ------DDERYKH-------------------------LHGH------------FVQHPF 399
                 D+ R KH                         + G             + +  +
Sbjct: 269 EYVKIYDETRDKHFIILESLIKTLYKKPEKEKYKVVEKIMGKDLVGLKYEPVYPYYKEAY 328

Query: 400 LNRKMPIVCDAEAVDMEFGTGAVKITPAHDQNDYNTGLRHNL-----EVINTFTDDGLLN 454
            ++   ++ D+  V  + GTG V   PA  + DY   L+H +     E+ N   D G   
Sbjct: 329 KDKAFRVIEDS-YVTSDSGTGLVSNAPAFGEEDYKVCLQHGIISEDDELPNPVDDAGKFT 387

Query: 455 ENCGPEWEGTRRFDARKLVIEKLKEKGLFVGQKDNEMTIPTCSRSGDIIEPLLK---PQW 511
                ++ G    DA K +I+ L   G  +       + P C RS     PLL    P W
Sbjct: 388 LPV-TDYLGQYVKDADKQIIKDLTANGTMLANTQFRHSYPFCWRSD---TPLLYRSVPAW 443

Query: 512 WVSQKQMAEEAIKVVRNGEITITPKSSESEYFHWLENIQDWCISRQLWWGHRCPVYF--- 568
           +V  K +  + +  V+     +     E  + +W+ N +DW +SR  +WG   P++    
Sbjct: 444 FVRVKPIIPKFLDSVQKSH-WVPNVIKEKRFSNWIANARDWNVSRNRYWGTPIPIWVSDD 502

Query: 569 ---VNIEGEENDRNDNSFWVSGRNLXXXXXXXXXX-XXXXXYTLEQDEDVLDTWFSSGLY 624
              V   G   +  D S   +  +L                  L++ E+V D WF SG  
Sbjct: 503 YEEVVCVGSVQELKDLSGVQTIEDLHRDSIDGITIPSKKGKGVLKRIEEVFDCWFESGSM 562

Query: 625 PFSTLGWPDKTPD-MSQFYPASMLETGWDILFFWVSRMILLGLKLTGSIPFKEVFCHSLV 683
           P+S+  +P +  D   +  PA+ +  G D    W   + +LG +L G +P++ V    +V
Sbjct: 563 PYSSQHYPFENQDKFKERVPANFISEGLDQTRGWFYTLGVLGSQLFGQVPYQNVIVCGIV 622

Query: 684 RDAQGRKMSKSLGNVVDPLDVISGIKLEDLHAKLLQGNLDPREVEKAKNGQKESYPHGIP 743
             A G+KMSKSL N  DP  V+     + L   L+   +   E  K K         G+ 
Sbjct: 623 LAADGKKMSKSLKNYPDPNLVLDKYGADALRLYLINSPVLKAESLKFKE-------DGVK 675

Query: 744 ECGTDALRFALCAYTTGGRDINLDILRVEGYRKFCNKIYQATKFALLRLGDDYKPPASEA 803
           E  +  L     ++      I+L        +K  N  ++            Y P     
Sbjct: 676 EVVSKVLLPWWNSFKFLDGQISL-------LKKTSNIDFK------------YDPTIK-- 714

Query: 804 LSGNESLVEKWILHELTETAKNVNEAFEKRDFLNSTSAIYEFWYLVCDVYIE-NSKYLIQ 862
              +++++++WIL  L    KN++   +          + +F   + + YI  N + L  
Sbjct: 715 ---SDNVMDRWILASLQTLVKNIHAEMKSYKLYAVVPRLLDFIDQLTNWYIRLNRRRLKG 771

Query: 863 EGTEVQQKSAKDTLYILIDNALKMIHPFMPFISEEMWQHLPRYASET--------SPTIV 914
           E  E    +A ++L+  +   +  + PF PF+S+ ++Q +  Y  E         S ++ 
Sbjct: 772 ENGEQDCLNALNSLFDALFTFVCAMAPFTPFLSDNIYQRMKEYIPENVLSTFGPDSRSVH 831

Query: 915 KSSYPTFKEEFHN 927
             SYP   E+  +
Sbjct: 832 FLSYPVVDEKLFD 844

>KLLA0E20625g 1825036..1828257 highly similar to sp|P09436
           Saccharomyces cerevisiae YBL076c ILS1 isoleucyl-tRNA
           synthetase, start by similarity
          Length = 1073

 Score =  163 bits (412), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 204/933 (21%), Positives = 373/933 (39%), Gaps = 164/933 (17%)

Query: 147 WWNKSGFFEP--EFTKDGKIKPEGVFTIPAPPPNVTGSLHIGHALTIAIQDSLCRYYRMK 204
           +WN+   F    + T+D   KPE  F+    PP  TG+ H GH L   ++D + RY  M 
Sbjct: 21  FWNEIDAFHTSLKLTED---KPE--FSFFDGPPFATGTPHYGHLLASTVKDIVPRYATMT 75

Query: 205 GKTVLFLPGFDHAGIATQSVVEKQIWASEKKTRHDYGREEFVDKVWEWKEEYHKKIKNQV 264
           G  V    G+D  G+  + +++K++  + K+  + +G + + ++       Y ++ +  +
Sbjct: 76  GHHVERRFGWDTHGLPIEHIIDKKLNITCKEDVYAFGIDNYNNECRAIVSTYAEEWRKTI 135

Query: 265 KKLGASYDWSREAFTLDPKLSKAVVEAFVKLHEEGIIYRAARLVNWSVKLNTAISNLEVE 324
            +LG   D+  +  T+ P   +++  AF +L ++  +YR  +++ +S    T +SN E +
Sbjct: 136 GRLGRWIDFDDDYKTMYPTFMESIWWAFKELFDKDQVYRGYKVMPYSTGCTTPLSNFEAQ 195

Query: 325 N--KDIKGKTLLSVPGYDEKVEFGVLTSFSYPVVGSDE-KLIVATTRPETMFGDTAVAIH 381
              KD+    +                + ++ V+G ++ KL+  TT P T+  + A+ ++
Sbjct: 196 QNYKDVNDPAI----------------TIAFNVIGQEKTKLVAWTTTPWTLPSNLALCVN 239

Query: 382 PDDE----------------------------------------------RYKHLHGHFV 395
           P+ E                                              +Y+ L  +FV
Sbjct: 240 PEFEYVKIYDENKDTYFILLESLIKTLYKKPAQEKYKVVEKIKGKDLVGLKYEPLFPYFV 299

Query: 396 QHPFLNRKMPIVCDAEAVDMEFGTGAVKITPAHDQNDYNTGLRHNL-----EVINTFTDD 450
              + +    ++ D+  V  + GTG V   PA  ++D    L H +        N   D 
Sbjct: 300 DE-YKDTGFRVLGDS-YVSNDSGTGIVHQAPAFGEDDNRVCLEHGVIREDTPAPNPIDDV 357

Query: 451 GLLNENCGPEWEGTRRFDARKLVIEKLKEKGLFVGQKDNEMTIPTCSRSGDIIEPLLKPQ 510
           G   +    ++ G    DA K +I+KL   G  +       + P C RS   +     P 
Sbjct: 358 GKFTKEVS-DFTGMYVKDADKEIIKKLLASGHILLNSQIRHSYPFCWRSDTPLIYRTVPA 416

Query: 511 WWVSQKQMAEEAIKVVRNGEITITPKSSESEYFHWLENIQDWCISRQLWWGHRCPVY--- 567
           W+V  K +  + ++ V+      T    E  + +W+ N +DW +SR  +WG   P++   
Sbjct: 417 WFVRVKTIIPQFLESVKKSNWVPT-VIKEKRFSNWIANARDWNVSRNRYWGTPIPLWVSE 475

Query: 568 ----FVNIEGEENDRNDNSFWVSGRNLXXXXXXXXXXXXXXXYTLEQDEDVLDTWFSSGL 623
                V I   E  R  +                          L + E+V D WF SG 
Sbjct: 476 DYEEMVCIGSVEELRELSGVQDITDLHRDSIDNITIPSKKGKGVLRRIEEVFDCWFESGS 535

Query: 624 YPFSTLGWP-DKTPDMSQFYPASMLETGWDILFFWVSRMILLGLKLTGSIPFKEVFCHSL 682
            P+++  +P + T   SQ  PA+ +  G D    W   + +LG  L G +P++ V    +
Sbjct: 536 MPYASQHYPFENTEKFSQRVPANFISEGLDQTRGWFYTLGVLGTHLFGEVPYRNVIVSGI 595

Query: 683 VRDAQGRKMSKSLGNVVDPLDVISGIKLEDLHAKLLQGNLDPREVEKAKNGQKESYPHGI 742
           V  A G+KMSKSL N  DP  V+                              E Y    
Sbjct: 596 VLAADGKKMSKSLKNFPDPNIVL------------------------------EKY---- 621

Query: 743 PECGTDALRFALCAYTTGGRDINLDILRV-------EGYRKFCNKI----YQATKF---- 787
              G+DALR  L         IN  +L+        EG ++  +K+    + + KF    
Sbjct: 622 ---GSDALRLYL---------INSPVLKAESLKFKEEGVKEVVSKVLLPWWNSFKFLDGQ 669

Query: 788 -ALLRLGDDYKPPASEALSGNESLVEKWILHELTETAKNVNEAFEKRDFLNSTSAIYEFW 846
            ALL+   D     +  L  +++++++WIL  L      +++             + +F 
Sbjct: 670 IALLKKNSDVDFKYNPHLK-SDNVMDRWILASLQSLVAYIHQEMSTYKLYTVVPRLLDFI 728

Query: 847 YLVCDVYIE-NSKYLIQEGTEVQQKSAKDTLYILIDNALKMIHPFMPFISEEMWQHLPRY 905
             + + YI  N + L  EG       A +TL+  +   ++ + PF PF+S+ ++  L  +
Sbjct: 729 DELTNWYIRFNRRRLKGEGGVEDCLKALNTLFDALFTFVRAMAPFTPFLSDNIYSKLRPF 788

Query: 906 A--------SETSPTIVKSSYPTFKEEFHNPSAAKEYELILNVTKDARSLLAQYNI-LKN 956
                    S+ S ++   SYP   E+ ++    K  + + +V    R++  +  I LK 
Sbjct: 789 IPEEVLAQYSKDSRSVHFLSYPEVNEDLYDEDIEKAVKRMQSVIDLGRNIREKKTISLKT 848

Query: 957 --GKVFVESANESYYSTVQSQKDSIVSLIKAID 987
               + +  +N  Y   +++ K  IV  +   D
Sbjct: 849 PLKTLVILHSNPDYLKDIEALKKYIVEELNVRD 881

>CAGL0L12606g 1353211..1356159 similar to sp|P48526 Saccharomyces
           cerevisiae YPL040c isoleucine--tRNA ligase,
           mitochondrial, hypothetical start
          Length = 982

 Score =  154 bits (388), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 201/938 (21%), Positives = 356/938 (37%), Gaps = 153/938 (16%)

Query: 152 GFFEPEFTKDGKIKPEGVFTIPAPPPNVTGSLHIGHALTIAIQDSLCRYYRMKGKTVLFL 211
           G  E E  K   ++ E +F +   PP   G LH+GHAL   ++D + R+   +GKTV + 
Sbjct: 58  GAVEGEDEKLAAVR-ERLFVLHDGPPYANGDLHLGHALNKILKDFVNRFQLSQGKTVYYR 116

Query: 212 PGFDHAGIATQSVVEKQIWASEK----KTRHDYGREEFVDKVWEWKEEYHKKIKNQVKKL 267
           PG+D  G+  +    K +  ++K    K R +  R+  +  +         K ++Q KK 
Sbjct: 117 PGWDCHGLPIEMKALKDLRDADKMDSVKVR-ELARQHALRSL--------DKQRDQFKKY 167

Query: 268 GASYDWSREAFTLDPKLSKAVVEAFVKLHEEGIIYRAARLVNWSVKLNTAI--SNLEVEN 325
           G   DWS    T+D       ++ F K+   G+I R  + V W     TA+  S LE   
Sbjct: 168 GILTDWSDPYVTMDKSFEVNQLKVFQKMFNMGLIKRQNKPVYWGTVTKTALAESELEYNE 227

Query: 326 KDIKGKTLLSVP-GYDEKVEFGVLTSFSYPVVGSDEKLIVATTRPETMFGDTAVAIHPD- 383
           K +     +  P   D +            +       ++ T+ P T+F + A+  + + 
Sbjct: 228 KHVSTAAYVKFPLTADSRAHLQDKLKLENELQNDQISCLIWTSTPWTLFSNRAICFNENF 287

Query: 384 -------DERY-------------------------KHLHGHFVQHPFLNRKM--PIVCD 409
                  D  Y                         K L G F  +P ++  +  P++  
Sbjct: 288 SYSLLQLDGSYVIVENNLINQLGSDHKGEILKTFEGKLLKGLFYYNPLVSDIVARPLIHG 347

Query: 410 AEAVDMEFGTGAVKITPAHDQNDYNTGLRHNLEVINTFTDDG--LLNE---NC------G 458
               D   GTG V   P H  +DY  G+ ++LE+ +    +G  +LNE   NC      G
Sbjct: 348 DHVTD-NAGTGLVHTAPGHGHDDYFLGIENDLEIYSPVDHEGRYILNELPDNCKELLMEG 406

Query: 459 PEWEGTRRFDARK--LVIEKLKEKGLFVGQKDNEMTIPTCSRSGDIIEPLLKPQWWVSQK 516
               G +  D+    ++++ L +K   +       + P   R+   +     PQW+    
Sbjct: 407 GTGLGRKVLDSETTTVILDLLSKKQALLKAHKYTHSYPYDWRAKTPVIIRATPQWFADLH 466

Query: 517 QMAEEAIKVVRNGEITITPKSSESEYFHWLENIQDWCISRQLWWGHRCPVYFVNIEGEEN 576
            + + AIK +   ++   PK  E+    ++++  +WCISRQ  WG   PV+        N
Sbjct: 467 DVKDLAIKSLE--KVEFYPKRGENRLSSFIKSRNEWCISRQRSWGVPIPVF-------HN 517

Query: 577 DRNDNSFWVSGRNLXXXXXXXXXXXXXXXYTLEQD-------------------EDVLDT 617
             N +   ++   L               ++ E D                    D +D 
Sbjct: 518 KSNPDKVLINDELLEYIITRISKHGSDLWFSPEDDISDWFPENYRTMAKDFIKGTDTMDV 577

Query: 618 WFSSGL-------YPFSTLGWPDKTPDMSQFY-PASMLETGWDILFFWVSRMILLGLKLT 669
           WF SG        +    LG       ++  Y   S    GW    F  S +  +   ++
Sbjct: 578 WFDSGSTWNIIREFYQKELGLSTVPQPLANVYLEGSDQHRGW----FQSSLLTKVACSMS 633

Query: 670 GSIPFKEVFCHSLVRDAQGRKMSKSLGNVVDPLDVISGIKLEDLHAKLLQGNLDPREVEK 729
              P+ EV  H    D +G KMSKS+GN + P  +I G                    +K
Sbjct: 634 EIAPYNEVITHGFTLDEKGIKMSKSIGNTISPESIIEG--------------------DK 673

Query: 730 AKNGQKESYPHGIPECGTDALRFALCAYTTGGRDINLDILRVEGYRKFCNKIYQATKFAL 789
            +N         +P  G D LR     Y     D   D+       K   +  +  +  +
Sbjct: 674 KRN---------LPALGIDGLR-----YFVAQADFTTDVTVGPTVLKHVAEALKKCRLTM 719

Query: 790 LRLGDDYKPPASEALSGNESL--VEKWILHELTETAKNVNEAFEKRDFLNSTSAI-YEFW 846
             L  + +     +L     L  V+K++L  + +  +   E ++  +F  +  A+ +   
Sbjct: 720 RFLISNLEISKRYSLLNTSELRPVDKYVLASVNKLLEETKELYKVHNFSKALVALQFHMN 779

Query: 847 YLVCDVYIENSK-YLIQEGTE-VQQKSAKDTLYILIDNALKMIHPFMPFISEEMWQHLPR 904
             +   Y + SK  L  +  E ++++  + TL+ + D    M+ P +P + +E W  LP+
Sbjct: 780 NELSSFYFDISKDSLYSDSIESLKRRQIQTTLFHIYDAYRAMLAPILPILVQESWNFLPK 839

Query: 905 --YASETSPTIVKSSYPTFKEEFHNPSAAKEY-ELILNVTKDARSLLAQYNILKNGKVFV 961
                +     V   +P+  E   NP    E+ ++IL + K+ +S   ++  L N  +  
Sbjct: 840 QWLNGDNEAEAVTRKWPSLTEI--NPEVVNEFKQVILPLVKEYKS---KFATLGNPSITK 894

Query: 962 ESANESYYSTVQSQKDSIVSLIKAIDEVSVVKSAADIP 999
            S  ++  +  +S   S   L   +    V  +  D+P
Sbjct: 895 PSQTKAIINCSKSTGYSNEELCDVLQTAEVDVNIGDMP 932

>AER394W [2894] [Homologous to ScYBL076C (ILS1) - SH]
           complement(1386794..1390012) [3219 bp, 1072 aa]
          Length = 1072

 Score =  154 bits (388), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 204/915 (22%), Positives = 365/915 (39%), Gaps = 159/915 (17%)

Query: 165 KPEGVFTIPAPPPNVTGSLHIGHALTIAIQDSLCRYYRMKGKTVLFLPGFDHAGIATQSV 224
           +PE  F+    PP  TG+ H GH L   ++D + RY  M G  V    G+D  G+  + +
Sbjct: 37  RPE--FSFFDGPPFATGTPHYGHILASTVKDIVPRYATMNGYHVERRFGWDTHGLPIEHI 94

Query: 225 VEKQIWASEKKTRHDYGREEFVDKVWEWKEEYHKKIKNQVKKLGASYDWSREAFTLDPKL 284
           ++K++  + K+  + +G E + ++       Y  + +  + +LG   D+  +  T+ P  
Sbjct: 95  IDKKLNITCKEDVYKFGIENYNNECRAIIMTYADEWRKTIGRLGRWIDFDNDYKTMYPSF 154

Query: 285 SKAVVEAFVKLHEEGIIYRAARLVNWSVKLNTAISNLEVENKDIKGKTLLSVPGYDEKVE 344
            ++V  AF +L+E+  +YR  R++ +S    T +SN E +              Y E  +
Sbjct: 155 MESVWWAFKQLYEKEQVYRGYRVMPYSTGCTTPLSNFEAQQ------------NYKEVND 202

Query: 345 FGVLTSFSYPVVGSDEKLIVA-TTRPETMFGDTAVAIHPDDE----------RYKHLHGH 393
             V   F+  VVG +    VA TT P T+  + A+ ++P+ E          RY  L   
Sbjct: 203 PAVTIGFN--VVGEENTQFVAWTTTPWTLPSNLALCVNPEFEYVKIYDEKKDRYFILMES 260

Query: 394 FVQHPF---LNRKMPIVCDAEAVDM--------------EFGTGAVK-ITPAHDQNDYNT 435
            ++  +      K  +V      D+              E+GT A + I+ ++  ND  T
Sbjct: 261 LLKSLYKKPAAEKYKVVERYTGKDLVGMKYEPLFPYFKEEYGTQAYRVISDSYVTNDSGT 320

Query: 436 GLRHNLEVIN-----TFTDDGLLNENCG---------------PEWEGTRRFDARKLVIE 475
           G+ HN              +G++NE+                  ++ G    DA K +I+
Sbjct: 321 GIVHNAPAFGEDDYRVCLANGIINEDSTLPNPVDDSGKFTSEVTDFSGKYVKDADKEIIK 380

Query: 476 KLKEKGLFVGQKDNEMTIPTCSRSGDIIEPLLKPQWWVSQKQMAEEAIKVVRNGEITITP 535
            L      +       + P C RS   +     P W+V  K +  + ++ V+      T 
Sbjct: 381 HLTATSNLLLATQVRHSYPFCWRSDTPLIYRSVPAWFVRVKPIIPQFLESVKKSNWVPT- 439

Query: 536 KSSESEYFHWLENIQDWCISRQLWWGHRCPVYF------VNIEGEENDRNDNSFWVSGRN 589
              E  +  W+ N +DW ISR  +WG   P++       +   G   +  + S  VSG +
Sbjct: 440 VIKEKRFATWIANARDWNISRNRYWGTPIPLWVSDDFDEIVCVGSIAELEELS-GVSGIS 498

Query: 590 --LXXXXXXXXXXXXXXXYTLEQDEDVLDTWFSSGLYPFSTLGWP-DKTPDMSQFYPASM 646
                               L + E+V D WF SG  P+++  +P + T   +Q  PA+ 
Sbjct: 499 DLHRDTVDKITIPSKKGKGELRRIEEVFDCWFESGSMPYASQHYPFENTEKFAQRVPANF 558

Query: 647 LETGWDILFFWVSRMILLGLKLTGSIPFKEVFCHSLVRDAQGRKMSKSLGNVVDPLDVIS 706
           +  G D    W   + +LG +L G +P++ V    +V  A G+KMSKSL N  DP  VI 
Sbjct: 559 ISEGLDQTRGWFYTLGVLGTQLFGHVPYQNVIVSGIVLAADGKKMSKSLKNYPDPNIVID 618

Query: 707 GIKLEDLHAKLLQGNLDPREVEKAKNGQKESYPHGIPECGTDALRFALCAYTTGGRDINL 766
                                                + G+DALR  L         IN 
Sbjct: 619 -------------------------------------KYGSDALRLYL---------INS 632

Query: 767 DILRV-------EGYRKFCNKI----YQATKF-----ALLR----LGDDYKPPASEALSG 806
            +LR        EG ++  +K+    + + KF     ALL+    +   Y P        
Sbjct: 633 PVLRAESLKFKEEGVKEVVSKVLLPWWNSFKFLEGQIALLKKTSSVDFKYDPNVR----- 687

Query: 807 NESLVEKWILHELTETAKNVNEAFEKRDFLNSTSAIYEFWYLVCDVYIE-NSKYLIQEGT 865
           +++++++W+L  L    K ++   +     +    + +F   + + YI  N + L  E  
Sbjct: 688 SDNVMDRWVLASLQSLIKYIHVEMKAYKLYSVVPRLLDFIDELTNWYIRFNRRRLKGEDG 747

Query: 866 EVQQKSAKDTLYILIDNALKMIHPFMPFISEEMWQHLPRYA--------SETSPTIVKSS 917
                +A +TL+  +   ++ + PF PF+SE ++  L  Y          E   ++    
Sbjct: 748 MEDCINALNTLFEALFTFVRAMAPFTPFLSETIYLRLREYIPKDILDHFGENHESVHFLR 807

Query: 918 YPTFKEEFHNPSAAKEYELILNVTKDARSLLAQYNI-LKN--GKVFVESANESYYSTVQS 974
           YP  KE   + +  +    +  V +  R++  +  I LK     + +  +++ Y   +++
Sbjct: 808 YPVAKEHLFDDAIERSVGRMQTVIELGRNIREKKTISLKTPLKTLIILHSDQQYLEDIKA 867

Query: 975 QKDSIVSLIKAIDEV 989
            K  I   +   D V
Sbjct: 868 LKKYIFEELNVRDLV 882

>Scas_568.3
          Length = 1001

 Score =  146 bits (368), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 168/826 (20%), Positives = 326/826 (39%), Gaps = 138/826 (16%)

Query: 167 EGVFTIPAPPPNVTGSLHIGHALTIAIQDSLCRYYRMKGKTVLFLPGFDHAGI-----AT 221
           E +F +   PP   G LH+GHAL   ++D + RY    GK V + PG+D  G+       
Sbjct: 79  ENLFILHDGPPYANGDLHLGHALNKILKDIIVRYQYSSGKYVFYKPGWDCHGLPIELKVL 138

Query: 222 QSVVEKQIWASEKKTRHDYGREEFVDKVWEWKEEYHKKIKNQVKKLGASYDWSREAFTLD 281
           +S+ +K I     +      R+  +  +   ++++H        +     DW+    T+D
Sbjct: 139 KSLPKKDIETISPEKIRSMARKHALTAIDHQRKQFH--------QFAIFTDWNDPYITMD 190

Query: 282 PKLSKAVVEAFVKLHEEGIIYRAARLVNWSVKLNTAISNLEVE-NKDIKGKTLLSVPGYD 340
            K     ++ F K++ EG+I R  + V W  +  TA++  E+E NK  +  +        
Sbjct: 191 KKFEIDQLKIFQKMYHEGLILRQNKPVFWGTETKTALAESELEYNKSHESTSAYVKFPLT 250

Query: 341 EKVEFGVLTSFSY----PVVGSDEKLIVATTRPETMFGDTAVAIH--------------- 381
           ++    ++ + +     PV  S    ++ T+ P T+F + A+  +               
Sbjct: 251 KQSSLQLIENLNIVQDTPVTIS---CLIWTSTPWTLFSNRAICFNQNFSYSLVKLVDNNN 307

Query: 382 ---------------PDDERYKHLHGHFV-----QHPFLNRKMPI-VCDAEAVDMEFGTG 420
                          P+ +  K   G  +     ++P  + + P+ +     V  + GTG
Sbjct: 308 EFILVESNLLIQLNIPNYDIVKTFSGELLTNLKYENPLFSEEEPLPLLHGTHVTNDTGTG 367

Query: 421 AVKITPAHDQNDYNTGLRHNLEVINTFTDDG-------------LLNENCGPEWEGTRRF 467
            V   P H  +DY  G+R+NL + +    +G             LL +   P   G    
Sbjct: 368 LVHTAPGHGPDDYLVGIRNNLPIYSPVDHEGRYNLSELPSSTHKLLTDPDAPGNTGRYVL 427

Query: 468 DARK--LVIEKLKEKGLFVGQKDNEMTIPTCSRSGDIIEPLLKPQWWVSQKQMAEEAIKV 525
           D +   ++IEKLKE  +    K    + P   RS   +     PQW+++  +M + A++ 
Sbjct: 428 DPKTTLIIIEKLKELNMLFRSKKYTHSYPYDWRSKKPVIIRATPQWFLNLAKMKQLAVES 487

Query: 526 VRNGEITITPKSSESEYFHWLENIQDWCISRQLWWGHRCPVYF--------------VNI 571
           + N ++   P+  ++    +++N  +WCISRQ  WG   P ++              +N 
Sbjct: 488 L-NDKVNFFPERGKTRLLSFIKNRNEWCISRQRAWGVPIPAFYRIENSDEVLMNEEIINH 546

Query: 572 EGEENDRNDNSFWVSGRNLXXXXXXXXXXXXXXXYTLEQDEDVLDTWFSSG-------LY 624
             +  + N    W    +                +   +  D +D WF SG        +
Sbjct: 547 VIKTIESNGIDKWFDQYS-SPTEEWLPESYKNVAHEYRRGTDTMDVWFDSGSSWKVIESF 605

Query: 625 PFSTLGWPDKTPDMSQFYPASMLETGWDILFFWVSRMILLGLKLT--GSIPFKEVFCHSL 682
              TL   + +   S  +  ++   G D    W   ++L  +  +     P++ +  H  
Sbjct: 606 YHDTLKIRNGSVLPSPLFDVAL--EGSDQHRGWFQSLLLTKVAYSKVAEAPYRNIITHGF 663

Query: 683 VRDAQGRKMSKSLGNVVDPLDVISGIKLEDLHAKLLQGNLDPREVEKAKNGQKESYPHGI 742
             D +G KMSKS+GN + P DVI G               +P                G+
Sbjct: 664 TLDEKGIKMSKSIGNTISPTDVIQG---------------NPAR--------------GL 694

Query: 743 PECGTDALRFALCAYTTGGRDINLDILRVEGYRKFCNKIYQATKFALLRL--GDDYKPPA 800
              G D LR+ + A++   +D+ +    ++   +   KI    +F L  L     ++P A
Sbjct: 695 IPLGIDGLRYYV-AHSNFTKDLVVGANIMKRVSESLKKIRITFRFLLSNLEKSGTFEPLA 753

Query: 801 SEALSGNESLVEKWILHELTETAKNVNEAFEKRDFLNSTSAI-YEFWYLVCDVYIENSKY 859
            E L      V+++I+  L +      E+++  +F    + + +     +   Y ++SK 
Sbjct: 754 VEELRP----VDQYIISTLQKLLAESKESYQSYNFSKILTTLQHHLSSELSAFYFDSSKD 809

Query: 860 LIQEG--TEVQQKSAKDTLYILIDNALKMIHPFMPFISEEMWQHLP 903
            +     T  ++K  +  L  ++     +++P +P + +E+  ++P
Sbjct: 810 SLYSDSITSEKRKQIQTVLLYVLQTYSTILNPILPTLIQEVRNYIP 855

>AGL247C [4065] [Homologous to ScYPL040C (ISM1) - SH]
           (237045..240011) [2967 bp, 988 aa]
          Length = 988

 Score =  146 bits (368), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 184/853 (21%), Positives = 310/853 (36%), Gaps = 145/853 (16%)

Query: 156 PEFTKDGKIKPEGVFTIPAPPPNVTGSLHIGHALTIAIQDSLCRYYRMKGKTVLFLPGFD 215
           P+ T       + VF +   PP   G LH+GHA+   ++D + RY   KG+ V + PG+D
Sbjct: 61  PDDTDKANFVRDRVFVLHDGPPYANGDLHVGHAMNKILKDIMSRYQLTKGRYVFYRPGWD 120

Query: 216 HAGIATQSVVEKQIWASEKKTRHDYGREEFVDKVWEWKEEYHKKIKNQVKKLGASYDWSR 275
             G+     +E +   S          ++      +  E      + Q ++ G   DW  
Sbjct: 121 CHGLP----IELKALRSLDYDTAAISPQQVRAMAAQHAEGAIAAQRKQFQQFGILTDWQD 176

Query: 276 EAFTLDPKLSKAVVEAFVKLHEEGIIYRAARLVNWSVKLNTAISNLEVENKD--IKGKTL 333
              T+DP      +     +   G+I R  + V W  +  TA++  E+E +D  I     
Sbjct: 177 TYRTMDPGYEIQQLRLLQGIFARGLIRRQRKPVYWGTETRTALAEGELEYRDDHISKAAY 236

Query: 334 LSVP---GYDEKVEFGVLTSF-SYPVVGSDEKLIVATTRPETMFGDTAVAIHPDDE---- 385
           +  P   G    +   + TS    P+V      ++ T+ P T+  + A+  H D      
Sbjct: 237 VYFPLTEGASATLRERLGTSLPEQPIV-----CLIWTSTPWTLLSNRAICFHDDHAYLLL 291

Query: 386 ------------------------------RYKHLHGHFVQHPFLNRKM--PIVCDAEAV 413
                                         R   L G +  +P L   +  P++   + V
Sbjct: 292 QWKGMLVVAERTELADFKWSGDTPVVVTSFRGSDLRGLYYTNPLLGDAVSRPLL-HGDHV 350

Query: 414 DMEFGTGAVKITPAHDQNDYNTGLRHNLEVINTFTDDG-------------LLNENCGPE 460
             + GTG V   P H Q DY  G  H +EV +    +G             +L E  G  
Sbjct: 351 TADTGTGLVHTAPGHGQEDYLVGQAHGIEVYSPVDHEGRYILDDIPPHLRDMLREESGKP 410

Query: 461 WEGTRRFDARKLVIEKLKEKGLFVGQKDNEMTIPTCSRSGDIIEPLLKPQWWVSQKQMAE 520
            + T +  A  ++I+ L+E  + +   +   + P   RS   +     PQW+     M  
Sbjct: 411 LKVTDQKTA-GVIIKLLEEHKMLLHSHEYTHSYPYDWRSKKPVILRATPQWFADLSDMKH 469

Query: 521 EAIKVVRNGEITITPKSSESEYFHWLENIQDWCISRQLWWGHRCPVYFVNIEGEENDRND 580
            A++ + N E    P   +     ++++  +WCISRQ  WG   P   +    +E   N+
Sbjct: 470 HAVESLENVEFF--PARGKKRLEAFIKSRNEWCISRQRSWGVPIPALHLRSNPDEVLLNN 527

Query: 581 NSF--------------WVSGRNLXXXXXXXXXXXXXXXYTLEQDEDVLDTWFSSGL--- 623
            +               W    N                +   +  D +D WF SG    
Sbjct: 528 ETLAHIIETISKVGINSWFEESNAENMKQWLPEKYHDVAHLYYRGRDTIDVWFDSGSSWN 587

Query: 624 ----YPFSTLGWPDKTPDMSQFYPASMLETGWDILFFWVSRMILLGLKLTGSI--PFKEV 677
               +   TLG       ++  Y    LE G D    W    +L  +  +G++  PF ++
Sbjct: 588 LLEKWYTETLGLKKPLQPLADVY----LE-GSDQHRGWFQSSLLTKVAASGTVGAPFGKI 642

Query: 678 FCHSLVRDAQGRKMSKSLGNVVDPLDVISG-IKLEDLHAKLLQGNLDPREVEKAKNGQKE 736
             H    D  G KMSKSLGN + P  +I G  KL+                         
Sbjct: 643 VTHGFTLDEAGLKMSKSLGNTIAPSSIIEGDQKLQ------------------------- 677

Query: 737 SYPHGIPECGTDALRFALCAYTTGGRDINLDILRVEGYRKFCNKIYQATKFALLRLGDDY 796
                +P  G D LR  L A     +D+    L          K+    +F L  L D  
Sbjct: 678 -----LPRLGVDGLRL-LVAQADFTKDVAFGPLIARHVADSLKKVRLTFRFILGNLQD-- 729

Query: 797 KPPASEALSGNESL----------VEKWILHELTETAKNVNEAFEKRDFLNSTSAIYEFW 846
             P+  +     SL          ++ +IL +  +        +E +++ N  S +    
Sbjct: 730 -CPSVASAGEQASLAPGDCAQLRRIDWYILDKTQKLTAKCQGLYESQNYSNVISLVLYHM 788

Query: 847 YLVCDVYIENSK-YLIQEGTEVQQKSA-KDTLYILIDNALKMIHPFMPFISEEMWQHLPR 904
                +Y + SK  L  E    +++ A + TL+ ++D    ++ P MP + +E W  LPR
Sbjct: 789 SNDLSLYFDASKDTLYMEPPHNKRRLAIQTTLFHILDAYRSILGPIMPALVQEAWNCLPR 848

Query: 905 --YASETSPTIVK 915
                +T+P + +
Sbjct: 849 EWLRGDTTPALRR 861

>KLLA0D11858g complement(1010259..1013231) similar to sp|P48526
           Saccharomyces cerevisiae YPL040c ISM1 isoleucine--tRNA
           ligase, mitochondrial, start by similarity
          Length = 990

 Score =  137 bits (346), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 172/814 (21%), Positives = 306/814 (37%), Gaps = 127/814 (15%)

Query: 167 EGVFTIPAPPPNVTGSLHIGHALTIAIQDSLCRYYRMKGKTVLFLPGFDHAGIATQSVVE 226
           E VF +   PP   G LH+GHAL   ++D + R+  + GK V+++PG+D  G+  +    
Sbjct: 77  ENVFILHDGPPYANGDLHLGHALNKILKDIINRFQLLNGKHVVYIPGWDCHGLPIELKAL 136

Query: 227 KQIWASEKKTRHDYGREEFVDKVWEWKEEYHKKIKNQVKKLGASYDWSREAFTLDPKLSK 286
            ++  +++  R    +   + +    K    K  + Q ++ G   +W     T+DPK   
Sbjct: 137 NKL--NDQLDRISPTKIRSIARAHAQKTI--KSQRQQFEQFGILTNWDTNYVTMDPKFEI 192

Query: 287 AVVEAFVKLHEEGIIYRAARLVNWSVKLNTAISNLEVENKDIKGKTLLSVPGYDEKVEFG 346
             +  F +L  + +I R  + V W  +  TA++  E+E K+      +S+  Y   V+F 
Sbjct: 193 NQLSVFQELFRKKLIKRQRKPVYWGTETKTALAEGELEYKEDH----ISIAAY---VKFP 245

Query: 347 VLTSFSYPVVGSDE---KLIVATTRPETMFGDTAVAIHPD-------------------- 383
            LT  S  V+G  E     ++ T+ P T+  + A+  +                      
Sbjct: 246 -LTEESKSVLGFPEAPVSFLIWTSTPWTLLSNRAICFNQSLDYVLIKHNGEYMIVEKNLA 304

Query: 384 --------DERYKHLHGHFVQHPFLNRKMPIVCD--------AEAVDMEFGTGAVKITPA 427
                    E  K L G+F+ H  L    PI+ D         + V    GTG V   P 
Sbjct: 305 DKLDFLSGFELVKDLDGNFLSH--LKYTNPILKDNVTRPLFHGDHVTSVTGTGLVHTAPG 362

Query: 428 HDQNDYNTGLRHNLEVINTFTDDG-------------LLNENCGPEWEGTRRFDARKLVI 474
           H   DY  G+++ LE+ +    +G             LL E  G   +   R    K ++
Sbjct: 363 HGHEDYIIGIQNFLEIFSPVDHEGRYNVEELPAHLRDLLKEESGKGRKVLDRTTTEK-IL 421

Query: 475 EKLKEKGLFVGQKDNEMTIPTCSRSGDIIEPLLKPQWWVSQKQMAEEAIKVVRNGEITIT 534
             LK + + +   +   + P   RS   I     PQW+     +   A++ +    +   
Sbjct: 422 SVLKGENMLMHHHEYVHSYPYDWRSKKPIIIRATPQWFADLHDVKTLALRALET--VKFV 479

Query: 535 PKSSESEYFHWLENIQDWCISRQLWWGHRCPVYFVNIEGEENDRNDNSF----------- 583
           P+   +    +++   +WCISRQ +WG   P      + +    N+ +            
Sbjct: 480 PERGINRLSSFIKTRNEWCISRQRYWGVPIPSLHKRDDPDSVLMNEETISHIIKTIESKG 539

Query: 584 ---WVSGRNLXXXXXXXXXXXXXXXYTLEQDEDVLDTWFSSGLYPFSTLGWPDKTPDMSQ 640
              W +   +               +   +  D +D WF SG        W      +  
Sbjct: 540 VNSWFAESTVDSMYQWLPKKYHDIAHEYYRGTDTVDVWFDSGSSWNVIADWYKNVAGLQS 599

Query: 641 FYPASMLET---GWDILFFWVSRMILLGLKLTG--SIPFKEVFCHSLVRDAQGRKMSKSL 695
             P  + +    G D    W    +L  +  +G    P+K V  H    D  G KMSKS+
Sbjct: 600 QLPVPLADIYLEGSDQHRGWFQSSLLTKVASSGMPDAPYKNVITHGFTLDENGIKMSKSI 659

Query: 696 GNVVDPLDVISGIKLEDLHAKLLQGNLDPREVEKAKNGQKESYPHGIPECGTDALRFALC 755
           GN + P  +I G               DP+                +P  G D LR  L 
Sbjct: 660 GNTISPGAIIKG---------------DPKA--------------NLPALGVDGLRL-LV 689

Query: 756 AYTTGGRDINLDILRVEGYRKFCNKIYQATKFALLRLGDDYKPPASEALSGNESL--VEK 813
           A +    D+      ++       K     KF L  L +      S  L     L  V++
Sbjct: 690 AQSNFTSDVVAGPTVMKHVADALKKFRLTFKFILGNLQET----QSHGLIPFSELRRVDQ 745

Query: 814 WILHELTETAKNVNEAFEKRDFLNSTSAI-YEFWYLVCDVYIENSKYLIQEGTEVQQK-- 870
           + L  L   ++   + +++ +F N  + + Y     +  +Y   +K  +   +   +K  
Sbjct: 746 YTLLNLKALSQETKKLYQQYNFSNVLTQVQYHMNNDLSALYFSVTKDSLYSDSLNNKKRL 805

Query: 871 SAKDTLYILIDNALKMIHPFMPFISEEMWQHLPR 904
           S + TL+ ++D    ++ P +P + +E+W + P+
Sbjct: 806 SIQTTLFHILDTYRSIMSPIIPIMVQEVWNYTPK 839

>YPL040C (ISM1) [5399] chr16 complement(475988..478996)
           Isoleucyl-tRNA synthetase, mitochondrial [3009 bp, 1002
           aa]
          Length = 1002

 Score =  136 bits (342), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 188/872 (21%), Positives = 335/872 (38%), Gaps = 141/872 (16%)

Query: 126 SLDDPALKAYNPANVESSWYEWWNKSG----------FFEPEFTK----DGKIK--PEGV 169
           +L+ P  K  N +N+E +  E   KS           FFE EF+K    D K++   E +
Sbjct: 28  TLNLPKTKFPNRSNLEITLRELIPKSSQLVYKEQLRDFFE-EFSKLNTTDEKLEFIKEKL 86

Query: 170 FTIPAPPPNVTGSLHIGHALTIAIQDSLCRYYRMKGKTVLFLPGFDHAGIATQSVVEKQI 229
           F +   PP   G LH+GHAL   ++D + RY   +GK + + PG+D  G+  +    K +
Sbjct: 87  FILHDGPPYANGELHLGHALNKILKDIINRYQLSQGKYIFYKPGWDCHGLPIEIKALKDL 146

Query: 230 WASEKKTRHDYGREEFVDKVWEWKEEYHKKIKNQ---VKKLGASYDWSREAFTLDPKLSK 286
            A + ++           K         K IK Q    +      DW     T+D     
Sbjct: 147 SAQQIESISPLKIRSMALK------HAQKAIKRQRETFQHFAILTDWETPYLTMDKDYEI 200

Query: 287 AVVEAFVKLHEEGIIYRAARLVNWSVKLNTAISNLEVE----NKDIKGKT---LLSVPGY 339
             +  F +++E G+I R  + V W  +  TA++  E+E    +K I       L      
Sbjct: 201 NQLNIFKEMYERGLIKRQNKPVYWGTETRTALAEGELEYNENHKSIAAYVKFPLEKKSQM 260

Query: 340 DEKVEFGVLTS--------------------------FSYPVVGSDEKLIVATTRPETMF 373
           D   + G+  +                          FSY ++  + +LI+  T      
Sbjct: 261 DLCKKLGITNNLPIYCLIWTSTPWTLLSNRAICFNQDFSYSLLRLNSELILVETGSIDKL 320

Query: 374 GDTAVAIHPDDE-RYKHLHGHFVQHPFLNRKM--PIVCDAEAVDMEFGTGAVKITPAHDQ 430
           G T  +     + +  HL+G + Q+  ++ K+  P++  A  V    GTG V   P H Q
Sbjct: 321 GLTTNSFETIKQFQGTHLNGLYYQNLLVDDKVGRPLLHGAH-VTSGTGTGLVHTAPGHGQ 379

Query: 431 NDYNTGLRHNLEVINTFTDDGLLNENCGPE------------WEGTRRFDAR--KLVIEK 476
           +DY  G+++ LE+ +     G    N  P+             +G +  DA   K+++ K
Sbjct: 380 DDYLIGIQNGLEIYSPVDHQGRYQLNELPQSVRSIVRDEGDLTKGRQVLDAETAKIILCK 439

Query: 477 LKEKGLFVGQKDNEMTIPTCSRSGDIIEPLLKPQWWVSQKQMAEEAIKVVRNGEITITPK 536
           L +  L     +   + P   RS   +     PQW+     +   A++ +    +   PK
Sbjct: 440 LSDLNLLYKSHEYTHSYPYDWRSKKPVIIRATPQWFADLHDVKNLALESI--SRVKFCPK 497

Query: 537 SSESEYFHWLENIQDWCISRQLWWGHRCPVYFVNIEGEENDRND---------------N 581
              S    ++++  +WCISRQ  WG     ++   E +    N                N
Sbjct: 498 RGYSRLSSFMKSRNEWCISRQRSWGIPILSFYKKSEPDSVLMNSEILAHAIEKIKQKGIN 557

Query: 582 SFWVSGRNLXXXXXXXXXXXXXXXYTLEQDEDVLDTWFSSGLYPFSTLGWPDKTPDMSQF 641
           +++    N                Y   Q  D +D WF SG        + +K+  +S+ 
Sbjct: 558 AWFNDKDNDMKEWLPEKYHDVAHEYCRSQ--DTMDVWFDSGSSWSVIKDFYEKSLKLSKL 615

Query: 642 YPASMLET---GWDILFFWVSRMILLGLKLTG--SIPFKEVFCHSLVRDAQGRKMSKSLG 696
            P+ + +    G D    W    +L  +  +     P++EV  H    D  G KMSKS+G
Sbjct: 616 -PSPLYQVCLEGSDQHRGWFQSSLLTKVASSNVPVAPYEEVITHGFTLDENGLKMSKSVG 674

Query: 697 NVVDPLDVISGIKLEDLHAKLLQGNLDPREVEKAKNGQKESYPHGIPECGTDALRFALCA 756
           N + P  +I G             NL                  G+P  G D LR     
Sbjct: 675 NTISPEAIIRG-----------DENL------------------GLPALGVDGLR----- 700

Query: 757 YTTGGRDINLDILRVEGYRKFCNKIYQATKFALLRLGDDYKPPASEALSGNESL--VEKW 814
           Y     +   DI+      K   +  +  +     L  + +      L   E L  V+++
Sbjct: 701 YLIAQSNFTTDIVAGPTVMKHVGEALKKVRLTFRYLLSNLQKSQDFNLLPIEQLRRVDQY 760

Query: 815 ILHELTETAKNVNEAFEKRDFLNSTSAI-YEFWYLVCDVYIENSKYLI--QEGTEVQQKS 871
            L+++ E  +   E ++K +F      + Y     +   Y + SK ++   + + + ++ 
Sbjct: 761 TLYKINELLETTREHYQKYNFSKVLITLQYHLNNELSAFYFDISKDILYSNQISSLARRQ 820

Query: 872 AKDTLYILIDNALKMIHPFMPFISEEMWQHLP 903
            + TL  +++    ++ P +P + +E+W+++P
Sbjct: 821 VQTTLVHILNAYRAILAPILPVMVQEVWKYIP 852

>Kwal_27.11827
          Length = 985

 Score =  135 bits (339), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 174/818 (21%), Positives = 310/818 (37%), Gaps = 140/818 (17%)

Query: 169 VFTIPAPPPNVTGSLHIGHALTIAIQDSLCRYYRMKGKTVLFLPGFDHAGIATQSVVEKQ 228
           +F +   PP   G LH+GHA+   ++D + RY  ++GK + + PG+D  G+  +    ++
Sbjct: 74  LFVLHDGPPYANGDLHLGHAMNKMLKDIINRYQLLQGKFIFYKPGWDCHGLPIELKALQK 133

Query: 229 IWASEKKTRHDYGREEFVDKVWEWKEEYHKKI----KNQVKKLGASYDWSREAFTLDPKL 284
           +   E         E F  ++ +   ++ +K      +Q K+   + DW     T+  + 
Sbjct: 134 LNKDES--------ELFPTRIRKLASQHAQKTIKSQASQFKQFAIATDWDDCYETMQQQF 185

Query: 285 SKAVVEAFVKLHEEGIIYRAARLVNWSVKLNTAISNLEVENKDI--KGKTLLSVPGYDEK 342
               ++    + ++G+I R  + V W  +  TA++  E+E +D        +  P  +E 
Sbjct: 186 EFDQLDNLKIMIQKGLIKRQNKPVYWGTETKTALAEGELEYRDDHESMSAFIKFPLTEES 245

Query: 343 VEFGVLTSFSYPVVGSDEKLIVATTRPETMFGDTAVAIH--------------------- 381
               V+  ++   + S   L + T+ P T+F + AV  +                     
Sbjct: 246 SR--VVAEWNKLRLDSPISLAIWTSTPWTIFANQAVCFNESFDYGLYELNNEYVVLESGL 303

Query: 382 -----PDDER---------YKHLHGHFVQHPFLNRKMPIVCDAEAVDMEFGTGAVKITPA 427
                PD  R          K L  +    PFLN+    +   + V    GTG V   P 
Sbjct: 304 GSKVLPDIARLIATIPGTKLKDLKYYI---PFLNKSPKPLIHGDHVTNISGTGLVHTAPG 360

Query: 428 HDQNDYNTGLRHNLEVINTFTDDGLLNENCGP--------EWEGTRRFDARKLVIEKLKE 479
           H  +DY  G+++ L + +   D+G    +  P        E E  +   ARK++ E    
Sbjct: 361 HGHDDYLIGVKNGLNIYSPVDDEGRYKTDMMPSHLREILIEPETGK---ARKVLSEATTS 417

Query: 480 KGLFVGQKDNEM--------TIPTCSRSGDIIEPLLKPQWWVSQKQMAEEAIKVVRNGEI 531
           + L + Q    +        + P   RS   +     PQW+     +   A++ ++N  +
Sbjct: 418 QILTMLQNHQMLLRAEKYIHSYPYDWRSKKPVIVRSTPQWFADLTDVKSLALESLKN--V 475

Query: 532 TITPKSSESEYFHWLENIQDWCISRQLWWGHRCPVYFVNIEGEEN--------------D 577
           T  P+   +    ++++  +WCISRQ  WG   P +    + EE                
Sbjct: 476 TFHPERGLNRLTSFIKSRNEWCISRQRSWGVPIPAFHKVGKSEEVLMSEEVAKYAISAIK 535

Query: 578 RNDNSFWVSGRNLXXXXXXXXXXXXXXXYTLEQDEDVLDTWFSSG-------LYPFSTLG 630
           R     W    N                +   +  D +D WF SG        +    LG
Sbjct: 536 RKGIDAWFKEDN-SDINEWLPPSYQDRGHEYRRGRDTVDVWFDSGSTWKVIDRFYNHRLG 594

Query: 631 WP-DKTPDMSQFYPASMLETGWDILFFWVSRMILLGLKLTGSIPFKEVFCHSLVRDAQGR 689
            P  ++P    +   S    GW    F  S +  +        P+  V  H    D  G 
Sbjct: 595 LPLPRSPLADLYLEGSDQHRGW----FQSSLLTKVATAGIPQAPYAAVLTHGFTLDENGS 650

Query: 690 KMSKSLGNVVDPLDVISGIKLEDLHAKLLQGNLDPREVEKAKNGQKESYPHGIPECGTDA 749
           KMSKSLGN + P  VI+G K                               GIP  G D 
Sbjct: 651 KMSKSLGNTILPSAVIAGDK-----------------------------DRGIPALGVDG 681

Query: 750 LRFALCAYTTGGRDINLDILRVEGYRKFCNKIYQATKFALLRLGDDYKPPASEALSGNES 809
           LR  L A T    D+++    ++   +   K+    KF    LG+  K  A   L   E 
Sbjct: 682 LRL-LIAQTDFTTDVSIGPTVIKHVAEALKKLRLTLKFM---LGNLQKTAAGCELLPFEK 737

Query: 810 L--VEKWILHELTETAKNVNEAFEKRDFLNS-TSAIYEFWYLVCDVYIENSKYLIQEGT- 865
           L  ++++ L +L E +    + ++  +F    T+ +Y     +   Y + +K  +  G+ 
Sbjct: 738 LRDIDQYTLCKLQELSIQAKDHYDAYNFSKVLTAVLYHMNNQLSAFYFDVTKDALYSGSI 797

Query: 866 -EVQQKSAKDTLYILIDNALKMIHPFMPFISEEMWQHL 902
             ++++  + TL+ + D    ++ P +P + +E W  L
Sbjct: 798 NSLKRQQIRTTLFHIFDTYRSILGPILPVMIQEAWNCL 835

>KLLA0E05269g 476546..479173 similar to sp|P11325 Saccharomyces
           cerevisiae YLR382c NAM2 leucine--tRNA ligase precursor,
           mitochondrial singleton, start by similarity
          Length = 875

 Score = 99.8 bits (247), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 94/386 (24%), Positives = 161/386 (41%), Gaps = 102/386 (26%)

Query: 177 PNVTGSLHIGHALTIAIQDSLCRYYRMKGKTVLFLPGFDHAGI-ATQSVVEKQIWASEKK 235
           P  +G+LHIGH     I D + R+Y++KG  VL   G+D  G+ A  + +E+++  +   
Sbjct: 57  PYPSGTLHIGHLRVYTISDVVNRFYQLKGYNVLHPMGWDAFGLPAENAAIERKVNPAI-- 114

Query: 236 TRHDYGREEFVDKVWEWKEEYHKKIKNQVKKLGASYDWSREAFTLDPKLSKAVVEAFVKL 295
                           W +E   K+K Q+  + ++++W RE  T DP+  K   + F++L
Sbjct: 115 ----------------WTKENIGKMKAQMGMMASNFNWDREIATCDPEYYKFTQKLFLEL 158

Query: 296 HEEGIIYRAARLVNWSVKLNTAISNLEVEN------------KDIKGKTLLSVPGYDEKV 343
            + G  YR    +NW     T ++N +V++            K +  +  L +  +  ++
Sbjct: 159 FKNGYAYRKEAEINWDPVDQTVLANEQVDSNGKSWRSGAQVEKKLLSQWFLGITRFAHEL 218

Query: 344 EF------------------------GVLTSFSYPVVGSDEKLIVATTRPETMFGDTAVA 379
           +                         GV   F+ P +   + + + TTRPET++    V 
Sbjct: 219 QHDLDGLDGWPSHVKRMQKNWIGESKGVEVVFNLPSI---DPIKIFTTRPETLYSVQFVT 275

Query: 380 ---------------------IH-----PDDERYKHLHGH-FVQHPFLNRKMPIVCDAEA 412
                                IH     P+D +  ++  + F QHP   +K   +  A  
Sbjct: 276 LALDHSIVRKLKEEDNNLQEFIHRAEKLPEDSKKGYMLSNIFCQHPLDPKKTVPIFVAPY 335

Query: 413 VDMEFGTGAVKITPAHDQNDY-----NTGLRHNLEVINT-----------FTDDGLLNEN 456
           V   +G GAV   PAHDQ D+     N   +  +  +++            + DG++NEN
Sbjct: 336 VLGNYGHGAVMGCPAHDQRDFDFWKENCPGKPMIYTVSSAEAKIDTSGPYVSKDGVMNEN 395

Query: 457 CGPEWEGTRRFDARKLVIEKLKEKGL 482
            G +  G    +ARKLV+EKL   GL
Sbjct: 396 AG-DLVGLTTHEARKLVVEKLTSLGL 420

>YLR382C (NAM2) [3761] chr12 complement(882067..884751) Leucyl-tRNA
           synthetase, mitochondrial, forms a ternary complex with
           bI4 maturase and bI4 intron and stimulates bI4 intron
           splicing activity, dominant alleles suppress mutations
           in the bI4 maturase [2685 bp, 894 aa]
          Length = 894

 Score = 90.5 bits (223), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 102/398 (25%), Positives = 152/398 (38%), Gaps = 112/398 (28%)

Query: 177 PNVTGSLHIGHALTIAIQDSLCRYYRMKGKTVLFLPGFDHAGI-ATQSVVEKQIWASEKK 235
           P  +G+LHIGH     I DSL R+Y+ KG  V+   G+D  G+ A  + +E+ I  +   
Sbjct: 56  PYPSGALHIGHLRVYVISDSLNRFYKQKGYNVIHPMGWDAFGLPAENAAIERSINPAI-- 113

Query: 236 TRHDYGREEFVDKVWEWKEEYHKKIKNQVKKLGASYDWSREAFTLDPKLSKAVVEAFVKL 295
                           W  +   K+K Q++ + A++DW RE  T DP+  K     F+KL
Sbjct: 114 ----------------WTRDNIAKMKQQMQSMLANFDWDREITTCDPEYYKFTQWIFLKL 157

Query: 296 HEEGIIYRAARLVNWSVKLNTAISNLEVENKDIKGKTLLSVPGYDEKVEFGVLTSFSYPV 355
            E G+ YR    +NW     T ++N +V+ +    ++   V     K  F  +T F+  +
Sbjct: 158 FENGLAYRKEAEINWDPVDMTVLANEQVDAQGRSWRSGAIVEKKQLKQWFLGITKFAPKL 217

Query: 356 -------------------------VGSD----------EKLIVATTRPETMFGDTAVAI 380
                                    VG++          E LIV TTRPET+F    VA+
Sbjct: 218 KKHLNQLKDWPSNVKQMQKNWIGESVGAELVFKVADPKFENLIVFTTRPETLFAVQYVAL 277

Query: 381 ---HPDDERYKHLH---GHFVQ---------------------HPFLNRKMPIVCDAEAV 413
              HP  ++Y         F+Q                     +P    ++PI   A  V
Sbjct: 278 ALDHPIVQKYCEEMPDLKEFIQKSDQLPNDTKEGFQLPNIKAVNPLTKEEVPIFA-APYV 336

Query: 414 DMEFGTG--AVKITPAHDQNDY-----NTGLRHNLEVINTFTD----------------- 449
              +G+   AV   P HD  D+     N    H    I  F D                 
Sbjct: 337 VSSYGSAPSAVMGCPGHDNRDFEFWQTNCPGEHIKTCIAPFFDDASKVTEQERQRIIDTV 396

Query: 450 -----DGLLNENCGPEWEGTRRFDARKLVIEKLKEKGL 482
                DG+L + CG E  G     ARK ++  L  +GL
Sbjct: 397 PFTSTDGVLTKECG-EHSGVLTVVARKSIMGMLNSEGL 433

>AER043C [2548] [Homologous to ScYLR382C (NAM2) - SH]
           (711416..714037) [2622 bp, 873 aa]
          Length = 873

 Score = 86.3 bits (212), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 100/463 (21%), Positives = 167/463 (36%), Gaps = 133/463 (28%)

Query: 177 PNVTGSLHIGHALTIAIQDSLCRYYRMKGKTVLFLPGFDHAGIATQSVVEKQIWASEKKT 236
           P  +G LHIGH     I D+L R+YRMKG  V+   G+D  G+  ++   ++  A    T
Sbjct: 56  PYPSGMLHIGHLRVYTISDALNRFYRMKGYEVVHPMGWDAFGLPAENAALERGIAPADWT 115

Query: 237 RHDYGREEFVDKVWEWKEEYHKKIKNQVKKLGASYDWSREAFTLDPKLSKAVVEAFVKLH 296
           R +  R                 +K Q   + A ++W RE  T DP+  +   E F++L 
Sbjct: 116 RQNIAR-----------------MKQQKGDMLAHFEWGREVTTCDPEYYRFTQELFLELW 158

Query: 297 EEGIIYRAARLVNWSVKLNTAISNLEVENKDIKGKTLLSVPGYDEKVEFGVLTSFSYPV- 355
             G+ Y+    +NW     T ++N +V+ +    ++   V        F  +T F++ + 
Sbjct: 159 HHGMAYKKEAEINWDPVDKTVLANEQVDAQGRSWRSGALVEKRKLNQWFLRITRFAHELS 218

Query: 356 --------------------------------VGSDEKLIVATTRPETMFGDTAVAIHPD 383
                                            G  E ++  T R E +FG   VAI  +
Sbjct: 219 HDLDGLDGWPAKVKAMQKHWIGEVEGTEVRLCTGDGEAIVAFTPRIEAVFGLQYVAISTE 278

Query: 384 DERYK---------------------------HLHGHFVQHPFL---NRKMPI-VCDAEA 412
               K                            L G +VQHPF      ++P+ V     
Sbjct: 279 HALTKKMAERLPELCEFLQRPLVLSESDLSGFQLPGTYVQHPFAKDHGHRIPVFVSPYVP 338

Query: 413 VDMEFGTGAVKITPAHDQNDYN--TGLRHNLEVINTFTDDGLLNENCGPEWEGTRRFDAR 470
            D   G GAV  TPAHD+ D+      +    VI++F   G  ++ C             
Sbjct: 339 AD---GAGAVLGTPAHDEFDHKFWRANKPAEPVISSFEASGECDDEC------------- 382

Query: 471 KLVIEKLKEKGLFVGQKDNEMTIPTCSRSGDIIEPLLKPQWWVSQKQMAEEAIKVVRNGE 530
                 ++ KG+   +  N   I +                        ++A +V+ +  
Sbjct: 383 -----HIQTKGILNAKAGNLKGISS------------------------QDAKQVLADKL 413

Query: 531 ITITPKSSESEYFHWLENIQDWCISRQLWWGHRCPVYFVNIEG 573
           +        ++Y      ++DW ISRQ +WG   P+ + +  G
Sbjct: 414 VATGDGRQTTQY-----RLRDWLISRQRYWGAPIPIIYCDSCG 451

>Kwal_26.9374
          Length = 884

 Score = 85.5 bits (210), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 103/460 (22%), Positives = 168/460 (36%), Gaps = 135/460 (29%)

Query: 177 PNVTGSLHIGHALTIAIQDSLCRYYRMKGKTVLFLPGFDHAGI-ATQSVVEKQIWASEKK 235
           P  +G+LHIGH     I D+L R+Y+  G  V+   G+D  G+ A  + +E+++  +   
Sbjct: 58  PYPSGNLHIGHLRVYTITDALNRFYKQNGYNVIHPMGWDAFGLPAENAAIERKVNPAS-- 115

Query: 236 TRHDYGREEFVDKVWEWKEEYHKKIKNQVKKLGASYDWSREAFTLDPKLSKAVVEAFVKL 295
                           W  +   K+K Q+  + A++DW RE  T +P   K   + F++L
Sbjct: 116 ----------------WTHQNIAKMKEQLNNMLANFDWDREVTTCNPDYYKHTQKLFLEL 159

Query: 296 HEEGIIYRAARLVNWSVKLNTAISNLEVENKDIKGKT---------------LLSVPGYD 340
            + G+ YR    +NW     T ++N +V   D +G++                L +  Y 
Sbjct: 160 FKRGLAYRKDAEINWDPVDQTVLANEQV---DAQGRSWRSGALVEKRKLNQWFLGITKYA 216

Query: 341 EKVEFGVLTSFSYPV---------------------VGSDEKLIVATTRPETMFG----- 374
             ++  +     +P                        + E + V TTRPET+F      
Sbjct: 217 HALQHDLNQLQDWPRNVKTMQKNWVGESHGTEIDFKCSTSETIQVFTTRPETLFSVQYVA 276

Query: 375 ----------------------DTAVAIHPDDERYKHLHGHFVQHPFLNRK---MPIVCD 409
                                 D A  + PD +    L G   ++P L      +PI   
Sbjct: 277 LALDNPVIEKAAISDPELRKFIDQAKFLSPDCKDGYQLKGVKAKNPILKAAEYDLPIFA- 335

Query: 410 AEAVDMEFGTGAVKITPAHDQNDYNTGLRHNLEVINTFTDDGLLNENCGPEWEGTRRFDA 469
           A  V   +G GAV   PAHD+ D            N F    +      P          
Sbjct: 336 APYVLGNYGKGAVMGCPAHDERD------------NAFWAQNMPGHPTKPS--------- 374

Query: 470 RKLVIEKLKEKGLFVGQKDNEMTIPTCSRSGDIIEPLLKPQWW---VSQKQMAEEAIKVV 526
              +I K        G   N + +P  S+SG +    +         + KQM  +A++  
Sbjct: 375 ---IIAKED------GTATNLLQLPFTSKSGILSSAAMTYAGMDTTTAAKQMT-KALESS 424

Query: 527 RNGEITITPKSSESEYFHWLENIQDWCISRQLWWGHRCPV 566
            NG   ++ K            ++DW ISRQ +WG   P+
Sbjct: 425 GNGRYMVSYK------------LRDWLISRQRYWGTPIPI 452

>CAGL0H05049g complement(483870..486593) similar to sp|P11325
           Saccharomyces cerevisiae YLR382c NAM2, hypothetical
           start
          Length = 907

 Score = 83.2 bits (204), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 182/825 (22%), Positives = 310/825 (37%), Gaps = 192/825 (23%)

Query: 177 PNVTGSLHIGHALTIAIQDSLCRYYRMKGKTVLFLPGFDHAGI-ATQSVVEKQIWASEKK 235
           P  +G LH+GH     I D+L R+Y+ +G  V+   G+D  G+ A  + +E+ I  SE  
Sbjct: 77  PYPSGMLHMGHLRVYVISDTLNRFYQQRGYNVIHPMGWDAFGLPAENAAIERGIDPSE-- 134

Query: 236 TRHDYGREEFVDKVWEWKEEYHKKIKNQVKKLGASYDWSREAFTLDPKLSKAVVEAFVKL 295
                           W ++  KK+K Q+  + A+++W RE  T DP+  K     F++L
Sbjct: 135 ----------------WTKQNIKKMKEQMNDMLANFNWEREVTTCDPEYYKFTQWLFLQL 178

Query: 296 HEEGIIYRAARLVNWSVKLNTAISNLEVENKDIKGKT---------------LLSVPGYD 340
           ++ G+ YR    +NW     T ++N +V   D  G++                L +  + 
Sbjct: 179 YKNGLAYRKDAEINWDPVDKTVLANEQV---DANGRSWRSGAIVEKKKLTQWFLGITKFV 235

Query: 341 EKVE------------------------FGVLTSFSY-PVVGSDEKLIVATTRPETMFGD 375
           +++                          G+  +F     +G  E + V TTR ET+F  
Sbjct: 236 DQLRDDLKYLEEWPNKVKTMQNNWIGSSTGMEVNFKLNKKIGKFENVTVFTTRAETLFSV 295

Query: 376 TAVAI---HPDDERY--------KHLH-----------GH-----FVQHPFLNRKMPIVC 408
             V +   HP  + Y        + LH           G+      V++P  +  +P+  
Sbjct: 296 EYVVLATDHPITQHYAKQKSDLREFLHKLPELPEDTKTGYRISDLTVENPITHEVIPVFV 355

Query: 409 DAEAVDMEFG--TGAVKITPAHDQNDYNTGLRHNLEVINTFTDDGLLNENCGPEWEGTRR 466
            A  V   +G    AV   PAHD  DY          IN       LN N  P       
Sbjct: 356 -APYVISGYGDLPAAVMGCPAHDLRDY------EFRKIN-------LNTNEEP------- 394

Query: 467 FDARKLVIEKLKEKGLFVGQKDNEMTIPTCSRSGDIIEPLLKPQWWVSQKQMAEEAIKV- 525
           F     +I  L   G        + +IP  S+SG + E   K   W        +AI   
Sbjct: 395 FGC---IIPDLSRLG--------QDSIPYTSKSGTMNERCGKYVGW--DVNATRDAISTE 441

Query: 526 VRNGEITITPKSSESEYFHWLENIQDWCISRQLWWGHRCPVYFVNIEG----EENDRNDN 581
           + N  +        + Y      I+DW ISRQ +WG   P+   N  G     E D    
Sbjct: 442 LENKNLG----KRTTRY-----RIKDWLISRQRYWGSPIPIIHCNNCGIVPVPEEDLPVT 492

Query: 582 SFWVSGRN-----LXXXXXXXXXXXXXXXYTLEQDEDVLDTWFSSGLYPFSTLGWPDKTP 636
             +V G +     L                + +++ D +DT+  S  Y F  +   +K  
Sbjct: 493 LPYVQGLHQKGNPLSNISDFVNTECPRCHNSAKRETDTMDTFIDSSWYFFRYIDAHNKVL 552

Query: 637 DMS-----QFYPASMLETGWD--ILFFWVSRMILLGLKLTG--------SIPFKEVFCHS 681
             S     +  P  +   G +  IL    SR I   L   G          PFK++    
Sbjct: 553 PFSPEKANKSMPVDIYIGGVEHAILHLLYSRFISKFLSSIGMWDRGISHGEPFKKLVTQG 612

Query: 682 LVRDAQGRKM-SKSLGNVVDP--LDVISGIKLEDLHAKLLQGNLDPREVEKAK-NGQKES 737
           +V   QG+ +     G  + P  +D +S      +  K +   L   ++ K+K NG   +
Sbjct: 613 MV---QGKTLIDPETGKFLTPNDIDYLSSSSTPKIKGKNIAPILKYEKMSKSKYNGADPN 669

Query: 738 YPHGIPECGTDALRFALCAYTTGGRDINLDILRVEGYRKFCNKIYQATKFALLRLGDDYK 797
               I + G DA R  +   +     +  D  ++ G  ++ +KI Q      L +     
Sbjct: 670 --ECISKHGPDATRAHILFQSPISDALRWDEEKIVGIERWLDKILQ------LCMSFASN 721

Query: 798 PPASEALSG----NESLVEKWILHELTETAKNVNEAFEKRDFLNSTSAIYEFWYLVCDVY 853
           P     ++G      +  E  + + +++   ++ ++F +   LN+  +     Y+     
Sbjct: 722 PDKIVGMTGIPPDQYNTDEITLYNNVSKMVNSITKSFSENLSLNTVISD----YMKLTTL 777

Query: 854 IENSKYLIQEGTEVQQKSAKDTLYI-LIDNALKMIHPFMPFISEE 897
           +EN+K         +    +DT+ I  + + +K I+P +P I+EE
Sbjct: 778 LENAK---------KNTKIRDTVTINYVRDLIKCIYPVVPSIAEE 813

>Scas_719.5
          Length = 939

 Score = 80.9 bits (198), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 94/397 (23%), Positives = 157/397 (39%), Gaps = 111/397 (27%)

Query: 177 PNVTGSLHIGHALTIAIQDSLCRYYRMKGKTVLFLPGFDHAGI-ATQSVVEKQIWASEKK 235
           P  +G+LH+GH     I DSL R+++ +G  V+   G+D  G+ A  + + + I  ++  
Sbjct: 79  PYPSGTLHMGHLRVYVISDSLNRFFKQRGYEVIHPMGWDAFGLPAENAAIARGINPAD-- 136

Query: 236 TRHDYGREEFVDKVWEWKEEYHKKIKNQVKKLGASYDWSREAFTLDPKLSKAVVEAFVKL 295
                           W ++   K+K Q+  + A++DW RE  T DP   K     F+KL
Sbjct: 137 ----------------WTKQNIAKMKEQMNNMLANFDWDREVTTCDPDYYKFNQWIFLKL 180

Query: 296 HEEGIIYRAARLVNWSVKLNTAISNLEVENKDIKGKTLLSVPGYDEKVEFGVLTSFS--- 352
           +E G+ Y+    +NW     T ++N +V++  I  ++   V     K  F  +T F+   
Sbjct: 181 YENGLAYQKEAEINWDPVDKTVLANEQVDSNGISWRSGAKVEKRQLKQWFLGITKFAKDL 240

Query: 353 ---------YP-------------------VVGSDEKLI----VATTRPETMFGDTAVAI 380
                    +P                   + G+D +L     + TTR ET+F    VA+
Sbjct: 241 RKDLYTLKKWPENVKTMQRNWIGESSGATLLFGTDNELFKHIQLFTTRAETLFAVQFVAL 300

Query: 381 ---HPDDERYKHLH-------------------GHFVQ-----HPFLNRKM-----PIVC 408
              HP  E Y                       G+ ++     +P   +K+     P V 
Sbjct: 301 SKEHPIVEHYAKTDPKLREFITIMDTLPDDSKTGYLLKDIKAINPLTKKKVSIFVAPYVI 360

Query: 409 DAEAVDMEFGTGAVKITPAHDQNDY-----NTGLRHNLEVINTFT--------------- 448
            +   D E G  AV   PAHD+ D+     N+     +  I+ FT               
Sbjct: 361 GSYGSDNEPG-AAVMGCPAHDERDFAFWHENSPNEPIISCIDPFTLLEDDSITALNSPLP 419

Query: 449 ---DDGLLNENCGPEWEGTRRFDARKLVIEKLKEKGL 482
              D G ++E C  E+ G     AR  +++KL+ + L
Sbjct: 420 YTYDLGSMSEICA-EYHGLATEAARASIVQKLRSENL 455

>AAL088W [99] [Homologous to ScYPL160W (CDC60) - SH]
           complement(185828..189142) [3315 bp, 1104 aa]
          Length = 1104

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 28/58 (48%)

Query: 170 FTIPAPPPNVTGSLHIGHALTIAIQDSLCRYYRMKGKTVLFLPGFDHAGIATQSVVEK 227
           F  P   P + G LH+GH  T++  +    + RM GK  LF  GF   G+   +  +K
Sbjct: 72  FMAPMAYPYMNGVLHVGHCFTMSKVEFSVGFERMNGKRALFPLGFHCTGMPILACADK 129

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 50/126 (39%), Gaps = 15/126 (11%)

Query: 267 LGASYDWSREAFTLDPKLSKAVVEAFV-----KLHEEGIIYRAARLVNWSVKLNTAISNL 321
           +GA  DW R   T D        +AFV     KL E G +    R   +S +   A   +
Sbjct: 224 IGARVDWRRAYITTD---MNQYYDAFVRWQMNKLREAGKVKFGERYTIYSERDGQAC--M 278

Query: 322 EVENKDIKGKTLLSVPGYD-EKVEFGVLTSFSYPVVGSDEK----LIVATTRPETMFGDT 376
           + + +  +G T     G   E +EF           G D+      I AT RPETM+G T
Sbjct: 279 DHDRQSGEGVTPQEYVGIKIEVLEFAAEAQEIIDNSGLDKSKKIHFIAATLRPETMYGQT 338

Query: 377 AVAIHP 382
              + P
Sbjct: 339 CCFVSP 344

>AAL133W [54] [Homologous to ScYGR171C (MSM1) - SH]
           complement(113951..115654) [1704 bp, 567 aa]
          Length = 567

 Score = 37.7 bits (86), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 36/80 (45%), Gaps = 9/80 (11%)

Query: 170 FTIPAPPPNVTGSLHIGHALTIAIQDSLCRYYRMKGKTVLFLPGFDHAGIATQSVVEKQI 229
           F I  P        H+GH  +  I D   R+ +++   VLF  G D  G+  Q+  E+Q 
Sbjct: 15  FHITTPIFYPNAKPHLGHLYSSLICDVQARWQKLRDSEVLFTTGTDEHGLKIQTASEQQG 74

Query: 230 WASEKKTRHDYGREEFVDKV 249
           +AS K          FVDK+
Sbjct: 75  YASPKV---------FVDKL 85

>Scas_650.7
          Length = 1119

 Score = 37.0 bits (84), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 25/51 (49%)

Query: 177 PNVTGSLHIGHALTIAIQDSLCRYYRMKGKTVLFLPGFDHAGIATQSVVEK 227
           P   G+LH GH  T++  +    + RM GK  LF  GF   G+   +  +K
Sbjct: 95  PYANGALHAGHCFTLSKVEFSVGFERMNGKRALFPLGFHCTGMPILACADK 145

>YGR171C (MSM1) [2124] chr7 complement(840827..842554)
           Methionyl-tRNA synthetase, mitochondrial, member of
           class I family of aminoacyl-tRNA synthetases [1728 bp,
           575 aa]
          Length = 575

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 23/49 (46%), Positives = 28/49 (57%), Gaps = 6/49 (12%)

Query: 656 FWVSRMILLGLKLTGSIPFKEVFCHSLVRDAQGRKMSKSLGNVVDPLDV 704
           +W S ++  GL L   I    V  H L     G KMSKSLGNVVDP+D+
Sbjct: 313 YWPSFLLAAGLPLPRQIV---VHGHWL---CNGMKMSKSLGNVVDPIDM 355

 Score = 31.6 bits (70), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 31/80 (38%), Gaps = 11/80 (13%)

Query: 171 TIPAPPPNVTGSLHIGHALTIAIQDSLCRYYRMKGKTVLFLPGFDHAGIATQSVVEKQIW 230
           T P   PN     H+GH  +  + D   R+   KG    F  G D  G+  Q   E   +
Sbjct: 18  TTPIFYPNAKP--HLGHLYSSLLSDVYHRWQLFKGNLSFFTTGTDEHGLKIQCASESNGF 75

Query: 231 ASEKKTRHDYGREEFVDKVW 250
              KK         FVDK++
Sbjct: 76  DQPKK---------FVDKLY 86

>Kwal_33.15315
          Length = 583

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 24/34 (70%)

Query: 688 GRKMSKSLGNVVDPLDVISGIKLEDLHAKLLQGN 721
           G KMSKS+GNVVDPLD+IS    + +   LL+ +
Sbjct: 345 GTKMSKSVGNVVDPLDMISYYGCDPVRWYLLENS 378

>Sklu_2298.2 YPL160W, Contig c2298 4548-7838
          Length = 1096

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 25/51 (49%)

Query: 177 PNVTGSLHIGHALTIAIQDSLCRYYRMKGKTVLFLPGFDHAGIATQSVVEK 227
           P + G LH GH  T++  +    + RM GK  LF  GF   G+   +  +K
Sbjct: 71  PYMNGVLHAGHCFTLSKVEFSVGFERMNGKRALFPLGFHCTGMPILACADK 121

 Score = 35.0 bits (79), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 89/400 (22%), Positives = 133/400 (33%), Gaps = 109/400 (27%)

Query: 267 LGASYDWSREAFTLD--PKLSKAVVEAFVKLHEEGIIYRAARLVNWSVKLNTAISNLEVE 324
            GA  DW R   T D  P     +     KL   G I    R   +S K   A   ++ +
Sbjct: 214 FGARIDWRRSFITADMNPYYDAFIRWQMNKLKALGKIKFGERYTIYSEKDGQAC--MDHD 271

Query: 325 NKDIKGKTLLSVPGYDEKVEFGVLTSFSYPVVGSDEKL--------IVATTRPETMFGDT 376
            +  +G T     G   K+E       +  +V S + L        + AT RPETM+G T
Sbjct: 272 RQSGEGVTPQEYIGI--KIEVTEFAPEAKKIVDSSDALDKSKKIYFVAATLRPETMYGQT 329

Query: 377 AVAIHPD---------DERY------------------------------KHLHGHFVQH 397
              + P          D  Y                              KH  G  +  
Sbjct: 330 CCFVSPKIEYGIFDAGDAYYITTERAFKNMSYQKLTPKRGYYKPIVTISGKHFIGSKIHA 389

Query: 398 PFLNRKMPIVCDAEAVDMEFGTGAVKITPAHDQNDYNT--GLRHNLE------------- 442
           P    +   +   E V    GTG V   P++  +DY T   L+H  E             
Sbjct: 390 PLAAYEELRILPMETVIANKGTGVVTCVPSNSPDDYMTTKDLQHKPEYYGIEADWIKHEP 449

Query: 443 --VINT-----FTDDGLLNENCGPEWEGTRRF-DARKLVIE------------------- 475
             +INT          +  EN     + T +  +A+K+  +                   
Sbjct: 450 IPIINTEKYGDLIAKAVCEENKIKSPKDTNQLAEAKKIAYKEDYYTGTMIYGKYKGEKVE 509

Query: 476 ----KLKEKGLFVGQK--DNEMTIPTCSRSGDIIEPLLKPQWWV--SQKQMAEEAIKVVR 527
               K+K   +  GQ    +E      SRSGD     L+ QW+V   ++   E+AI+ + 
Sbjct: 510 AAKSKVKSDMIAAGQAFVYDEPESLVISRSGDECIVSLEDQWYVDYGEESWKEQAIECLE 569

Query: 528 NGEITITP--KSSESEYFHWLENIQDWCISRQLWWGHRCP 565
             E+   P  K++      WL+N   W + R    G R P
Sbjct: 570 QMEL-FAPEVKNAFEGVLEWLKN---WAVCRTYGLGTRLP 605

>KLLA0D06105g complement(522480..525767) highly similar to sp|P26637
           Saccharomyces cerevisiae YPL160w CDC60 leucine--tRNA
           ligase, cytosolic singleton, start by similarity
          Length = 1095

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 25/51 (49%)

Query: 177 PNVTGSLHIGHALTIAIQDSLCRYYRMKGKTVLFLPGFDHAGIATQSVVEK 227
           P + G LH GH  T++  +    + RM GK  LF  GF   G+   +  +K
Sbjct: 71  PYMNGVLHAGHCFTLSKVEFSIGFERMNGKRALFPIGFHCTGMPILACADK 121

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 38/81 (46%), Gaps = 8/81 (9%)

Query: 489 NEMTIPTCSRSGDIIEPLLKPQWWV--SQKQMAEEAIKVVRNGEITITP--KSSESEYFH 544
           NE      SRSGD     L+ QW+V   +++  ++AI+ +   E+   P  K++      
Sbjct: 528 NEPESVVISRSGDECIVSLEDQWYVDYGEEEWKKQAIECLEGMEL-FAPEVKNAFESVLD 586

Query: 545 WLENIQDWCISRQLWWGHRCP 565
           WL N   W +SR    G R P
Sbjct: 587 WLRN---WAVSRSYGLGTRLP 604

>CAGL0J03652g 346614..349895 highly similar to sp|P26637
           Saccharomyces cerevisiae YPL160w CDC60 leucine-tRNA
           ligase, hypothetical start
          Length = 1093

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 25/51 (49%)

Query: 177 PNVTGSLHIGHALTIAIQDSLCRYYRMKGKTVLFLPGFDHAGIATQSVVEK 227
           P + G LH GH  T++  +    + RM GK  LF  GF   G+   +  +K
Sbjct: 69  PYMNGVLHAGHCFTLSKVEFSIGFERMNGKRALFPLGFHCTGMPILACADK 119

>YPL160W (CDC60) [5287] chr16 (246989..250261) Leucyl-tRNA
           synthetase, cytoplasmic [3273 bp, 1090 aa]
          Length = 1090

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 25/51 (49%)

Query: 177 PNVTGSLHIGHALTIAIQDSLCRYYRMKGKTVLFLPGFDHAGIATQSVVEK 227
           P + G +H GH  T++  +    + RM GK  LF  GF   G+   +  +K
Sbjct: 66  PYMNGVMHAGHCFTLSKVEFSIGFERMNGKRALFPLGFHCTGMPILACADK 116

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 61/155 (39%), Gaps = 20/155 (12%)

Query: 242 REE---FVDKVWEWKEEYHKKIKNQVKKLGASYDWSREAFTLDPKLSKAVVEAFV----- 293
           REE   F D  + W   +    ++    LGA  DW R   T D   +    +AF+     
Sbjct: 182 REEIIKFADAKY-WLTYFPPLCESDCTSLGARIDWRRSFVTTD---ANPYYDAFIRWQMN 237

Query: 294 KLHEEGIIYRAARLVNWSVKLNTAISNLEVENKDIKGKTLLSVPGYD-EKVEFG-----V 347
           KL   G I    R   +S K   A   ++ + +  +G T     G   E +EF      +
Sbjct: 238 KLKAAGKIKFGERYTIYSEKDGQAC--MDHDRQSGEGVTPQEYIGVKIEALEFADDAAKI 295

Query: 348 LTSFSYPVVGSDEKLIVATTRPETMFGDTAVAIHP 382
           + S S          + AT RPETM+G T   + P
Sbjct: 296 IDSSSDLDKSKKFYFVAATLRPETMYGQTCCFVSP 330

>Sklu_2399.6 YGR171C, Contig c2399 15064-16788
          Length = 574

 Score = 35.0 bits (79), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 24/36 (66%)

Query: 686 AQGRKMSKSLGNVVDPLDVISGIKLEDLHAKLLQGN 721
           + G KMSKSLGNVVDPL +IS    + +   LL+ +
Sbjct: 345 SNGVKMSKSLGNVVDPLLMISYYGCDSMRWYLLENS 380

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 56/142 (39%), Gaps = 18/142 (12%)

Query: 163 KIKPEGVFTIPAPPPNVTGSLHIGHALTIAIQDSLCRYYRMKGKTVLFLPGFDHAGIATQ 222
           K   +  F +  P        H+GH  +  + D   R+Y +     LF  G D  G+  Q
Sbjct: 12  KCSKQAKFHVTTPIFYPNAKPHLGHLYSSLLCDVTRRWYDLLSYKTLFTTGTDEHGLKIQ 71

Query: 223 SVVEKQIWASEKKTRHDYGREEFVDKVWEWKEEYHKKIKNQVKKLGASYDWSREAFTLDP 282
              EKQ +     T HD     FV+ +++   +  KK         +  ++SR   T DP
Sbjct: 72  LASEKQSY----NTPHD-----FVEVLYKHFVDLDKK---------SQVNYSRFIRTTDP 113

Query: 283 KLSKAVVEAFVKLHEEGIIYRA 304
              + V + +    E G IY+ 
Sbjct: 114 DHIENVKKLWRLCWENGYIYKG 135

>KLLA0F14971g complement(1386169..1387875) similar to sp|P22438
           Saccharomyces cerevisiae YGR171c MSM1 methionyl-tRNA
           synthetase singleton, hypothetical start
          Length = 568

 Score = 34.7 bits (78), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 15/19 (78%), Positives = 17/19 (89%)

Query: 688 GRKMSKSLGNVVDPLDVIS 706
           G KMSKSLGNVVDP+ +IS
Sbjct: 340 GVKMSKSLGNVVDPIQIIS 358

 Score = 31.2 bits (69), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 34/161 (21%), Positives = 61/161 (37%), Gaps = 18/161 (11%)

Query: 170 FTIPAPPPNVTGSLHIGHALTIAIQDSLCRYYRMKGKTVLFLPGFDHAGIATQSVVEKQI 229
           F I  P        H+GH  +  + D   R+ ++ G+   F  G D  G+  Q   +++ 
Sbjct: 12  FHITTPIFYPNAKPHLGHLYSSLLCDVQNRWKKLAGQDTCFTTGVDEHGLKIQLAAQQKG 71

Query: 230 WASEKKTRHDYGREEFVDKVWEWKEEYHKKIKNQVKKLGASYDWSREAFTLDPKLSKAVV 289
           +++ K          FVD++ E      K          A+  ++R   T DP     V 
Sbjct: 72  YSNPKA---------FVDELCEHFVHLDKD---------ANIKFTRFIRTTDPDHVNNVK 113

Query: 290 EAFVKLHEEGIIYRAARLVNWSVKLNTAISNLEVENKDIKG 330
           + +   +  G IY+      +SV   T   + ++    I G
Sbjct: 114 KLWNLCYNNGYIYKGEHKGWYSVSDETFYPDTKILKLTIDG 154

>Scas_620.7
          Length = 576

 Score = 34.3 bits (77), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 29/49 (59%), Gaps = 6/49 (12%)

Query: 656 FWVSRMILLGLKLTGSIPFKEVFCHSLVRDAQGRKMSKSLGNVVDPLDV 704
           +W S ++  GL L      K+V  H+      G KMSKSLGNVVDP+++
Sbjct: 315 YWPSFLMAAGLPLP-----KQVVVHNHWL-CNGVKMSKSLGNVVDPIEM 357

>CAGL0I08723g 849045..850799 similar to sp|P22438 Saccharomyces
           cerevisiae YGR171c MSM1 methionyl-tRNA synthetase,
           hypothetical start
          Length = 584

 Score = 33.5 bits (75), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 29/53 (54%), Gaps = 6/53 (11%)

Query: 654 LFFWVSRMILLGLKLTGSIPFKEVFCHSLVRDAQGRKMSKSLGNVVDPLDVIS 706
           + FW S ++   L L      K++  HS      G KMSKSLGNVV+P+ + S
Sbjct: 324 IIFWPSFLLAANLPLP-----KQIVVHSHWL-CNGFKMSKSLGNVVEPMKISS 370

>Sklu_2219.6 YDL116W, Contig c2219 10146-12317 reverse complement
          Length = 723

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 37/67 (55%)

Query: 771 VEGYRKFCNKIYQATKFALLRLGDDYKPPASEALSGNESLVEKWILHELTETAKNVNEAF 830
           V+ +++F N IYQ  K  L+ L +D +    EAL    +L   +++ EL ++  + +E+ 
Sbjct: 615 VKQFKEFSNGIYQLIKDFLVYLSEDERVQDKEALFEIRALYTPYLVIELHKSLVSASESL 674

Query: 831 EKRDFLN 837
           +   F+N
Sbjct: 675 KISSFIN 681

>Kwal_26.8831
          Length = 916

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 50/127 (39%), Gaps = 16/127 (12%)

Query: 267 LGASYDWSREAFTLD--PKLSKAVVEAFVKLHEEGIIYRAARLVNWSVKLNTAISNLEVE 324
            G+  DW R   T D  P     +     KL E G I    R   +S K   A   ++ +
Sbjct: 35  FGSRIDWRRSFITTDMNPYYDAFIRWQMNKLKELGKIKFGERYTIYSEKDGQAC--MDHD 92

Query: 325 NKDIKGKTLLSVPGYD-EKVEFGVLTSFSYPVVGSDEKL--------IVATTRPETMFGD 375
            +  +G T     G   E +EF      +  ++ S E L        + AT RPETM+G 
Sbjct: 93  RQSGEGVTPQEYVGIKIEAIEFA---EAAQKIIDSTESLDKSKKFHFVAATLRPETMYGQ 149

Query: 376 TAVAIHP 382
           T   + P
Sbjct: 150 TCCFVSP 156

>Kwal_23.5635
          Length = 333

 Score = 30.8 bits (68), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 56/147 (38%), Gaps = 21/147 (14%)

Query: 791 RLGDDYKPPASEALSGNESLVEKWILHELTETAKNVNEAFEKRDFLNSTSAIYEFWYLVC 850
           R   D KP  S  L+      + W+L          N  FE        S  Y+  + +C
Sbjct: 75  RYTSDSKPVKSGILTNEAKKQDGWLLE---------NGTFE-------FSTKYDLGFSLC 118

Query: 851 DVYIENSKYLIQEGTEVQQKSAKDTLYILIDNALKMIHPF--MPFISEEMWQHLPRYASE 908
            V    SK   Q+  +  Q S +DT   L D  L MI  F  M   S E W  +P    +
Sbjct: 119 GVLY--SKTRTQDENDYHQSSPQDTTPELEDRFL-MIRDFHNMLIDSNEAWSSIPSAILQ 175

Query: 909 TSPTIVKSSYPTFKEEFHNPSAAKEYE 935
           +S   +  S     + +H  +AAK  E
Sbjct: 176 SSLEKLSDSIVEGGDTYHKLTAAKVTE 202

>KLLA0C01936g 153971..155902 similar to sp|P53835 Saccharomyces
            cerevisiae YNL279w PRM1 singleton, start by similarity
          Length = 643

 Score = 30.8 bits (68), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 40/82 (48%), Gaps = 8/82 (9%)

Query: 989  VSVVKSAADIPQGCVLQSVNPEVNVHVLVKGHV-----DIDAEISKVQKKLDKTLKSKSA 1043
            V ++ SA D   G V  + N   +V  LV G V     +ID  +S + K ++K L + + 
Sbjct: 117  VCLIVSAID---GSVDVATNATESVIDLVNGTVSSVADEIDDGLSGLTKVVNKVLSAVND 173

Query: 1044 IDKIVNSSDYEQKANDQVKQFN 1065
            I      +D E   NDQVK+ N
Sbjct: 174  IQNFFKGNDDESDINDQVKKVN 195

>Scas_719.84
          Length = 1544

 Score = 30.8 bits (68), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 16/69 (23%), Positives = 32/69 (46%), Gaps = 2/69 (2%)

Query: 134  AYNPANVESSWYEWWNKSGFFEPEFTKDGKI--KPEGVFTIPAPPPNVTGSLHIGHALTI 191
            AY+    +  + ++ + SG +  E  ++G +   P  V+     P N+ G +H    LT+
Sbjct: 1446 AYSWGRPQFKYAQYIHSSGAYIAEIRENGDLFLAPNNVYISRVNPANIVGKIHASPKLTV 1505

Query: 192  AIQDSLCRY 200
              Q  + R+
Sbjct: 1506 DAQTIMLRF 1514

>Kwal_14.1186
          Length = 781

 Score = 30.4 bits (67), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 47/89 (52%), Gaps = 8/89 (8%)

Query: 978  SIVSLI-KAIDEVSVVKSAADIPQGCV----LQSVNPE-VNVHVLVKGHVDIDAEISKVQ 1031
            S+ +L+ K  D+   +  AADI +GC     L  V PE V+V    +G  + D  I   +
Sbjct: 524  SVFALMGKIFDDGDYINIAADITRGCAHLSQLLGVMPESVHVRSCPEGPCEFDPSIPWDR 583

Query: 1032 KKLDKTLKSKSAIDKIVNSSDYEQKANDQ 1060
             +  KT K++SA+   V+ S  +Q A+++
Sbjct: 584  AR--KTPKAESALGVSVDDSIIDQDASER 610

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 35,045,179
Number of extensions: 1553877
Number of successful extensions: 4998
Number of sequences better than 10.0: 67
Number of HSP's gapped: 5088
Number of HSP's successfully gapped: 113
Length of query: 1075
Length of database: 16,596,109
Length adjustment: 112
Effective length of query: 963
Effective length of database: 12,718,893
Effective search space: 12248293959
Effective search space used: 12248293959
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)