Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0D14927g50749925850.0
Scas_716.3250950410761e-142
ADR034W40440910151e-134
YGR093W5075129991e-131
Kwal_23.39913573508771e-114
CAGL0G03069g4865078351e-106
CAGL0H07271g27852701.2
YKR017C55165701.5
Sklu_1900.165849682.7
CAGL0H10142g37264683.0
Scas_661.2437264647.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D14927g
         (499 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D14927g 1258177..1259700 similar to sp|P53255 Saccharomyces...  1000   0.0  
Scas_716.32                                                           419   e-142
ADR034W [1775] [Homologous to ScYGR093W - SH] complement(767110....   395   e-134
YGR093W (YGR093W) [2053] chr7 (670390..671913) Member of the pro...   389   e-131
Kwal_23.3991                                                          342   e-114
CAGL0G03069g 284268..285728 similar to sp|P53255 Saccharomyces c...   326   e-106
CAGL0H07271g 712654..713490 similar to tr|06667 Saccharomyces ce...    32   1.2  
YKR017C (YKR017C) [3272] chr11 complement(471337..472992) Protei...    32   1.5  
Sklu_1900.1 YMR008C, Contig c1900 2946-4922 reverse complement         31   2.7  
CAGL0H10142g 989652..990770 highly similar to sp|P14843 Saccharo...    31   3.0  
Scas_661.24                                                            29   7.6  

>KLLA0D14927g 1258177..1259700 similar to sp|P53255 Saccharomyces
           cerevisiae YGR093w singleton, start by similarity
          Length = 507

 Score = 1000 bits (2585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/499 (97%), Positives = 487/499 (97%)

Query: 1   MDLLKILVLNTNDESLLDVLAVANTLHNKSGPFACALILGDVKKCSDALTNFQMELPTYI 60
           MDLLKILVLNTNDESLLDVLAVANTLHNKSGPFACALILGDVKKCSDALTNFQMELPTYI
Sbjct: 1   MDLLKILVLNTNDESLLDVLAVANTLHNKSGPFACALILGDVKKCSDALTNFQMELPTYI 60

Query: 61  GNGSELSDGNISHSRDLNENLTVLNGFGFIKLANGLKIGYLAETSKLSDSARAEVLKNFQ 120
           GNGSELSDGNISHSRDLNENLTVLNGFGFIKLANGLKIGYLAETSKLSDSARAEVLKNFQ
Sbjct: 61  GNGSELSDGNISHSRDLNENLTVLNGFGFIKLANGLKIGYLAETSKLSDSARAEVLKNFQ 120

Query: 121 ELSEQTSADILLSYDWSEAISERENLILGNSLVDQVASLMKPKYHFTGKNEKQFFELDPF 180
           ELSEQTSADILLSYDWSEAISERENLILGNSLVDQVASLMKPKYHFTGKNEKQFFELDPF
Sbjct: 121 ELSEQTSADILLSYDWSEAISERENLILGNSLVDQVASLMKPKYHFTGKNEKQFFELDPF 180

Query: 181 VWDHTNEHICRFINVAQFKSGSKWAYAFKINLLEGLETIPDNLIDNPYLEKPSGKRDLVP 240
           VWDHTNEHICRFINVAQFKSGSKWAYAFKINLLEGLETIPDNLIDNPYLEKPSGKRDLVP
Sbjct: 181 VWDHTNEHICRFINVAQFKSGSKWAYAFKINLLEGLETIPDNLIDNPYLEKPSGKRDLVP 240

Query: 241 DPETDNSSAVSKKQRKPKQVLPSECRFCLSNTKLNDHMIISISKFSYITIAKGPLTTPGN 300
           DPETDNSSAVSKKQRKPKQVLPSECRFCLSNTKLNDHMIISISKFSYITIAKGPLTTPGN
Sbjct: 241 DPETDNSSAVSKKQRKPKQVLPSECRFCLSNTKLNDHMIISISKFSYITIAKGPLTTPGN 300

Query: 301 DMDFSGHCLIIPIEHIPKLNTAKQEAVITDTDLFKDLNKFEESIAEMNFKRYDMSTLIFE 360
           DMDFSGHCLIIPIEHIPKLNTAKQEAVITDTDLFKDLNKFEESIAEMNFKRYDMSTLIFE
Sbjct: 301 DMDFSGHCLIIPIEHIPKLNTAKQEAVITDTDLFKDLNKFEESIAEMNFKRYDMSTLIFE 360

Query: 361 INSSNAIHFHKQLIPVPKYLIGNFISALNRQVHMNNEKFKSNAKLXXXXXXXXXXXXYLG 420
           INSSNAIHFHKQLIPVPKYLIGNFISALNRQVHMNNEKFKSNAKL            YLG
Sbjct: 361 INSSNAIHFHKQLIPVPKYLIGNFISALNRQVHMNNEKFKSNAKLEFKEFEGFDDKEYLG 420

Query: 421 LVNDHETNYFQFIIRETASSKPKVYISVFDKDERIDLQFGRRVAAFLLKQPKRTMWDSKV 480
           LVNDHETNYFQFIIRETASSKPKVYISVFDKDERIDLQFGRRVAAFLLKQPKRTMWDSKV
Sbjct: 421 LVNDHETNYFQFIIRETASSKPKVYISVFDKDERIDLQFGRRVAAFLLKQPKRTMWDSKV 480

Query: 481 CFQTKQQEEKDVSNFQRAY 499
           CFQTKQQEEKDVSNFQRAY
Sbjct: 481 CFQTKQQEEKDVSNFQRAY 499

>Scas_716.32
          Length = 509

 Score =  419 bits (1076), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 218/504 (43%), Positives = 309/504 (61%), Gaps = 17/504 (3%)

Query: 5   KILVLNTNDESLLDVLAVANTLHNKSGPFACALILGDVKKCSDALTNFQMELPTYIGNGS 64
           K+LV++  +ES   V+     L+ KSGPF C   LGD+    D + +     P Y    +
Sbjct: 5   KVLVIHLKNESAESVINKVKRLNEKSGPFECIFFLGDLLSKLDQV-DISTLPPIYCF--T 61

Query: 65  ELSDGNISHSRDLNENLTVLNGFGFIKLANGLKIGYLAETSKLSDSARAEVLKNFQELSE 124
            L D  ++ S ++  NLT LNG+G  ++ N L+IGY+A      +  + ++L+ F+ ++ 
Sbjct: 62  SLPDSPVNGSDEVQANLTRLNGYGVYQMTNKLRIGYIALEEAKCNELKDKILEKFKLVN- 120

Query: 125 QTSADILLSYDWSEAISERENLILGNSLVDQVASLMKPKYHFTGKNEKQFFELDPFVWDH 184
               DIL++ +WS  I+E ++ + G+  +D VA L++P+YHFT  +   FFEL+PF+W+ 
Sbjct: 121 -APIDILITREWSTHIAELKDRLSGSDTIDDVAKLLQPRYHFTYSDNDTFFELNPFLWNE 179

Query: 185 TNEHICRFINVAQFKSGSKWAYAFKINLL-------EGLETIPDNLIDNPYLEKPSGKR- 236
             E + RFIN+A + SGSKWAYAF I +        E    +P NLI NPY      KR 
Sbjct: 180 -KESVSRFINLATYGSGSKWAYAFNIKIETDDDIEDEHESNLPTNLISNPYSTTNIKKRP 238

Query: 237 -DLVPDPETDNSSAVSKKQRKPKQVLPSECRFCLSNTKLNDHMIISISKFSYITIAKGPL 295
            DL+ D +    +  S   +KP++VLP +C FC +N  + DHMIISI   +Y+T AKGPL
Sbjct: 239 MDLI-DTDGQQVTKSSISLKKPRKVLPIDCHFCFTNPNMEDHMIISIDDSAYMTTAKGPL 297

Query: 296 TTPGNDMDFSGHCLIIPIEHIPKLNTAKQEAVITDTDLFKDLNKFEESIAEMNFKRYDMS 355
           T P  DM+F GHCLIIPIEHIPK N    ++   +T L KDL  +E S+  MN++++DMS
Sbjct: 298 TVPKGDMNFPGHCLIIPIEHIPKFNNVDGQSPF-ETPLGKDLLAYERSVVNMNYQKFDMS 356

Query: 356 TLIFEINSSNAIHFHKQLIPVPKYLIGNFISALNRQVHMNNEKFKSNAKLXXXXXXXXXX 415
           T++FEINS  +IHFHKQ+ P+PKYLI  F  +L+RQ+H NNEK+  NAKL          
Sbjct: 357 TIVFEINSERSIHFHKQVFPIPKYLIMKFNESLDRQLHFNNEKYSRNAKLNFEKFETTSD 416

Query: 416 XXYLGLVNDHETNYFQFIIRETASSKPKVYISVFDKDERIDLQFGRRVAAFLLKQPKRTM 475
             Y  +V +   NY QF + ET  ++P +Y+S F+ D+R+DLQFGRRV AFLL  P R  
Sbjct: 417 LRYEAIVKNSNMNYLQFTVYETPITEPAIYVSKFELDDRLDLQFGRRVVAFLLHLPNRLN 476

Query: 476 WDSKVCFQTKQQEEKDVSNFQRAY 499
           WDS  C QTK+QE  DV  FQ++Y
Sbjct: 477 WDSPTCQQTKEQEMIDVEKFQKSY 500

>ADR034W [1775] [Homologous to ScYGR093W - SH]
           complement(767110..768324) [1215 bp, 404 aa]
          Length = 404

 Score =  395 bits (1015), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 193/409 (47%), Positives = 273/409 (66%), Gaps = 17/409 (4%)

Query: 96  LKIGYLAETSKLSDSARAEVLKNFQELSEQTSADILLSYDWSEAISERENLILGNSLVDQ 155
           +KIGY   + ++  SA    L+ F+++      DILL+ +W +++  +   + G   VDQ
Sbjct: 1   MKIGYFTPSERIEPSAVDAELEIFKKVGR---LDILLTKEWPKSVRSKLEEVSGTDTVDQ 57

Query: 156 VASLMKPKYHFTGKNEKQFFELDPFVWDHTN-EHICRFINVAQFKSGSKWAYAFKINLLE 214
           +    KP+YHF    +K +FEL+PF WD ++   I RFIN+A F SG KWAYAF I +  
Sbjct: 58  LVISSKPQYHFATLGDK-YFELEPFGWDRSSMPDITRFINLATFGSGEKWAYAFNITVGT 116

Query: 215 GLE-TIPDNLIDNPYLEKPSGKRDLVPDPETDNSSAVSKKQRKPKQVLPSECRFCLSNTK 273
             E ++P NL  NP++     KRDL  DP            +K  +VLP+ C FCLSN  
Sbjct: 117 DQEASVPTNLTTNPFITMDRPKRDLDSDP--------LPPPKKRTKVLPAACHFCLSNPS 168

Query: 274 LNDHMIISISKFSYITIAKGPLTTPGNDMDFSGHCLIIPIEHIPKLNTAKQE---AVITD 330
           + DHM+ISI K SY+TIAKGPL+ P  +M FSGHCLIIPI+H+PK N+A  +   + I +
Sbjct: 169 VEDHMVISIGKHSYLTIAKGPLSVPRGEMTFSGHCLIIPIDHVPKFNSASPDQTTSAIME 228

Query: 331 TDLFKDLNKFEESIAEMNFKRYDMSTLIFEINSSNAIHFHKQLIPVPKYLIGNFISALNR 390
           T++ K++ ++E ++  MN+K++DMSTL+FEINS N++HFHKQ++PVPKYLIG+F +AL+R
Sbjct: 229 TEMGKEVMRYESALVNMNYKKFDMSTLVFEINSVNSVHFHKQVVPVPKYLIGSFTTALDR 288

Query: 391 QVHMNNEKFKSNAKLXXXXXXXXXXXXYLGLVNDHETNYFQFIIRETASSKPKVYISVFD 450
           Q+H+NNEKFK NA              +L LVND +TNY QF + ET  + PKV+I+ F 
Sbjct: 289 QLHINNEKFKKNANFTFQDFEGLQHPDFLALVNDPKTNYMQFTVYETHKASPKVFIATFK 348

Query: 451 KDERIDLQFGRRVAAFLLKQPKRTMWDSKVCFQTKQQEEKDVSNFQRAY 499
            ++ IDLQFGRRVAAFLLK PKR +W+SK C Q+K++EE +V +FQR++
Sbjct: 349 SEDSIDLQFGRRVAAFLLKLPKRVIWNSKACLQSKEEEEIEVKDFQRSF 397

>YGR093W (YGR093W) [2053] chr7 (670390..671913) Member of the
           protein similar to CwfJ N-terminus 1 containing family
           and of the CwfJ N-terminus 2 containing family, has low
           similarity to uncharacterized C. albicans Orf6.6477p
           [1524 bp, 507 aa]
          Length = 507

 Score =  389 bits (999), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 213/512 (41%), Positives = 300/512 (58%), Gaps = 36/512 (7%)

Query: 5   KILVLNTNDESLLDVLAVANTLHNKSGPFACALILGDVKKCSDALTNFQME---LPTYIG 61
           KILV + ++    + +     ++ KSGPF   +I  +         NF++    LP  I 
Sbjct: 5   KILVAHISESDADEAIRKIKKVNEKSGPFDLIIIFSNSYD-----ENFELNTDGLPQLIL 59

Query: 62  NGSELSDGNISHSRDLNENLTVLNGFGFIKLANGLKIGYLAETSKLSDSARAEVLKNFQE 121
              +    N S S+ +NEN+T+L+  G  KLANG+ + Y           +  +L  F +
Sbjct: 60  LSCD--KANNSKSKKINENVTLLHNMGTYKLANGITLSYFIYPDDTLQGEKKSILDEFGK 117

Query: 122 LSEQTSADILLSYDWSEAISERENLILGNSLVDQVASLMKPKYHFTGKNEKQFFELDPFV 181
             +Q   DILL+ +W  +ISER   + G+ +VD++A  ++ +YHF   +E  F+EL+PF 
Sbjct: 118 SEDQ--VDILLTKEWGLSISERCGRLSGSEVVDELAKKLQARYHFAFSDEINFYELEPFQ 175

Query: 182 WDHTNEHICRFINVAQFKSGSKWAYAFKINLLEGL---ETIPDNLIDNPY--LEKPSGKR 236
           W+   E + RF+N+ ++ SG KWAYAF + + +     E  P NLI NPY  +   S KR
Sbjct: 176 WER--ERLSRFLNIPKYGSGKKWAYAFNMPIGDNELKDEPEPPNLIANPYNSVVTNSNKR 233

Query: 237 DLVPDPETDNSSAVSKK---------QRKPKQVLPSECRFCLSNTKLNDHMIISISKFSY 287
            L  + ET+NS    K+          +K + +LPS C FC SN  L DHMIISI K  Y
Sbjct: 234 PL--ETETENSFDGDKQVLANREKNENKKIRTILPSSCHFCFSNPNLEDHMIISIGKLVY 291

Query: 288 ITIAKGPLTTPGNDMDFSGHCLIIPIEHIPKLNTAKQEAVITDTDLFKDLNKFEESIAEM 347
           +T AKGPL+ P  DMD SGHCLIIPIEHIPKL+ +K      + +L + +  +E S+ +M
Sbjct: 292 LTTAKGPLSVPKGDMDISGHCLIIPIEHIPKLDPSK------NAELTQSILAYEASLVKM 345

Query: 348 NFKRYDMSTLIFEINSSNAIHFHKQLIPVPKYLIGNFISALNRQVHMNNEKFKSNAKLXX 407
           N+ ++DM T++FEI S  +IHFHKQ+IPVPKYL+  F SAL+RQVH NNEKF  NAKL  
Sbjct: 346 NYIKFDMCTIVFEIQSERSIHFHKQVIPVPKYLVLKFCSALDRQVHFNNEKFTRNAKLEF 405

Query: 408 XXXXXXXXXXYLGLVNDHETNYFQFIIRETASSKPKVYISVFDKDERIDLQFGRRVAAFL 467
                     Y+ ++N+   NY QF + ET  + PK+Y++ F+  E IDLQFGRRV AFL
Sbjct: 406 QCYDSHSSKQYVDVINNQSNNYLQFTVYETPEADPKIYLATFNASETIDLQFGRRVLAFL 465

Query: 468 LKQPKRTMWDSKVCFQTKQQEEKDVSNFQRAY 499
           L  P+R  W+S  C QTKQQE  +   FQ+AY
Sbjct: 466 LNLPRRVKWNSSTCLQTKQQETIEAEKFQKAY 497

>Kwal_23.3991
          Length = 357

 Score =  342 bits (877), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 171/350 (48%), Positives = 227/350 (64%), Gaps = 8/350 (2%)

Query: 152 LVDQVASLMKPKYHFTGKNEKQFFELDPFVWDHTNEHICRFINVAQFKSGSKWAYAFKIN 211
           +VD V +   PKYHF+      F E+ PF W  TN+   R +N+AQF SG+KWAYAF + 
Sbjct: 10  IVDFVLTNTHPKYHFSATGNDTFQEIAPFKWASTND-TTRCLNLAQFDSGAKWAYAFTVA 68

Query: 212 LLEGLETIPDNLIDNPYLEKPSGKRDLVPDPETDNSSAVSKKQRKPKQVLPSECRFCLSN 271
                + IP  L  NPY  + + KR    + E  ++S +SKK   PKQVLP ECRFC SN
Sbjct: 69  TGVNNQDIPQTLGKNPYEVEITNKR--THESENADNSRISKK---PKQVLPEECRFCFSN 123

Query: 272 TKLNDHMIISISKFSYITIAKGPLTTPGNDMDFSGHCLIIPIEHIPKLNTAKQEAVITDT 331
           + + DH+IISI + +Y+T AKGPLT P ++M+F GHCL+IPI+HIPK+      +     
Sbjct: 124 SSIEDHLIISIGEHAYLTTAKGPLTLPTSNMNFPGHCLVIPIKHIPKMKARHNSSADLSY 183

Query: 332 DLF-KDLNKFEESIAEMNFKRYDMSTLIFEINSSNAIHFHKQLIPVPKYLIGNFISALNR 390
           D F ++  K+EE+IA+MNF +++M T+ FEINS N+IH+HKQ+IPVPKYLI  F SAL R
Sbjct: 184 DPFWRESQKYEEAIAKMNFTKFEMGTVAFEINSENSIHYHKQIIPVPKYLINKFKSALER 243

Query: 391 QVHMNNEKFKSNAKLXXXXXXXXXXXXYLGLVNDHETNYFQFIIRETA-SSKPKVYISVF 449
           QVH NN K+ +NA+L            Y  L+ND+E NY QF + E    + PK Y++ F
Sbjct: 244 QVHFNNTKYTNNAQLEFQEFNGPNDEGYRSLINDYEQNYLQFSVYEGIDGAPPKTYVATF 303

Query: 450 DKDERIDLQFGRRVAAFLLKQPKRTMWDSKVCFQTKQQEEKDVSNFQRAY 499
             DERIDLQFGRRV AF+L+ PKR  WDS  C QT +QE+ DV  FQ+ +
Sbjct: 304 KPDERIDLQFGRRVVAFVLRLPKRAKWDSPACRQTLEQEKNDVREFQKHF 353

>CAGL0G03069g 284268..285728 similar to sp|P53255 Saccharomyces
           cerevisiae YGR093w, hypothetical start
          Length = 486

 Score =  326 bits (835), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 191/507 (37%), Positives = 285/507 (56%), Gaps = 40/507 (7%)

Query: 4   LKILVLN---TNDESLLDVLAVANTLHNKSGPFACALILGDVKKCSDALTNFQMELPTYI 60
           +KI+V N    N +  LD + +AN    K+GPF    +LG  K+     T++ ++    I
Sbjct: 1   MKIMVANPGLENTKEALDKIQIAN---EKNGPFETVFLLGQNKED----TSYDLKDTNTI 53

Query: 61  GNGSELSDGNISHSRDLNENLTVLNGFGFIKLANGLKIGYLAETSKLSDSARAEVLKNFQ 120
              ++L +G  +       ++ +L+GFG +KLA+GL +GY+  +       +  +L+ F+
Sbjct: 54  LVTNQLKNGRTTRK----SSVIILHGFGIMKLASGLVVGYITLSKNSLQQEKKSILEYFK 109

Query: 121 ELSEQTSADILLSYDWSEAI-SERENLILGNSLVDQVASLMKPKYHFTGKNEKQFFELDP 179
              E    D+L++   S+A+ S  +    GNS++D+V    KP+YH T   ++ + ++ P
Sbjct: 110 ASKE--FIDVLVTNIGSKAVASHLQYKANGNSIIDEVMKHCKPQYHLTYDGDRGYHDMKP 167

Query: 180 FVWDHT--NEHICRFINVAQFK--SGSKWAYAFKINLLEGLETIPD---NLIDNPYLEKP 232
           F W  T  +  I R+ N+  +   + SKW  AF I   +    I D    L  NPYL KP
Sbjct: 168 FCWGETSSDSQITRYYNLPSYSPITKSKWIVAFSIEPGKDFNEINDYKNELGTNPYLLKP 227

Query: 233 SGKRDLVPDPETDNSSAVSKKQRKPKQVLPSECRFCLSNTKLNDHMIISISKFSYITIAK 292
           + KRD         S        K  ++  + C FC SN  + D MI++I+K SY+T+AK
Sbjct: 228 ALKRD--------RSGIEQNAHTKKTKIDSTTCHFCFSNPNVEDQMIVAIAKHSYLTLAK 279

Query: 293 GPLTTPGNDMDFSGHCLIIPIEHIPKLNTAKQEAVITDTDLFKDLNKFEESIAEMNFKRY 352
           GPLT P  DM FSGH LI PI H+ K++ +       D +L K++  FE  +A+MN+K +
Sbjct: 280 GPLTVPKGDMSFSGHALITPINHVAKIDKS------LDNELSKEIELFESRVAKMNYKLF 333

Query: 353 DMSTLIFEINSSNAIHFHKQLIPVPKYLIGNFISALNRQVHMNNEKFKSNAKLXXXXXXX 412
           D ST++FEI S  AIHFHKQ+IPVPKYLI  F  AL+RQVH+N+E  + N KL       
Sbjct: 334 DCSTVVFEIQSDKAIHFHKQVIPVPKYLITKFERALDRQVHINSE--RGNCKLEFEKFDG 391

Query: 413 XXXXXYLGLVNDHETNYFQFIIRETASSKPKVYISVFDKDERIDLQFGRRVAAFLLKQPK 472
                Y  +V   +TNY QF I ET +SK  +YIS FD  ER+DLQ+GRR  AF+L  PK
Sbjct: 392 LDNEEYRKIVGRKDTNYLQFTIYETDTSKATIYISSFDITERLDLQYGRRTLAFVLNLPK 451

Query: 473 RTMWDSKVCFQTKQQEEKDVSNFQRAY 499
           R  W+S +C Q+K+QE K+   +Q+++
Sbjct: 452 RVQWNSPICQQSKEQELKEAQLYQKSF 478

>CAGL0H07271g 712654..713490 similar to tr|06667 Saccharomyces
           cerevisiae YDR315c IPK1, hypothetical start
          Length = 278

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 217 ETIPD-NLIDNPYLEKPSGKRDLVPDPETDNSSAVSKKQRKPKQVLPSECRF 267
           + IP+  L+D PY        D V DP++D+ SA++ K  +P  V   + R+
Sbjct: 54  DCIPEMELVDIPYDRISGIIGDFVGDPDSDHVSALTIKNLRPTNVYGEKIRY 105

>YKR017C (YKR017C) [3272] chr11 complement(471337..472992) Protein
           of unknown function, has a TRIAD composite zinc finger
           domain [1656 bp, 551 aa]
          Length = 551

 Score = 31.6 bits (70), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 30/65 (46%), Gaps = 9/65 (13%)

Query: 247 SSAVSKKQRKPKQVL------PSECRFCLSNTKLN---DHMIISISKFSYITIAKGPLTT 297
           ++A  KK RK  ++L        EC  C  N + N   +HM+ S  K+ +  I +GP   
Sbjct: 317 TTAWVKKARKESEILNWVLSHTKECPKCSVNIEKNGGCNHMVCSSCKYEFCWICEGPWAP 376

Query: 298 PGNDM 302
            G + 
Sbjct: 377 HGKNF 381

>Sklu_1900.1 YMR008C, Contig c1900 2946-4922 reverse complement
          Length = 658

 Score = 30.8 bits (68), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 3/49 (6%)

Query: 248 SAVSKKQRKPKQVLPSECRFCLSNTKLNDHM---IISISKFSYITIAKG 293
           + + +KQ+     LP EC  C +N   ND+      SIS ++  TI  G
Sbjct: 553 AVIRRKQQSMNATLPEECEKCFTNYCWNDNASKGSASISSYNNQTITSG 601

>CAGL0H10142g 989652..990770 highly similar to sp|P14843
           Saccharomyces cerevisiae YDR035w ARO3
           2-dehydro-3-deoxyphosphoheptonate aldolase, start by
           similarity
          Length = 372

 Score = 30.8 bits (68), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 33/64 (51%), Gaps = 5/64 (7%)

Query: 203 KWAYAFKINLLEGLETIPDNL--IDNPYLEKPS---GKRDLVPDPETDNSSAVSKKQRKP 257
           K AY +   L    E + D+L  I   YLEKP    G + L+ DP+ DNS  ++K  R  
Sbjct: 76  KAAYEYADKLAVIAEKLSDDLLIIMRAYLEKPRTTVGWKGLINDPDIDNSFQINKGLRIS 135

Query: 258 KQVL 261
           +++ 
Sbjct: 136 REMF 139

>Scas_661.24
          Length = 372

 Score = 29.3 bits (64), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 33/64 (51%), Gaps = 5/64 (7%)

Query: 203 KWAYAFKINLLEGLETIPDNL--IDNPYLEKPS---GKRDLVPDPETDNSSAVSKKQRKP 257
           K AY +   L +   T+  +L  I   YLEKP    G + L+ DP+ DNS  ++K  R  
Sbjct: 76  KAAYEYADRLAKIAATLSKDLLIIMRAYLEKPRTTVGWKGLINDPDIDNSFQINKGLRIS 135

Query: 258 KQVL 261
           +++ 
Sbjct: 136 REMF 139

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.134    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,998,712
Number of extensions: 762411
Number of successful extensions: 2277
Number of sequences better than 10.0: 16
Number of HSP's gapped: 2300
Number of HSP's successfully gapped: 16
Length of query: 499
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 393
Effective length of database: 12,926,601
Effective search space: 5080154193
Effective search space used: 5080154193
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)