Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0D14905g56755828100.0
Kwal_23.399257156521610.0
ADR033W57757121390.0
YGR092W (DBF2)57256119640.0
Scas_716.3357353319560.0
Scas_705.2355351719410.0
CAGL0B04147g56652319380.0
CAGL0G03047g53951619300.0
Kwal_33.145547144785524e-62
CAGL0J06072g7734365545e-62
YNL161W (CBK1)7564705492e-61
KLLA0D07810g7184905447e-61
AFR035W7194845431e-60
Scas_654.127374495361e-59
Scas_689.25*4093023725e-39
YNR047W8933663821e-38
CAGL0K07458g7043723774e-38
Scas_651.183713553625e-38
KLLA0C18568g7743773766e-38
Scas_720.1038043363758e-38
Scas_629.169183873722e-37
YMR104C (YPK2)6773803703e-37
YCR091W (KIN82)7203653693e-37
Kwal_33.138463753813564e-37
ADR167W8733973688e-37
KLLA0B07205g4553613571e-36
Kwal_23.64588683413643e-36
CAGL0C03509g8954173625e-36
ABL028W7223533571e-35
YKL126W (YPK1)6803913562e-35
YKL166C (TPK3)3982983452e-35
AEL115C3862973407e-35
YJL164C (TPK1)3973473409e-35
Scas_721.1246843533454e-34
CAGL0M08404g4622983385e-34
Kwal_47.167617443823447e-34
CAGL0G09020g3613663291e-33
Kwal_26.76356913533402e-33
YHR205W (SCH9)8243913412e-33
Scas_717.696743543392e-33
AFL090W3463033253e-33
CAGL0K03399g7033843384e-33
CAGL0F09075g7464453375e-33
Kwal_56.240593533013246e-33
Scas_703.57493903376e-33
Kwal_56.227885151983318e-33
Scas_690.133543013184e-32
KLLA0B03586g7343913295e-32
KLLA0D03190g3723013195e-32
KLLA0B12716g7163543271e-31
ADL389W7113903242e-31
CAGL0B04301g5422463161e-30
Scas_593.14d4951983122e-30
YBR028C5252003044e-29
KLLA0F24618g5561983044e-29
Scas_715.3411503353012e-28
AEL083W5362242964e-28
YBL105C (PKC1)11513352995e-28
YOL100W (PKH2)10813292951e-27
Kwal_56.226939843452942e-27
YDR490C (PKH1)7663252923e-27
CAGL0M09361g11443282906e-27
AFR377C7262492871e-26
KLLA0E06413g11613352881e-26
YMR001C (CDC5)7053482808e-26
Kwal_27.1058111543672819e-26
ACR191C11493662801e-25
YDR466W (PKH3)8982622782e-25
KLLA0C12485g9252552674e-24
YFL033C (RIM15)17701952632e-23
Scas_660.209572992612e-23
CAGL0I07513g10763412595e-23
AFR335C10332602577e-23
CAGL0K12562g16821652523e-22
KLLA0E03487g6472472503e-22
CAGL0G04609g9652772471e-21
KLLA0F09020g9281562425e-21
CAGL0K06479g9912462409e-21
Scas_707.315981862372e-20
Kwal_56.224766972192353e-20
Kwal_47.183076212692343e-20
Kwal_14.115915211702354e-20
ACR218W15691522345e-20
ACL006W7082352335e-20
KLLA0F11143g8132202318e-20
Scas_502.211162522311e-19
CAGL0K08514g14892612302e-19
ACR142W8372622273e-19
CAGL0J11638g7462572246e-19
Kwal_26.87967962592239e-19
KLLA0C01650g11122582212e-18
AFR696C11422582212e-18
Kwal_56.240913812992152e-18
CAGL0I09504g5281682173e-18
KLLA0B02332g3612532116e-18
KLLA0F09031g6331362158e-18
KLLA0C06138g7082742158e-18
Scas_493.211172532159e-18
Scas_644.157262432141e-17
CAGL0K05709g11032632132e-17
Scas_627.73492522062e-17
YDR507C (GIN4)11422442104e-17
Scas_616.1014612342096e-17
AFL101C3672032011e-16
CAGL0E05720g3582932001e-16
Scas_700.546982742023e-16
Scas_700.288962372023e-16
KLLA0F11319g8431812024e-16
YKL101W (HSL1)15182432024e-16
YBR274W (CHK1)5271691986e-16
CAGL0M02233g7672271997e-16
ABL034W14252501971e-15
Scas_675.25271681942e-15
YGL158W (RCK1)5122321932e-15
Kwal_26.778812672231962e-15
KLLA0F13552g12672831962e-15
Kwal_14.24974181761922e-15
CAGL0M03729g8612021925e-15
Kwal_26.87518482231925e-15
YCL024W (KCC4)10372381926e-15
Kwal_55.215458651671917e-15
CAGL0M02519g7562041908e-15
KLLA0B13112g7301961908e-15
CAGL0M02299g8931811901e-14
KLLA0F01276g5191821853e-14
AFR724C4402771833e-14
Kwal_55.203267501961854e-14
AEL185C5152091825e-14
YOR233W (KIN4)8002041836e-14
YOL113W (SKM1)6552041827e-14
YCR073C (SSK22)13311721837e-14
ABL011C7011921811e-13
YLR362W (STE11)7171971811e-13
Scas_477.57031971801e-13
ACR133C8511811802e-13
KLLA0C04191g7972301792e-13
YGL179C (TOS3)5602161782e-13
CAGL0B02739g6761961782e-13
CAGL0M08910g6122491782e-13
Scas_618.156202301773e-13
CAGL0L07326g5062971753e-13
AFL188C4722731754e-13
Scas_660.286232571754e-13
CAGL0L11550g10721681765e-13
YDL101C (DUN1)5132541736e-13
YDR477W (SNF1)6332491746e-13
CAGL0C05005g10761941757e-13
YNL298W (CLA4)8422021747e-13
KLLA0F12188g5462551737e-13
AER264C14831651758e-13
Kwal_47.182335982491721e-12
AER223C9021971731e-12
ACL191C3651761691e-12
Scas_648.173402041691e-12
CAGL0J03828g4671891711e-12
KLLA0E01584g4152981701e-12
YLR096W (KIN2)11472171721e-12
YNR031C (SSK2)15791731722e-12
Kwal_27.97638682011722e-12
Scas_720.9416831671722e-12
KLLA0E21780g10161671712e-12
Kwal_55.217093402751672e-12
YLR248W (RCK2)6102401702e-12
Kwal_23.52908192021702e-12
AEL230W6082491692e-12
YHR102W (KIC1)10801681712e-12
Scas_580.610151681702e-12
KLLA0F23155g4272231682e-12
Scas_700.348642101693e-12
KLLA0A07403g8792021693e-12
KLLA0C08525g15512721703e-12
Scas_598.67902021693e-12
CAGL0K02673g9151941693e-12
Kwal_0.1555872541683e-12
Kwal_33.141678381961684e-12
AAR009W4531881664e-12
Scas_640.14*7282451675e-12
Kwal_23.632515421661685e-12
KLLA0A03806g6022491675e-12
KLLA0E11979g6141901675e-12
KLLA0A02497g3622841645e-12
Scas_613.55172601665e-12
AAL029W5342831666e-12
YOR351C (MEK1)4972811656e-12
CAGL0B03509g5972271667e-12
KLLA0C00979g4832001657e-12
KLLA0F19536g11042171668e-12
CAGL0M11396g11921831669e-12
AEL205W7932021659e-12
Kwal_33.13222148871529e-12
ACL054W9722811651e-11
Scas_573.105692021641e-11
Kwal_56.237178581831651e-11
ACR119W9311931651e-11
Scas_602.1111862281651e-11
YDL028C (MPS1)7641871641e-11
Scas_673.20*7581971641e-11
Scas_693.1710491831642e-11
Scas_564.712102661632e-11
Scas_628.9621851622e-11
Scas_668.228931941632e-11
Scas_640.165051971612e-11
CAGL0J03872g6611871622e-11
AGR058W10712481622e-11
Kwal_26.87098291821613e-11
Kwal_23.35904992911603e-11
CAGL0D02244g4872081603e-11
Kwal_33.138317001961603e-11
Kwal_0.3074901001584e-11
YHL007C (STE20)9391941595e-11
KLLA0D07348g9091781595e-11
ADR379C4922821576e-11
CAGL0H01639g5212031576e-11
YCR008W (SAT4)603851586e-11
Kwal_0.964271881566e-11
YDR523C (SPS1)4902571576e-11
CAGL0M10153g8671941586e-11
Kwal_26.78619551941587e-11
CAGL0L07810g5962281577e-11
Scas_713.79831951578e-11
Scas_685.245151921568e-11
CAGL0B01925g9441821579e-11
ACL104C9471711579e-11
KLLA0B13607g9891661571e-10
ABR014W9711941571e-10
YJL095W (BCK1)14781761571e-10
AER195C504851551e-10
YOR061W (CKA2)3392911531e-10
Scas_711.2515151761571e-10
Kwal_33.131125052391551e-10
KLLA0F16467g3402041521e-10
CAGL0F00649g5142581541e-10
Kwal_14.12734152051522e-10
YDL025C6201861532e-10
ADR204W3392041502e-10
KLLA0D07304g4651941523e-10
AFR092W14231761533e-10
CAGL0L06006g9422671533e-10
Kwal_27.125594141831513e-10
Kwal_47.1726311272711533e-10
Scas_619.5*5102981513e-10
ACR117W5242081513e-10
CAGL0F04741g4422551503e-10
CAGL0G02035g3392011494e-10
CAGL0K04169g3981711504e-10
YGL180W (ATG1)8972741524e-10
Scas_713.384322511504e-10
ADR300C8902171514e-10
Kwal_23.566816891691525e-10
Scas_713.216411531505e-10
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D14905g
         (558 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D14905g 1256065..1257768 gi|28565036|gb|AAO32601.1 Kluyvero...  1087   0.0  
Kwal_23.3992                                                          837   0.0  
ADR033W [1774] [Homologous to ScYGR092W (DBF2) - SH; ScYPR111W (...   828   0.0  
YGR092W (DBF2) [2052] chr7 (668191..669909) Serine/threonine pro...   761   0.0  
Scas_716.33                                                           758   0.0  
Scas_705.23                                                           752   0.0  
CAGL0B04147g 402798..404498 highly similar to sp|P22204 Saccharo...   751   0.0  
CAGL0G03047g 282299..283918 highly similar to sp|P22204 Saccharo...   748   0.0  
Kwal_33.14554                                                         217   4e-62
CAGL0J06072g complement(572377..574698) similar to sp|P53894 Sac...   218   5e-62
YNL161W (CBK1) [4436] chr14 (332597..334867) Serine/threonine pr...   216   2e-61
KLLA0D07810g complement(669095..671251) gi|401646|sp|P31034|YL44...   214   7e-61
AFR035W [3227] [Homologous to ScYNL161W (CBK1) - SH] complement(...   213   1e-60
Scas_654.12                                                           211   1e-59
Scas_689.25*                                                          147   5e-39
YNR047W (YNR047W) [4630] chr14 (708522..711203) Serine/threonine...   151   1e-38
CAGL0K07458g complement(736336..738450) similar to sp|P12688 Sac...   149   4e-38
Scas_651.18                                                           144   5e-38
KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1 Kluyvero...   149   6e-38
Scas_720.103                                                          149   8e-38
Scas_629.16                                                           147   2e-37
YMR104C (YPK2) [4061] chr13 complement(473419..475452) Serine/th...   147   3e-37
YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine pro...   146   3e-37
Kwal_33.13846                                                         141   4e-37
ADR167W [1909] [Homologous to ScYNR047W - SH; ScYCR091W (KIN82) ...   146   8e-37
KLLA0B07205g complement(624606..625973) some similarities with s...   142   1e-36
Kwal_23.6458                                                          144   3e-36
CAGL0C03509g complement(350846..353533) similar to sp|P53739 Sac...   144   5e-36
ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C (Y...   142   1e-35
YKL126W (YPK1) [3140] chr11 (205353..207395) Serine/threonine pr...   141   2e-35
YKL166C (TPK3) [3104] chr11 complement(134514..135710) Catalytic...   137   2e-35
AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C (...   135   7e-35
YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic...   135   9e-35
Scas_721.124                                                          137   4e-34
CAGL0M08404g complement(836791..838179) some similarities with s...   134   5e-34
Kwal_47.16761                                                         137   7e-34
CAGL0G09020g 860266..861351 highly similar to sp|P06245 Saccharo...   131   1e-33
Kwal_26.7635                                                          135   2e-33
YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine pro...   135   2e-33
Scas_717.69                                                           135   2e-33
AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH] complement(...   129   3e-33
CAGL0K03399g complement(310487..312598) highly similar to sp|P12...   134   4e-33
CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces c...   134   5e-33
Kwal_56.24059                                                         129   6e-33
Scas_703.5                                                            134   6e-33
Kwal_56.22788                                                         132   8e-33
Scas_690.13                                                           127   4e-32
KLLA0B03586g complement(326871..329075) similar to sp|P11792 Sac...   131   5e-32
KLLA0D03190g 267933..269051 highly similar to sp|P06245 Saccharo...   127   5e-32
KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces...   130   1e-31
ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH] complement(...   129   2e-31
CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces c...   126   1e-30
Scas_593.14d                                                          124   2e-30
YBR028C (YBR028C) [220] chr2 complement(294387..295964) Serine/t...   121   4e-29
KLLA0F24618g complement(2288943..2290613) similar to sp|P38070 S...   121   4e-29
Scas_715.34                                                           120   2e-28
AEL083W [2423] [Homologous to ScYBR028C - SH] complement(470964....   118   4e-28
YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase...   119   5e-28
YOL100W (PKH2) [4721] chr15 (129236..132481) Serine/threonine pr...   118   1e-27
Kwal_56.22693                                                         117   2e-27
YDR490C (PKH1) [1306] chr4 complement(1431956..1434256) Serine/t...   117   3e-27
CAGL0M09361g complement(928484..931918) highly similar to sp|P24...   116   6e-27
AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)...   115   1e-26
KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732....   115   1e-26
YMR001C (CDC5) [3966] chr13 complement(269019..271136) Serine/th...   112   8e-26
Kwal_27.10581                                                         112   9e-26
ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..68...   112   1e-25
YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine p...   111   2e-25
KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236 Saccha...   107   4e-24
YFL033C (RIM15) [1651] chr6 complement(69113..74425) Serine/thre...   105   2e-23
Scas_660.20                                                           105   2e-23
CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces c...   104   5e-23
AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C (...   103   7e-23
CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces...   101   3e-22
KLLA0E03487g complement(323764..325707) similar to sgd|S0002874 ...   100   3e-22
CAGL0G04609g complement(437162..440059) similar to sp|Q12236 Sac...   100   1e-21
KLLA0F09020g 836287..839073 weakly similar to sp|P43565 Saccharo...    98   5e-21
CAGL0K06479g 636296..639271 some similarities with tr|Q03306 Sac...    97   9e-21
Scas_707.3                                                             96   2e-20
Kwal_56.22476                                                          95   3e-20
Kwal_47.18307                                                          95   3e-20
Kwal_14.1159                                                           95   4e-20
ACR218W [1265] [Homologous to ScYFL033C (RIM15) - SH] complement...    95   5e-20
ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH] complement(...    94   5e-20
KLLA0F11143g complement(1026129..1028570) similar to sp|P22216 S...    94   8e-20
Scas_502.2                                                             94   1e-19
CAGL0K08514g complement(853314..857783) similar to sp|P34244 Sac...    93   2e-19
ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH] complement...    92   3e-19
CAGL0J11638g complement(1128620..1130860) highly similar to sp|P...    91   6e-19
Kwal_26.8796                                                           91   9e-19
KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces c...    90   2e-18
AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W (...    90   2e-18
Kwal_56.24091                                                          87   2e-18
CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces c...    88   3e-18
KLLA0B02332g complement(206863..207948) similar to sp|P38991 Sac...    86   6e-18
KLLA0F09031g 839103..841004 similar to sp|P43565 Saccharomyces c...    87   8e-18
KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces c...    87   8e-18
Scas_493.2                                                             87   9e-18
Scas_644.15                                                            87   1e-17
CAGL0K05709g complement(555903..559214) similar to sp|Q12263 Sac...    87   2e-17
Scas_627.7                                                             84   2e-17
YDR507C (GIN4) [1321] chr4 complement(1462346..1465774) Serine/t...    86   4e-17
Scas_616.10                                                            85   6e-17
AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH] (249144..25...    82   1e-16
CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces c...    82   1e-16
Scas_700.54                                                            82   3e-16
Scas_700.28                                                            82   3e-16
KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomy...    82   4e-16
YKL101W (HSL1) [3161] chr11 (248566..253122) Serine/threonine pr...    82   4e-16
YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase, re...    81   6e-16
CAGL0M02233g complement(267332..269635) highly similar to sp|P22...    81   7e-16
ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH] complement(3...    80   1e-15
Scas_675.2                                                             79   2e-15
YGL158W (RCK1) [1831] chr7 (207036..208574) Serine/threonine pro...    79   2e-15
Kwal_26.7788                                                           80   2e-15
KLLA0F13552g complement(1252906..1256709) gi|33386566|emb|CAD877...    80   2e-15
Kwal_14.2497                                                           79   2e-15
CAGL0M03729g complement(420316..422901) similar to sp|P48562 Sac...    79   5e-15
Kwal_26.8751                                                           79   5e-15
YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protei...    79   6e-15
Kwal_55.21545                                                          78   7e-15
CAGL0M02519g complement(290723..292993) highly similar to tr|Q03...    78   8e-15
KLLA0B13112g complement(1146006..1148198) similar to sp|P23561 S...    78   8e-15
CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces c...    78   1e-14
KLLA0F01276g complement(120001..121560) similar to sp|P38147 Sac...    76   3e-14
AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH] (1769897..1...    75   3e-14
Kwal_55.20326                                                          76   4e-14
AEL185C [2321] [Homologous to ScYBR274W (CHK1) - SH] (291129..29...    75   5e-14
YOR233W (KIN4) [5024] chr15 (775846..778248) Serine/threonine pr...    75   6e-14
YOL113W (SKM1) [4709] chr15 (104325..106292) Serine/threonine pr...    75   7e-14
YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase...    75   7e-14
ABL011C [581] [Homologous to ScYLR362W (STE11) - SH] (378259..38...    74   1e-13
YLR362W (STE11) [3744] chr12 (849865..852018) MAP kinase kinase ...    74   1e-13
Scas_477.5                                                             74   1e-13
ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023) [...    74   2e-13
KLLA0C04191g 384198..386591 weakly similar to sp|P27636 Saccharo...    74   2e-13
YGL179C (TOS3) [1812] chr7 complement(163413..165095) Serine/thr...    73   2e-13
CAGL0B02739g complement(262590..264620) similar to sp|P23561 Sac...    73   2e-13
CAGL0M08910g complement(887703..889541) highly similar to sp|Q00...    73   2e-13
Scas_618.15                                                            73   3e-13
CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces c...    72   3e-13
AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..902...    72   4e-13
Scas_660.28                                                            72   4e-13
CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces...    72   5e-13
YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kin...    71   6e-13
YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine p...    72   6e-13
CAGL0C05005g complement(467626..470856) similar to sp|P27636 Sac...    72   7e-13
YNL298W (CLA4) [4314] chr14 (68913..71441) Serine/threonine prot...    72   7e-13
KLLA0F12188g 1122745..1124385 similar to sp|P38623 Saccharomyces...    71   7e-13
AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C ...    72   8e-13
Kwal_47.18233                                                          71   1e-12
AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH] (1044971.....    71   1e-12
ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..2757...    70   1e-12
Scas_648.17                                                            70   1e-12
CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces c...    70   1e-12
KLLA0E01584g 149713..150960 highly similar to sp|P39009 Saccharo...    70   1e-12
YLR096W (KIN2) [3511] chr12 (332591..336034) Serine/threonine pr...    71   1e-12
YNR031C (SSK2) [4613] chr14 complement(680693..685432) MAP kinas...    71   2e-12
Kwal_27.9763                                                           71   2e-12
Scas_720.94                                                            71   2e-12
KLLA0E21780g complement(1936438..1939488) similar to sp|P38692 S...    70   2e-12
Kwal_55.21709                                                          69   2e-12
YLR248W (RCK2) [3644] chr12 (634254..636086) Calcium/calmodulin-...    70   2e-12
Kwal_23.5290                                                           70   2e-12
AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH] complement(...    70   2e-12
YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine pro...    70   2e-12
Scas_580.6                                                             70   2e-12
KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces...    69   2e-12
Scas_700.34                                                            70   3e-12
KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces c...    70   3e-12
KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces c...    70   3e-12
Scas_598.6                                                             70   3e-12
CAGL0K02673g complement(240509..243256) similar to sp|Q03497 Sac...    70   3e-12
Kwal_0.155                                                             69   3e-12
Kwal_33.14167                                                          69   4e-12
AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C (C...    69   4e-12
Scas_640.14*                                                           69   5e-12
Kwal_23.6325                                                           69   5e-12
KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235....    69   5e-12
KLLA0E11979g complement(1060048..1061892) some similarities with...    69   5e-12
KLLA0A02497g 218592..219680 highly similar to sp|P14681 Saccharo...    68   5e-12
Scas_613.5                                                             69   5e-12
AAL029W [158] [Homologous to ScYLR248W (RCK2) - SH; ScYGL158W (R...    69   6e-12
YOR351C (MEK1) [5128] chr15 complement(995013..996506) Serine/th...    68   6e-12
CAGL0B03509g complement(349638..351431) similar to sp|P38623 Sac...    69   7e-12
KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces cer...    68   7e-12
KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces...    69   8e-12
CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces...    69   9e-12
AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W (...    68   9e-12
Kwal_33.13222                                                          63   9e-12
ACL054W [995] [Homologous to ScYGL180W (APG1) - SH] complement(2...    68   1e-11
Scas_573.10                                                            68   1e-11
Kwal_56.23717                                                          68   1e-11
ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -...    68   1e-11
Scas_602.11                                                            68   1e-11
YDL028C (MPS1) [834] chr4 complement(400994..403288) Multi-funct...    68   1e-11
Scas_673.20*                                                           68   1e-11
Scas_693.17                                                            68   2e-11
Scas_564.7                                                             67   2e-11
Scas_628.9                                                             67   2e-11
Scas_668.22                                                            67   2e-11
Scas_640.16                                                            67   2e-11
CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces c...    67   2e-11
AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W (...    67   2e-11
Kwal_26.8709                                                           67   3e-11
Kwal_23.3590                                                           66   3e-11
CAGL0D02244g complement(229504..230967) similar to sp|P24719 Sac...    66   3e-11
Kwal_33.13831                                                          66   3e-11
Kwal_0.307                                                             65   4e-11
YHL007C (STE20) [2279] chr8 complement(95113..97932) Serine/thre...    66   5e-11
KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062 Sacch...    66   5e-11
ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH] (1386601..1...    65   6e-11
CAGL0H01639g 158967..160532 similar to sp|P08458 Saccharomyces c...    65   6e-11
YCR008W (SAT4) [542] chr3 (128467..130278) Serine/threonine prot...    65   6e-11
Kwal_0.96                                                              65   6e-11
YDR523C (SPS1) [1335] chr4 complement(1485554..1487026) Serine/t...    65   6e-11
CAGL0M10153g complement(1010688..1013291) some similarities with...    65   6e-11
Kwal_26.7861                                                           65   7e-11
CAGL0L07810g complement(857656..859446) similar to sp|P25333 Sac...    65   7e-11
Scas_713.7                                                             65   8e-11
Scas_685.24                                                            65   8e-11
CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces c...    65   9e-11
ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH] (157357..160...    65   9e-11
KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497 Saccha...    65   1e-10
ABR014W [605] [Homologous to ScYHL007C (STE20) - SH] complement(...    65   1e-10
YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine pr...    65   1e-10
AER195C [2697] [Homologous to ScYCR008W (SAT4) - SH] (1005431..1...    64   1e-10
YOR061W (CKA2) [4869] chr15 (441535..442554) Casein kinase II (P...    64   1e-10
Scas_711.25                                                            65   1e-10
Kwal_33.13112                                                          64   1e-10
KLLA0F16467g 1519800..1520822 highly similar to sp|P19454 Saccha...    63   1e-10
CAGL0F00649g 71961..73505 similar to sp|P38623 Saccharomyces cer...    64   1e-10
Kwal_14.1273                                                           63   2e-10
YDL025C (YDL025C) [836] chr4 complement(405341..407203) Serine/t...    64   2e-10
ADR204W [1945] [Homologous to ScYOR061W (CKA2) - SH] complement(...    62   2e-10
KLLA0D07304g 623352..624749 some similarities with sp|P32491 Sac...    63   3e-10
AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH] complement(...    64   3e-10
CAGL0L06006g complement(670707..673535) similar to sp|P53104 Sac...    64   3e-10
Kwal_27.12559                                                          63   3e-10
Kwal_47.17263                                                          64   3e-10
Scas_619.5*                                                            63   3e-10
ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C (...    63   3e-10
CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces c...    62   3e-10
CAGL0G02035g 179911..180930 highly similar to sp|P19454 Saccharo...    62   4e-10
CAGL0K04169g 383738..384934 similar to sp|P14681 Saccharomyces c...    62   4e-10
YGL180W (ATG1) [1811] chr7 (160069..162762) Serine/threonine pro...    63   4e-10
Scas_713.38                                                            62   4e-10
ADR300C [2042] [Homologous to ScYHR082C (KSP1) - SH] (1222346..1...    63   4e-10
Kwal_23.5668                                                           63   5e-10
Scas_713.21                                                            62   5e-10
KLLA0E17127g complement(1515721..1518279) similar to sp|P38691 S...    63   5e-10
Scas_633.29                                                            63   5e-10
AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919) [...    62   6e-10
YIL035C (CKA1) [2632] chr9 complement(287789..288907) Casein kin...    62   6e-10
CAGL0J00539g 47095..48561 highly similar to sp|Q00772 Saccharomy...    62   6e-10
YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine prot...    62   7e-10
Kwal_23.5576                                                           62   7e-10
CAGL0L03520g complement(401103..405446) similar to sp|Q01389 Sac...    62   8e-10
Kwal_14.1416                                                           61   9e-10
KLLA0E04136g 382874..383995 similar to sp|P15790 Saccharomyces c...    61   9e-10
AFR019W [3211] [Homologous to ScYBL016W (FUS3) - SH] complement(...    61   9e-10
YLR113W (HOG1) [3526] chr12 (371621..372928) MAP kinase (MAPK), ...    61   9e-10
Scas_700.35                                                            61   9e-10
CAGL0K01617g complement(142479..144803) similar to sp|P54199 Sac...    62   1e-09
CAGL0I03498g 297344..298699 similar to sp|P06784 Saccharomyces c...    61   1e-09
Scas_688.14                                                            61   1e-09
KLLA0F23507g complement(2198603..2200066) similar to sp|P24719 S...    61   1e-09
YOR231W (MKK1) [5022] chr15 (772601..774127) Serine/threonine pr...    61   1e-09
CAGL0H01199g 110610..115556 highly similar to sp|P15442 Saccharo...    62   1e-09
Scas_683.6                                                             60   1e-09
Kwal_17.2687                                                           60   1e-09
Scas_651.19                                                            61   1e-09
KLLA0B11902g 1041657..1043144 gi|7385125|gb|AAF61706.1|AF226711_...    60   2e-09
YFR014C (CMK1) [1695] chr6 complement(172529..173869) Calcium/ca...    60   2e-09
YBL016W (FUS3) [179] chr2 (192416..193477) Serine/threonine prot...    60   2e-09
CAGL0M11748g 1167306..1168649 highly similar to sp|P32485 Saccha...    60   2e-09
Kwal_27.10004                                                          60   3e-09
Scas_707.34                                                            60   3e-09
Kwal_26.8703                                                           60   3e-09
Scas_710.28                                                            59   3e-09
ADR317C [2058] [Homologous to ScYDL028C (MPS1) - SH] (1263082..1...    60   3e-09
AGL242C [4070] [Homologous to ScYPL031C (PHO85) - SH] (246896..2...    59   4e-09
KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyvero...    60   4e-09
Kwal_47.17252                                                          60   4e-09
YOL128C (YGK3) [4695] chr15 complement(78351..79478) Member of t...    59   4e-09
Kwal_55.20189                                                          60   4e-09
CAGL0E01683g complement(166584..167711) highly similar to sp|P21...    59   4e-09
Kwal_26.7355                                                           60   5e-09
KLLA0D11990g join(complement(1023928..1023944), gi|2499590|sp|Q9...    58   5e-09
Scas_704.50                                                            59   5e-09
YOL016C (CMK2) [4800] chr15 complement(294777..296120) Calcium/c...    59   5e-09
KLLA0B11946g complement(1048033..1049352) similar to sp|P41808 S...    59   5e-09
CAGL0K10604g complement(1029226..1030566) similar to sp|P27466 S...    59   5e-09
CAGL0I05192g complement(493635..494756) highly similar to sp|P15...    59   5e-09
Scas_635.1                                                             59   5e-09
Kwal_47.18098                                                          59   5e-09
KLLA0E12177g 1080245..1081612 gi|4096112|gb|AAC99804.1 Kluyverom...    59   6e-09
ADL102C [1639] [Homologous to ScYIL035C (CKA1) - SH] (503670..50...    58   6e-09
AGR048C [4358] [Homologous to ScYLR113W (HOG1) - SH] (807470..80...    59   6e-09
YDR283C (GCN2) [1112] chr4 complement(1025062..1030041) Serine/t...    59   6e-09
Scas_678.24                                                            59   7e-09
YHR030C (SLT2) [2317] chr8 complement(168882..170336) Serine/thr...    59   7e-09
KLLA0A06820g complement(615686..618004) some similarities with s...    59   8e-09
KLLA0E10527g 929989..931104 similar to sp|P16892 Saccharomyces c...    58   9e-09
KLLA0C07535g 658746..660620 some similarities with sgd|S0005793 ...    58   9e-09
ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH] (146098..14...    58   1e-08
CAGL0I06248g 600351..602792 similar to sp|P38970 Saccharomyces c...    59   1e-08
Scas_689.24                                                            58   1e-08
AER232C [2734] [Homologous to ScYHR030C - SH; ScYKL161C (SLT2) -...    58   1e-08
KLLA0F20053g 1867209..1868543 highly similar to sp|P32485 Saccha...    58   1e-08
KLLA0C03828g 349187..351568 similar to sp|P54199 Saccharomyces c...    58   1e-08
CAGL0D02002g 207419..209080 similar to sp|Q03957 Saccharomyces c...    58   1e-08
Kwal_56.23841                                                          57   2e-08
Scas_698.37                                                            57   2e-08
CAGL0D01694g complement(176981..178279) similar to sp|P41808 Sac...    57   2e-08
YJL128C (PBS2) [2790] chr10 complement(178015..180021) MAP kinas...    57   2e-08
Kwal_27.11803                                                          55   2e-08
Kwal_27.9773                                                           57   2e-08
YDL159W (STE7) [712] chr4 (172482..174029) Serine/threonine/tyro...    57   2e-08
YGR040W (KSS1) [2006] chr7 (575400..576506) Serine/threonine pro...    57   2e-08
Kwal_33.14192                                                          57   2e-08
CAGL0K02167g complement(191468..194956) similar to sp|P38990 Sac...    57   2e-08
Scas_718.90                                                            57   2e-08
KLLA0C04213g 386815..387999 similar to sp|P22209 Saccharomyces c...    57   2e-08
YNL307C (MCK1) [4306] chr14 complement(56446..57573) Member of t...    56   3e-08
Kwal_26.7552                                                           57   3e-08
YKL139W (CTK1) [3128] chr11 (182963..184549) C-terminal domain (...    57   3e-08
AEL118C [2388] [Homologous to ScYKL168C (KKQ8) - SH; ScYJL165C (...    57   3e-08
KLLA0C10802g complement(926916..931934) similar to sp|P15442 Sac...    57   3e-08
ACR196C [1243] [Homologous to ScYDL159W (STE7) - SH] (692321..69...    57   3e-08
Scas_707.36                                                            57   3e-08
CAGL0K01661g complement(146952..148400) some similarities with t...    56   4e-08
KLLA0C16577g complement(1451181..1452695) some similarities with...    56   4e-08
CAGL0K04301g 404419..405486 similar to sp|P53233 Saccharomyces c...    55   4e-08
AAL083W [104] [Homologous to ScYDR283C (GCN2) - SH] complement(1...    57   5e-08
Scas_568.9*                                                            55   5e-08
Scas_582.1                                                             56   6e-08
Kwal_55.22001                                                          55   6e-08
CAGL0J04290g complement(400939..402012) similar to sp|P16892 Sac...    55   6e-08
CAGL0L05632g 610481..612514 similar to sp|P08018 Saccharomyces c...    56   6e-08
KLLA0C17160g 1498959..1501454 similar to sp|P53104 Saccharomyces...    56   6e-08
Scas_643.20                                                            56   7e-08
CAGL0F00913g 97023..100643 similar to sp|P31374 Saccharomyces ce...    55   8e-08
Kwal_56.24584                                                          55   9e-08
YLL019C (KNS1) [3399] chr12 complement(105685..107898) Serine/th...    55   9e-08
ACL053C [996] [Homologous to ScYER129W (PAK1) - SH; ScYGL179C (T...    55   9e-08
YKL168C (KKQ8) [3102] chr11 complement(131293..133497) Serine/th...    55   1e-07
Scas_653.25                                                            55   1e-07
AGL249C [4063] [Homologous to ScYPL042C (SSN3) - SH] (234347..23...    55   1e-07
ADR253W [1994] [Homologous to ScYMR139W (RIM11) - SH; ScYDL079C ...    54   1e-07
Scas_201.1*                                                            53   1e-07
YER129W (PAK1) [1559] chr5 (417277..420705) Protein kinase capab...    55   2e-07
Scas_22.1                                                              53   2e-07
KLLA0E14828g complement(1323743..1324675) gi|27526973|emb|CAD369...    54   2e-07
Scas_548.6                                                             55   2e-07
YAR018C (KIN3) [73] chr1 complement(170393..171700) Serine/threo...    54   2e-07
CAGL0L12474g complement(1345044..1345952) highly similar to sp|P...    53   2e-07
YOR267C (HRK1) [5054] chr15 complement(822585..824864) Serine/th...    54   2e-07
KLLA0E15378g 1362851..1365025 some similarities with sp|P08018 S...    54   2e-07
ADL168C [1573] [Homologous to ScYNL307C (MCK1) - SH; ScYOL128C -...    54   2e-07
YDL079C (MRK1) [789] chr4 complement(312951..314044,314337..3147...    54   2e-07
YAL017W (PSK1) [51] chr1 (120228..124298) Serine/threonine prote...    54   2e-07
Scas_667.18                                                            54   2e-07
Scas_610.7                                                             54   2e-07
AFL217C [2978] [Homologous to ScYJL128C (PBS2) - SH] (30765..328...    54   2e-07
KLLA0D09328g complement(788565..791705) some similarities with s...    54   3e-07
Scas_683.12                                                            53   3e-07
Scas_721.110                                                           54   3e-07
KLLA0E07414g complement(672690..673787) highly similar to sp|P21...    53   3e-07
CAGL0H07535g 736241..737137 highly similar to sp|P00546 Saccharo...    52   3e-07
Scas_623.11                                                            53   3e-07
Scas_544.6                                                             53   4e-07
ADR313W [2054] [Homologous to ScYDL025C - SH] complement(1255932...    53   4e-07
CAGL0M08360g complement(833220..835520) some similarities with s...    53   5e-07
YMR139W (RIM11) [4096] chr13 (546124..547236) Member of the GSK3...    52   5e-07
CAGL0H06259g 615045..619055 similar to sp|P31374 Saccharomyces c...    53   5e-07
KLLA0D11814g complement(1007240..1009021) similar to sp|P39073 S...    53   5e-07
CAGL0C02893g complement(286017..287966) similar to tr|Q08732 Sac...    53   5e-07
YBR160W (CDC28) [345] chr2 (560034..560930) Cyclin-dependent pro...    52   6e-07
Kwal_23.4276                                                           52   6e-07
YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase ...    53   6e-07
KLLA0F17006g complement(1561859..1563106) gi|3127831|emb|CAA6115...    52   6e-07
Kwal_27.11830                                                          52   7e-07
Scas_721.46                                                            52   7e-07
KLLA0F07623g 720246..723935 similar to sp|P31374 Saccharomyces c...    52   7e-07
ADL043C [1698] [Homologous to ScYLL019C (KNS1) - SH] (612091..61...    52   9e-07
Scas_680.20                                                            52   9e-07
YKL048C (ELM1) [3211] chr11 complement(346859..348781) Serine/th...    52   9e-07
ADR174C [1916] [Homologous to ScYOR267C - SH] (1008798..1010813)...    52   9e-07
KLLA0E08371g complement(756205..758538) similar to sp|P40494 Sac...    52   1e-06
CAGL0J11308g 1097845..1100031 similar to sp|P22211 Saccharomyces...    52   1e-06
Kwal_47.17868                                                          51   1e-06
YOL045W (PSK2) [4773] chr15 (243495..246800) Serine/threonine pr...    52   1e-06
KLLA0B09790g complement(855327..856214) highly similar to sp|P00...    51   1e-06
Kwal_33.14081                                                          52   1e-06
KLLA0C03938g complement(358851..360632) some similarities with s...    52   1e-06
Scas_618.8                                                             51   1e-06
CAGL0L12650g 1357789..1359492 similar to sp|P39073 Saccharomyces...    51   1e-06
Kwal_26.8347                                                           51   2e-06
Scas_634.5                                                             51   2e-06
ADR058C [1799] [Homologous to ScYBR160W (CDC28) - SH] (810941..8...    50   2e-06
AFR205C [3397] [Homologous to ScYKL139W (CTK1) - SH] (805583..80...    51   2e-06
KLLA0B07579g 659591..661759 weakly similar to sp|P32944 Saccharo...    51   2e-06
CAGL0G05720g complement(547617..549833) similar to sp|P22211 Sac...    51   2e-06
YHR082C (KSP1) [2372] chr8 complement(268460..271549) Serine/thr...    51   2e-06
Scas_692.24                                                            51   2e-06
ABR177C [770] [Homologous to ScYPR161C (SGV1) - SH] (735828..738...    51   2e-06
AGR334W [4645] [Homologous to ScYMR291W - SH] complement(1354612...    50   2e-06
Scas_677.18                                                            51   2e-06
CAGL0H10318g complement(1006299..1007222) highly similar to sp|P...    50   3e-06
Scas_703.47                                                            50   4e-06
KLLA0A02717g 245082..246380 some similarities with sp|P53233 Sac...    50   4e-06
Scas_649.30                                                            50   4e-06
CAGL0L06820g 767038..768138 highly similar to sp|P38615 Saccharo...    49   4e-06
CAGL0M13541g 1332296..1334164 similar to sp|Q03533 Saccharomyces...    50   5e-06
YGR052W (YGR052W) [2015] chr7 (593598..594707) Serine/threonine ...    49   5e-06
ADL283W [1458] [Homologous to ScYDL108W (KIN28) - SH] complement...    49   6e-06
CAGL0F03707g complement(359839..361665) similar to sp|Q08732 Sac...    49   6e-06
CAGL0M13167g complement(1291524..1293356) similar to sp|P32801 S...    49   6e-06
ACR281C [1328] [Homologous to ScYOL045W - SH; ScYAL017W (FUN31) ...    50   6e-06
AER222C [2724] [Homologous to ScYAR018C (KIN3) - SH] (1043479..1...    49   7e-06
Kwal_23.3471                                                           48   7e-06
Scas_568.13                                                            49   8e-06
KLLA0D10527g 892955..894892 similar to sp|P23293 Saccharomyces c...    49   8e-06
Scas_584.11                                                            49   9e-06
Kwal_26.7154                                                           49   9e-06
Scas_695.33                                                            49   1e-05
YKL161C (YKL161C) [3109] chr11 complement(149391..150692) Serine...    48   1e-05
Kwal_27.11919                                                          47   1e-05
CAGL0F03311g complement(327599..330736) similar to sp|P38691 Sac...    49   1e-05
ABR088C [679] [Homologous to ScYKL048C (ELM1) - SH] (546324..547...    48   1e-05
Scas_716.73                                                            48   1e-05
YDR247W (VHS1) [1081] chr4 (956005..957390) Serine/threonine pro...    48   1e-05
Scas_651.3                                                             49   1e-05
KLLA0F22297g complement(2083448..2085547) some similarities with...    48   1e-05
Scas_684.28                                                            48   1e-05
KLLA0A09713g 851952..853625 similar to sp|Q03533 Saccharomyces c...    48   2e-05
AFR150C [3342] [Homologous to ScYFL029C (CAK1) - SH] (707306..70...    47   2e-05
YKL198C (PTK1) [3074] chr11 complement(68274..70223) Protein con...    48   2e-05
Scas_613.13*                                                           47   2e-05
CAGL0J04972g 472984..474003 some similarities with tr|Q12100 Sac...    47   2e-05
Kwal_55.21900                                                          48   2e-05
CAGL0I08349g complement(813728..815731) similar to sp|P23293 Sac...    48   2e-05
Kwal_26.8941                                                           48   2e-05
AFR372W [3564] [Homologous to ScYJR059W (PTK2 ) - SH] complement...    47   2e-05
CAGL0D06600g 626571..628748 similar to tr|Q12399 Saccharomyces c...    47   3e-05
YDL214C (PRR2) [660] chr4 complement(74447..76546) Serine/threon...    47   3e-05
Scas_336.1                                                             47   3e-05
Scas_718.72                                                            47   3e-05
YDL108W (KIN28) [761] chr4 (267698..267725,267807..268699) Cycli...    46   3e-05
CAGL0G04455g 426386..428641 similar to sp|P32581 Saccharomyces c...    47   3e-05
YJL165C (HAL5) [2756] chr10 complement(106887..109454) Serine/th...    47   4e-05
KLLA0D08415g 714473..716797 similar to sp|P22211 Saccharomyces c...    47   4e-05
Kwal_33.14434                                                          47   4e-05
CAGL0H09152g complement(895722..898055) similar to sp|P47116 Sac...    47   5e-05
CAGL0K11275g 1093797..1095374 similar to tr|Q03785 Saccharomyces...    46   5e-05
KLLA0F26983g 2489326..2490729 some similarities with sp|P32801 S...    46   6e-05
YJL141C (YAK1) [2777] chr10 complement(147885..150308) Serine/th...    46   6e-05
Kwal_33.13984                                                          46   7e-05
KLLA0D12100g complement(1031728..1033161) some similarities with...    46   7e-05
Scas_673.34*                                                           46   8e-05
KLLA0B06501g complement(576636..579089) some similarities with s...    46   8e-05
Kwal_47.17345                                                          46   8e-05
Kwal_33.13681                                                          45   1e-04
Scas_671.16                                                            45   1e-04
ACR249C [1296] [Homologous to ScYJL141C (YAK1) - SH] (797020..79...    45   1e-04
YNL183C (NPR1) [4417] chr14 complement(293137..295509) Serine/th...    45   1e-04
KLLA0A05819g 541545..543659 similar to sp|P14680 Saccharomyces c...    45   1e-04
CAGL0I04422g 394159..395427 some similarities with sp|P22209 Sac...    45   1e-04
Kwal_27.11777                                                          45   1e-04
Scas_655.2                                                             45   1e-04
YBR059C (AKL1) [250] chr2 complement(356821..360147) Serine/thre...    45   1e-04
CAGL0I05896g 560169..562505 some similarities with sp|P14680 Sac...    45   2e-04
YMR291W (YMR291W) [4245] chr13 (852629..854389) Serine/threonine...    45   2e-04
CAGL0G02607g complement(240244..242310) similar to sp|P40494 Sac...    45   2e-04
ADR163W [1905] [Homologous to ScYDR247W - SH; ScYPL026C (SKS1) -...    44   2e-04
AEL149C [2357] [Homologous to ScYJL187C (SWE1) - SH] (348350..35...    45   2e-04
ABL143C [449] [Homologous to ScYNL183C (NPR1) - SH; ScYDL214C (P...    45   2e-04
YJR059W (PTK2) [2953] chr10 (545701..548157) Serine/threonine pr...    45   2e-04
YKL116C (PRR1) [3148] chr11 complement(220990..222546) Serine/th...    44   3e-04
KLLA0C14278g 1240990..1242615 similar to sp|P28708 Saccharomyces...    44   3e-04
Scas_721.132                                                           44   3e-04
Kwal_27.9804                                                           44   3e-04
Scas_601.6                                                             44   4e-04
YHR079C (IRE1) [2368] chr8 complement(258245..261592) Protein ki...    44   4e-04
CAGL0K11990g complement(1155395..1158370) some similarities with...    44   4e-04
CAGL0I05390g complement(508677..510041) similar to sp|Q12505 Sac...    43   7e-04
YDL017W (CDC7) [843] chr4 (424206..425729) Protein kinase that a...    43   7e-04
CAGL0H01837g complement(176352..178736) tr|Q9C1R8 Candida glabra...    43   7e-04
Scas_661.27                                                            43   7e-04
YJL187C (SWE1) [2737] chr10 complement(76802..79261) Serine/tyro...    43   7e-04
ADL217W [1524] [Homologous to ScYIL095W (PRK1) - SH; ScYNL020C (...    42   0.001
Scas_678.13                                                            42   0.001
KLLA0F18612g 1711131..1713575 some similarities with sp|P38080 S...    42   0.001
Scas_711.15                                                            42   0.001
YJL106W (IME2) [2809] chr10 (221307..223244) Serine/threonine pr...    42   0.001
CAGL0K11550g 1118142..1119758 similar to sp|P28708 Saccharomyces...    42   0.001
Scas_721.61                                                            42   0.001
YIL095W (PRK1) [2580] chr9 (183934..186366) Serine/threonine pro...    42   0.002
AGR027C [4337] [Homologous to ScYBR059C (AKL1) - SH] (763309..76...    42   0.002

>KLLA0D14905g 1256065..1257768 gi|28565036|gb|AAO32601.1
           Kluyveromyces lactis DBF2, start by similarity
          Length = 567

 Score = 1087 bits (2810), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 535/558 (95%), Positives = 535/558 (95%)

Query: 1   MFTRDANGRHKEVDALVDDMVNFSFDTDAKVMLDPPSTPTRIRGSPSPTRSIVKNPENSL 60
           MFTRDANGRHKEVDALVDDMVNFSFDTDAKVMLDPPSTPTRIRGSPSPTRSIVKNPENSL
Sbjct: 1   MFTRDANGRHKEVDALVDDMVNFSFDTDAKVMLDPPSTPTRIRGSPSPTRSIVKNPENSL 60

Query: 61  MDIDDDTQGDLTADITKSPKKLPKDFYKKSSKTKSKRLVSVCQMYFLDYYCDMFDYVISR 120
           MDIDDDTQGDLTADITKSPKKLPKDFYKKSSKTKSKRLVSVCQMYFLDYYCDMFDYVISR
Sbjct: 61  MDIDDDTQGDLTADITKSPKKLPKDFYKKSSKTKSKRLVSVCQMYFLDYYCDMFDYVISR 120

Query: 121 RERTRQVINYLEEQRRSNLMGTEQITNEWQGYLTKETNILRKRRLKPKHKDFEMITXXXX 180
           RERTRQVINYLEEQRRSNLMGTEQITNEWQGYLTKETNILRKRRLKPKHKDFEMIT    
Sbjct: 121 RERTRQVINYLEEQRRSNLMGTEQITNEWQGYLTKETNILRKRRLKPKHKDFEMITQVGQ 180

Query: 181 XXXXXXXLARKKDTKEICAXXXXXXXXXXXXEGTDHVLTERDILTTTRSEWLVKLLYAFQ 240
                  LARKKDTKEICA            EGTDHVLTERDILTTTRSEWLVKLLYAFQ
Sbjct: 181 GGYGQVYLARKKDTKEICALKILNKKLLMKLEGTDHVLTERDILTTTRSEWLVKLLYAFQ 240

Query: 241 DPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPEN 300
           DPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPEN
Sbjct: 241 DPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPEN 300

Query: 301 FLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLR 360
           FLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLR
Sbjct: 301 FLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLR 360

Query: 361 EEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGNSTNETYE 420
           EEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGNSTNETYE
Sbjct: 361 EEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGNSTNETYE 420

Query: 421 NLRNWKHVLQRPKCDNGRYAFSDRTWELITRLIADPINRLKSFEHVKRMRYFSEIDFNTL 480
           NLRNWKHVLQRPKCDNGRYAFSDRTWELITRLIADPINRLKSFEHVKRMRYFSEIDFNTL
Sbjct: 421 NLRNWKHVLQRPKCDNGRYAFSDRTWELITRLIADPINRLKSFEHVKRMRYFSEIDFNTL 480

Query: 481 RTIHPPFIPQLDNEEDVGYFDDFTNEEHMARYVDVFKRQDRLTAMVDDSLSDSKLVGFTF 540
           RTIHPPFIPQLDNEEDVGYFDDFTNEEHMARYVDVFKRQDRLTAMVDDSLSDSKLVGFTF
Sbjct: 481 RTIHPPFIPQLDNEEDVGYFDDFTNEEHMARYVDVFKRQDRLTAMVDDSLSDSKLVGFTF 540

Query: 541 RHRNGKDGSSGVLYGGLE 558
           RHRNGKDGSSGVLYGGLE
Sbjct: 541 RHRNGKDGSSGVLYGGLE 558

>Kwal_23.3992
          Length = 571

 Score =  837 bits (2161), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/565 (70%), Positives = 469/565 (83%), Gaps = 10/565 (1%)

Query: 1   MFTRDANGRHKEVDALVDDMVNFSFDT--DAKVMLDPPSTPTRIRG---SPSPTRSI--V 53
           M+ +    R++++++L D++   SFD   D+     PPSTP++ RG   +PSP++S+   
Sbjct: 1   MYQKSTTNRYRDIESLTDNIGQLSFDAAVDSPKYHYPPSTPSKFRGDVDNPSPSKSVNGA 60

Query: 54  KNPENSLMDIDDDTQGDLTADITKSPKKLPKDFYKKSSKTKSKRLVSVCQMYFLDYYCDM 113
                S+MDIDD +  D+  D T+SPKKLP DF++K+S T +KRLV+VCQMYFLDYYCDM
Sbjct: 61  DVSRTSMMDIDDTSNVDI--DYTQSPKKLPLDFHRKASSTNTKRLVNVCQMYFLDYYCDM 118

Query: 114 FDYVISRRERTRQVINYLEEQRRSNLMGTEQITNEWQGYLTKETNILRKRRLKPKHKDFE 173
           FDYVISRRERTRQV+ YLE+QR   ++G E+++ EWQ YLTKET ILRKRRLKPK+KDFE
Sbjct: 119 FDYVISRRERTRQVMKYLEQQRTQGIVG-EELSKEWQAYLTKETGILRKRRLKPKNKDFE 177

Query: 174 MITXXXXXXXXXXXLARKKDTKEICAXXXXXXXXXXXXEGTDHVLTERDILTTTRSEWLV 233
           MIT           LARK+DT+EICA              T+HVLTERDILTTTRSEWLV
Sbjct: 178 MITQVGQGGYGQVYLARKRDTREICALKILNKKLLIKLNETNHVLTERDILTTTRSEWLV 237

Query: 234 KLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTH 293
           KLLYAFQDP SLYLAMEFVPGGD+RTLL+NT+FLQAPHARFYISEMFCAV+ALHQLGYTH
Sbjct: 238 KLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTH 297

Query: 294 RDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRR 353
           RDLKPENFLIDS+GHIKLTDFGLA+GTVSMERIESMKIRL+EVKNL+FP+F E+SM+DRR
Sbjct: 298 RDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRR 357

Query: 354 RMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGN 413
            MY  LRE +V YA STVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSG+
Sbjct: 358 EMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGS 417

Query: 414 STNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITRLIADPINRLKSFEHVKRMRYFS 473
           STNETYENLR WK VL+RP+CDNGRYAFSDRTW+LI RLIADPI+RL+SFEHVK+M+YF+
Sbjct: 418 STNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRLIADPISRLRSFEHVKKMKYFA 477

Query: 474 EIDFNTLRTIHPPFIPQLDNEEDVGYFDDFTNEEHMARYVDVFKRQDRLTAMVDDSLSDS 533
           EI F  LR + PPFIPQLDNE D GYFDDFT+E  MA+Y DVFKRQD+L+AMVDDS + S
Sbjct: 478 EISFENLRNVSPPFIPQLDNETDAGYFDDFTSEADMAKYADVFKRQDKLSAMVDDSDAVS 537

Query: 534 KLVGFTFRHRNGKDGSSGVLYGGLE 558
           KLVGFT+RH+ GK+GSSGV+YGG E
Sbjct: 538 KLVGFTYRHKKGKNGSSGVIYGGPE 562

>ADR033W [1774] [Homologous to ScYGR092W (DBF2) - SH; ScYPR111W
           (DBF20) - SH] complement(764718..766451) [1734 bp, 577
           aa]
          Length = 577

 Score =  828 bits (2139), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/571 (70%), Positives = 473/571 (82%), Gaps = 16/571 (2%)

Query: 1   MFTRDANGRHKEVDALVDDMVNFSFDTDAK----VMLDPPSTPTR-IRGSP---SPTRS- 51
           MF+   N   ++VDAL  D+   SF+ + +    +++DPP TP+R ++ +P   SP    
Sbjct: 1   MFSGRGNNV-RDVDALAQDIGQLSFEGEMENRRHIVIDPPHTPSRYLQRTPNGKSPAGRQ 59

Query: 52  ----IVKNPENSLMDIDDDTQGDLTADITKSPKKLPKDFYKKSSKTKSKRLVSVCQMYFL 107
                V+N + S MD+D+  + D+  D+++SPKKLP DF+K++S TK+KRLVSVCQM+FL
Sbjct: 60  GGYLTVENADYSGMDVDERPRDDI--DLSRSPKKLPMDFHKRASSTKTKRLVSVCQMFFL 117

Query: 108 DYYCDMFDYVISRRERTRQVINYLEEQRRSNLMGTEQITNEWQGYLTKETNILRKRRLKP 167
           DYYCDMFDYVISRRERTRQV+NYLE+QR   L   ++I+ EWQ YL +ET+ILRKRRLKP
Sbjct: 118 DYYCDMFDYVISRRERTRQVMNYLEQQRAQGLHSAQEISEEWQNYLYRETDILRKRRLKP 177

Query: 168 KHKDFEMITXXXXXXXXXXXLARKKDTKEICAXXXXXXXXXXXXEGTDHVLTERDILTTT 227
           K+KDFE+IT           LARKKDTKEICA             GTDHVLTERDILTTT
Sbjct: 178 KNKDFEIITQVGQGGYGQVYLARKKDTKEICALKILNKNLLAKLNGTDHVLTERDILTTT 237

Query: 228 RSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALH 287
           RSEWLVKLLYAFQDP SLYLAMEFVPGGD+RTLL+NT+FLQAPHARFYISEMFCAV+ALH
Sbjct: 238 RSEWLVKLLYAFQDPHSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALH 297

Query: 288 QLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRER 347
           +LGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESM+IRL+EVKNLEFPEF+E 
Sbjct: 298 KLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMRIRLEEVKNLEFPEFKET 357

Query: 348 SMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGY 407
           SMD RR+MY+++RE+E+ YA STVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGY
Sbjct: 358 SMDYRRKMYHRVREKELNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGY 417

Query: 408 TPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITRLIADPINRLKSFEHVK 467
           TPFSG+S+NETYENLR WK VL+RP+C+NGR AFSDRTWELITRLIADPINRL+SFEHVK
Sbjct: 418 TPFSGSSSNETYENLRRWKQVLRRPRCENGRPAFSDRTWELITRLIADPINRLRSFEHVK 477

Query: 468 RMRYFSEIDFNTLRTIHPPFIPQLDNEEDVGYFDDFTNEEHMARYVDVFKRQDRLTAMVD 527
           +M+YF+EIDF  LR++ PPFIPQLD+E D GYFDDFTNE  MA+Y DVFKRQD+L AMV+
Sbjct: 478 KMKYFAEIDFANLRSMSPPFIPQLDSETDAGYFDDFTNEADMAKYADVFKRQDKLNAMVE 537

Query: 528 DSLSDSKLVGFTFRHRNGKDGSSGVLYGGLE 558
           +S + SKLVGFTFRHR GK GSSGVL+ G E
Sbjct: 538 ESSNSSKLVGFTFRHRKGKTGSSGVLHNGSE 568

>YGR092W (DBF2) [2052] chr7 (668191..669909) Serine/threonine
           protein kinase related to Dbf20p, required for events in
           anaphase/telophase, component of the CCR4-NOT
           transcriptional complex [1719 bp, 572 aa]
          Length = 572

 Score =  761 bits (1964), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/561 (66%), Positives = 443/561 (78%), Gaps = 17/561 (3%)

Query: 11  KEVDALVDDMVNFSFD---TDAKVMLDPPST-------PTRIRGSPSPTR-SIVKNPENS 59
           K VD L  +M N SFD   T     L P          P  I  SPSP + S     + S
Sbjct: 7   KNVDLLAGNMSNLSFDGHGTPGGTGLFPNQNITKRRTRPAGINDSPSPVKPSFFPYEDTS 66

Query: 60  LMDIDDDTQGDLTADITKSPKKLPKDFYKKSSKTKSKRLVSVCQMYFLDYYCDMFDYVIS 119
            MDID+ +Q D+  D++ SPKKLP  FY++++  K++R+VSVC+MYFL++YCDMFDYVIS
Sbjct: 67  NMDIDEVSQPDM--DVSNSPKKLPPKFYERATSNKTQRVVSVCKMYFLEHYCDMFDYVIS 124

Query: 120 RRERTRQVINYLEEQRRSNLMGTEQI--TNEWQGYLTKETNILRKRRLKPKHKDFEMITX 177
           RR+RT+QV+ YL++Q  S L  ++QI    EW  YL +E  +LRKRRLKPK++DFEMIT 
Sbjct: 125 RRQRTKQVLEYLQQQ--SQLPNSDQIKLNEEWSSYLQREHQVLRKRRLKPKNRDFEMITQ 182

Query: 178 XXXXXXXXXXLARKKDTKEICAXXXXXXXXXXXXEGTDHVLTERDILTTTRSEWLVKLLY 237
                     LARKKDTKE+CA              T HVLTERDILTTTRSEWLVKLLY
Sbjct: 183 VGQGGYGQVYLARKKDTKEVCALKILNKKLLFKLNETKHVLTERDILTTTRSEWLVKLLY 242

Query: 238 AFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDLK 297
           AFQD QSLYLAMEFVPGGDFRTLL+NT+ L++ HARFYISEMFCAVNALH LGYTHRDLK
Sbjct: 243 AFQDLQSLYLAMEFVPGGDFRTLLINTRCLKSGHARFYISEMFCAVNALHDLGYTHRDLK 302

Query: 298 PENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYN 357
           PENFLID+KGHIKLTDFGLA+GT+S ERIESMKIRL+++K+LEFP F E+S++DRR+MYN
Sbjct: 303 PENFLIDAKGHIKLTDFGLAAGTISNERIESMKIRLEKIKDLEFPAFTEKSIEDRRKMYN 362

Query: 358 KLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGNSTNE 417
           +LRE+E+ YA+S VGSPDYMALEVLE K YDFTVDYWSLGC+LFESLVGYTPFSG+STNE
Sbjct: 363 QLREKEINYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNE 422

Query: 418 TYENLRNWKHVLQRPKCDNGRYAFSDRTWELITRLIADPINRLKSFEHVKRMRYFSEIDF 477
           TY+NLR WK  L+RP+  +GR AFSDRTW+LITRLIADPINRL+SFEHVKRM YF++I+F
Sbjct: 423 TYDNLRRWKQTLRRPRQSDGRAAFSDRTWDLITRLIADPINRLRSFEHVKRMSYFADINF 482

Query: 478 NTLRTIHPPFIPQLDNEEDVGYFDDFTNEEHMARYVDVFKRQDRLTAMVDDSLSDSKLVG 537
           +TLR++ PPF PQLD+E D GYFDDFT+E  MA+Y DVFKRQD+LTAMVDDS   SKLVG
Sbjct: 483 STLRSMIPPFTPQLDSETDAGYFDDFTSEADMAKYADVFKRQDKLTAMVDDSAVSSKLVG 542

Query: 538 FTFRHRNGKDGSSGVLYGGLE 558
           FTFRHRNGK GSSG+L+ GLE
Sbjct: 543 FTFRHRNGKQGSSGILFNGLE 563

>Scas_716.33
          Length = 573

 Score =  758 bits (1956), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/533 (69%), Positives = 427/533 (80%), Gaps = 10/533 (1%)

Query: 33  LDPPSTPTR-----IRGSPSP--TRSIVKNPENSLMDIDDDTQGDLTADITKSPKKLPKD 85
           LD  STPT+     + GSP P   R    +  +S MDID  +  D+  DIT SPKKLP+ 
Sbjct: 35  LDNFSTPTKYKNDKLNGSPIPPGARRYEIDDSDSKMDIDGSSYNDI--DITNSPKKLPQG 92

Query: 86  FYKKSSKTKSKRLVSVCQMYFLDYYCDMFDYVISRRERTRQVINYLEEQRRSNLMGTEQI 145
           F   +S  K++RLVSVC+MYFLDYYCDMFDYVISRR+RT++V+ YLE+++  N+     +
Sbjct: 93  FQTMASNNKTQRLVSVCKMYFLDYYCDMFDYVISRRQRTKKVLEYLEQKKNENV-DLNSL 151

Query: 146 TNEWQGYLTKETNILRKRRLKPKHKDFEMITXXXXXXXXXXXLARKKDTKEICAXXXXXX 205
            NEW GY+ +E  +LRKRRLKPKHKDFEMIT           LARKKDT E+CA      
Sbjct: 152 NNEWNGYIQREHQVLRKRRLKPKHKDFEMITQVGQGGYGQVYLARKKDTNEVCALKILNK 211

Query: 206 XXXXXXEGTDHVLTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTK 265
                   T+HVLTERDILTTTRS+WLVKLLYAFQD Q+LYLAMEFVPGGDFRTLL+NT+
Sbjct: 212 KLLFKLNETNHVLTERDILTTTRSQWLVKLLYAFQDTQNLYLAMEFVPGGDFRTLLINTR 271

Query: 266 FLQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMER 325
           FL++ HARFYISEMF AVNALH LGYTHRDLKPENFLID+KGHIKLTDFGLA+GT+S +R
Sbjct: 272 FLKSTHARFYISEMFLAVNALHDLGYTHRDLKPENFLIDAKGHIKLTDFGLAAGTISNDR 331

Query: 326 IESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAK 385
           I+SMK+RL+EVKNLEFPEF ++S++DRR+MY K RE EV YA+S VGSPDYMALEVLE K
Sbjct: 332 IQSMKVRLEEVKNLEFPEFSDKSIEDRRQMYQKYRETEVNYANSMVGSPDYMALEVLEGK 391

Query: 386 NYDFTVDYWSLGCILFESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRT 445
            YDFTVDYWSL C+LFESLVGYTPFSG+STNETYENLR+WK  L+RP  DNGR AFSDRT
Sbjct: 392 KYDFTVDYWSLSCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPMLDNGRPAFSDRT 451

Query: 446 WELITRLIADPINRLKSFEHVKRMRYFSEIDFNTLRTIHPPFIPQLDNEEDVGYFDDFTN 505
           W+ ITRLIADPINRL+SFEHVKRM YF  +DFNTLR + PPFIPQLDNE D GYFDDFTN
Sbjct: 452 WDFITRLIADPINRLRSFEHVKRMTYFESVDFNTLRDLSPPFIPQLDNETDAGYFDDFTN 511

Query: 506 EEHMARYVDVFKRQDRLTAMVDDSLSDSKLVGFTFRHRNGKDGSSGVLYGGLE 558
           E  MA+Y DVFKRQ++L+ MV+D+  DSKLVGFTFRHR GK+GSSGVLY GLE
Sbjct: 512 EADMAKYADVFKRQNKLSTMVNDADIDSKLVGFTFRHRYGKNGSSGVLYNGLE 564

>Scas_705.23
          Length = 553

 Score =  752 bits (1941), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/517 (69%), Positives = 420/517 (81%), Gaps = 5/517 (0%)

Query: 45  SPSPTRSIVKNPENSLMDIDDDTQGDLTADITK---SPKKLPKDFYKKSSKTKSKRLVSV 101
           S +PTR+  +N  +       +     TAD T+   SPKKLP DFYKK+    +KR+V+V
Sbjct: 30  SVTPTRANKENRSSLSPSPSPNKTKRFTADETELKNSPKKLPHDFYKKALSNDTKRIVNV 89

Query: 102 CQMYFLDYYCDMFDYVISRRERTRQVINYLEEQRRSNLMGTEQITNEWQGYLTKETNILR 161
           CQMYFLDYYCDMFDYVISRR+RT+ V+NYLE  R  N + TE++ NEW  YL +E ++LR
Sbjct: 90  CQMYFLDYYCDMFDYVISRRQRTKSVLNYLE--RNQNSLSTEELNNEWTAYLQQEHDVLR 147

Query: 162 KRRLKPKHKDFEMITXXXXXXXXXXXLARKKDTKEICAXXXXXXXXXXXXEGTDHVLTER 221
           KRRLKPK+KDFEMIT           LARK+DTKE+CA              T+HVLTER
Sbjct: 148 KRRLKPKNKDFEMITQVGQGGYGQVYLARKRDTKEVCALKILNKKLLFKLNETNHVLTER 207

Query: 222 DILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFC 281
           DILTTTRS+WLVKLLYAFQD +SLYLAMEFVPGGDFRTLL+NT+FL+  HARFYISEMFC
Sbjct: 208 DILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFC 267

Query: 282 AVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEF 341
           AVNALH+LGYTHRDLKPENFLIDS+GHIKLTDFGLA+GT+S ERI+SMKIRL+EVKNLEF
Sbjct: 268 AVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEF 327

Query: 342 PEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILF 401
           P F E+S++DRR+MY  LR+ EV YA+S VGSPDYMALEVLE K YDFTVDYWSLGC+LF
Sbjct: 328 PAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLF 387

Query: 402 ESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITRLIADPINRLK 461
           ESLVGYTPFSG+STNETYENLR+WK  L+RP  DNGR AFSDRTW++ITRLIADPINRL+
Sbjct: 388 ESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITRLIADPINRLR 447

Query: 462 SFEHVKRMRYFSEIDFNTLRTIHPPFIPQLDNEEDVGYFDDFTNEEHMARYVDVFKRQDR 521
           SFEH+KRM YF+E++FNTLR   PPF PQLD+E D GYFDDFTNE  MA+Y DVFKRQ++
Sbjct: 448 SFEHIKRMPYFAEVNFNTLRQSAPPFTPQLDSETDAGYFDDFTNEADMAKYADVFKRQNK 507

Query: 522 LTAMVDDSLSDSKLVGFTFRHRNGKDGSSGVLYGGLE 558
           L++MVDDS  DSKLVGFTFRHRNG+ G SG+LY G E
Sbjct: 508 LSSMVDDSAVDSKLVGFTFRHRNGQKGLSGILYNGSE 544

>CAGL0B04147g 402798..404498 highly similar to sp|P22204
           Saccharomyces cerevisiae YGR092w DBF2 ser/thrprotein
           kinase related to DBF20P or sp|P32328 Saccharomyces
           cerevisiae YPR111w DBF20 cell cycle protein kinase
           related to DBF2P, hypothetical start
          Length = 566

 Score =  751 bits (1938), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/523 (67%), Positives = 423/523 (80%), Gaps = 5/523 (0%)

Query: 36  PSTPTRIRGSPSPTRSIVKNPENSLMDIDDDTQGDLTADITKSPKKLPKDFYKKSSKTKS 95
           PSTPT+ + + S       +P  S+   +   +      I  SPKKLP+DF++K++  K+
Sbjct: 40  PSTPTQYKENRSGASPYSTSPTKSIFKKEKPRE-----RIINSPKKLPRDFHRKATSNKT 94

Query: 96  KRLVSVCQMYFLDYYCDMFDYVISRRERTRQVINYLEEQRRSNLMGTEQITNEWQGYLTK 155
           +RLVSVCQMYFLDYYCDMFDYVISRR+RT+Q+I+ ++E ++++ +  EQ+  EW  YL K
Sbjct: 95  QRLVSVCQMYFLDYYCDMFDYVISRRQRTKQMISNIQEYKQNHTIPDEQLNEEWNNYLQK 154

Query: 156 ETNILRKRRLKPKHKDFEMITXXXXXXXXXXXLARKKDTKEICAXXXXXXXXXXXXEGTD 215
           E  +LRKRRLKPK+KDFEMIT           LARK+DTKE+CA              T+
Sbjct: 155 EHEVLRKRRLKPKNKDFEMITQVGQGGYGQVYLARKRDTKEVCALKILNKKLLVKLNETN 214

Query: 216 HVLTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFY 275
           H+LTERDILTTTRSEWLVKLLYAFQDP+SLYLAMEFVPGGDFRTLL+NT+ L++PHARFY
Sbjct: 215 HILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFY 274

Query: 276 ISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQE 335
           ISEMFCAVNALH+LGYTHRDLKPENFLID++GHIKLTDFGLA+GTVS ERIESMKIRL+E
Sbjct: 275 ISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEE 334

Query: 336 VKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWS 395
           VKNLEFP F E+S++DRR++Y  LR+ ++ YA+S VGSPDYMALEVLE K YD+TVDYWS
Sbjct: 335 VKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWS 394

Query: 396 LGCILFESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITRLIAD 455
           LGC+LFE+L+GYTPFSG+STNETYENLR+WK  L+RP  ++GR A SDR WELITRLIAD
Sbjct: 395 LGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITRLIAD 454

Query: 456 PINRLKSFEHVKRMRYFSEIDFNTLRTIHPPFIPQLDNEEDVGYFDDFTNEEHMARYVDV 515
           PINRL+SFEHVKRM YF EI+F+TLR + PPF PQLDNE D GYFDDFTNE  MA+Y DV
Sbjct: 455 PINRLRSFEHVKRMNYFHEINFDTLRQLSPPFTPQLDNETDAGYFDDFTNEADMAKYADV 514

Query: 516 FKRQDRLTAMVDDSLSDSKLVGFTFRHRNGKDGSSGVLYGGLE 558
           FKRQD+L AMVDDS  DSKL+GFTFRH+NG  GSSGVLY G E
Sbjct: 515 FKRQDKLAAMVDDSEVDSKLIGFTFRHKNGNTGSSGVLYKGHE 557

>CAGL0G03047g 282299..283918 highly similar to sp|P22204
           Saccharomyces cerevisiae YGR092w DBF2 ser/thrprotein
           kinase or sp|P32328 Saccharomyces cerevisiae YPR111w
           DBF20, hypothetical start
          Length = 539

 Score =  748 bits (1930), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/516 (69%), Positives = 411/516 (79%), Gaps = 2/516 (0%)

Query: 45  SPSPTRSIVKNPENSL--MDIDDDTQGDLTADITKSPKKLPKDFYKKSSKTKSKRLVSVC 102
           +PSP +  V N E  L  MDIDD        ++  SPKKLP  F  K+S  K++RLV VC
Sbjct: 15  TPSPKKDGVNNLEQELSAMDIDDSANDTNIDELLHSPKKLPAGFRSKASNNKTQRLVGVC 74

Query: 103 QMYFLDYYCDMFDYVISRRERTRQVINYLEEQRRSNLMGTEQITNEWQGYLTKETNILRK 162
           +MYFL+YYCDMFDYVISRR+RT+Q++ YL ++  +  +       EW+GYL KE NILRK
Sbjct: 75  KMYFLEYYCDMFDYVISRRQRTKQIMEYLRQENENGRLDEHTADTEWRGYLAKENNILRK 134

Query: 163 RRLKPKHKDFEMITXXXXXXXXXXXLARKKDTKEICAXXXXXXXXXXXXEGTDHVLTERD 222
           RRLKPK+ DFEM+T           LARK+DTKE+CA              T+HVLTERD
Sbjct: 135 RRLKPKNNDFEMLTQVGQGGYGQVYLARKRDTKEVCALKILNKKLLHRLNETNHVLTERD 194

Query: 223 ILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCA 282
           ILTTTRSEWLVKLLYAFQD  SLYLAMEFVPGGDFRTLL+NTK+L++ HARFYISEMFCA
Sbjct: 195 ILTTTRSEWLVKLLYAFQDSSSLYLAMEFVPGGDFRTLLINTKYLKSTHARFYISEMFCA 254

Query: 283 VNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFP 342
           VNALH+LGYTHRDLKPENFLID+KGHIKLTDFGLA+GTVS ERIESMKIRL+EVKNLEFP
Sbjct: 255 VNALHELGYTHRDLKPENFLIDAKGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFP 314

Query: 343 EFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFE 402
            F ER ++DRR+MY+ LR+ ++ YA+S VGSPDYMALEVLE K YDFTVDYWSLGC+LFE
Sbjct: 315 AFTERPIEDRRKMYHDLRDTDINYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFE 374

Query: 403 SLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITRLIADPINRLKS 462
           SLV +TPFSG +TNETYENLR+W+  L+RP+  NGRYA SDRTW  IT LIADPINRLKS
Sbjct: 375 SLVSFTPFSGATTNETYENLRHWRKTLRRPRLGNGRYAVSDRTWAFITSLIADPINRLKS 434

Query: 463 FEHVKRMRYFSEIDFNTLRTIHPPFIPQLDNEEDVGYFDDFTNEEHMARYVDVFKRQDRL 522
           FEHVKRM YFSEIDF+ LR + PPFIPQLD+E D GYFDDFTNE  MA+Y DVFKRQ++L
Sbjct: 435 FEHVKRMPYFSEIDFSKLREMSPPFIPQLDSEVDAGYFDDFTNEADMAKYADVFKRQNKL 494

Query: 523 TAMVDDSLSDSKLVGFTFRHRNGKDGSSGVLYGGLE 558
            AM+DDS  DSKLVGFTFRHRNGK GSSG+LY G E
Sbjct: 495 NAMIDDSAVDSKLVGFTFRHRNGKHGSSGILYNGAE 530

>Kwal_33.14554
          Length = 714

 Score =  217 bits (552), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 143/478 (29%), Positives = 233/478 (48%), Gaps = 45/478 (9%)

Query: 99  VSVCQMYFLDYYCDMFDYVISRRERTRQVINYLEEQRRSNLMGTEQITNEWQGYLTKETN 158
            +  ++   ++Y    +Y I R +R  ++ + L  Q  S+   + Q++   +    KE+ 
Sbjct: 234 AATVKLKIENFYQSSVNYAIERNQRRVELESQLVSQDWSDERKSRQLSTLGR----KESQ 289

Query: 159 ILRKRRLKPKHKDFEMITXXXXXXXXXXXLARKKDTKEICAXXXXXXXXXXXXEGTDHVL 218
            LR RR +   +DF+ +            L +KKDT +I A            +   HV 
Sbjct: 290 FLRLRRTRLSLEDFQTVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKDQLAHVK 349

Query: 219 TERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISE 278
            ERD+L  + S W+V L Y+FQD Q LYL MEF+PGGD  T+L+  +       RFY++E
Sbjct: 350 AERDVLAGSDSPWVVSLYYSFQDTQYLYLIMEFLPGGDLMTMLIRWQIFTEDVTRFYMAE 409

Query: 279 MFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQE--- 335
              A+ A+H+LG+ HRD+KP+N LID +GHIKL+DFGL++G          K  LQ+   
Sbjct: 410 CILAIEAIHKLGFIHRDIKPDNILIDIRGHIKLSDFGLSTGFHKTHDSNYYKKLLQQDEV 469

Query: 336 ---VKNLEFPEFR----------------------ERSMDDRRRMYNKLREEEVRYAHST 370
                +L+ P+                          +M +R+++    R+     A+ST
Sbjct: 470 NAAAGSLQKPQMGIVAGNNGGGSGNNRNTMFVDAIHLTMTNRQQI-QTWRKSRRLMAYST 528

Query: 371 VGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGNSTNETYENLRNWKHVLQ 430
           VG+PDY+A E+   + Y    D+WSLG I++E L+G+ PF   +  ETY  + N++  LQ
Sbjct: 529 VGTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGWPPFCSETPQETYRKIMNFEQTLQ 588

Query: 431 RPKCDNGRYAFSDRTWELITRLIADPINRL---KSFEHVKRMRYFSEIDFNTLRTIHPPF 487
            P   +  Y   D    LI RL+     RL      + +K   +F  +D+NT+R +  P+
Sbjct: 589 FPDDIHISYEAED----LIRRLLTHADQRLGRHGGADEIKSHPFFRGVDWNTIRQVEAPY 644

Query: 488 IPQLDNEEDVGYF-----DDFTNEEHMARYVDVFKRQDRLTAMVDDSLSDSKLVGFTF 540
           IP+L +  D  +F     ++  +   MA+     ++  +  A    S  D   +G+T+
Sbjct: 645 IPKLSSITDTRFFPTDELENVPDSPAMAQAARQREQMMKQGAANPSSKEDLPFIGYTY 702

>CAGL0J06072g complement(572377..574698) similar to sp|P53894
           Saccharomyces cerevisiae YNL161w CBK1, hypothetical
           start
          Length = 773

 Score =  218 bits (554), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 142/436 (32%), Positives = 214/436 (49%), Gaps = 32/436 (7%)

Query: 85  DFYKKSSKTKSKRLVSVCQMYFLDYYCDMFDYVISRRERTRQVINYLEEQRRSNLMGTEQ 144
           D   KS++ K+    +  ++   +YY     Y I R ER  +    LE +  S+    E+
Sbjct: 291 DLLSKSTQDKA----AAVKLKVENYYQQSVKYAIERNERRVE----LETELGSHNWSEER 342

Query: 145 ITNEWQGYLTKETNILRKRRLKPKHKDFEMITXXXXXXXXXXXLARKKDTKEICAXXXXX 204
              +      KE+  LR RR +   +DF  +            L +KKDT +I A     
Sbjct: 343 NARQLASLGKKESQFLRLRRTRLSLEDFHTVQVIGKGAFGEVRLVQKKDTGKIYAMKTLL 402

Query: 205 XXXXXXXEGTDHVLTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNT 264
                  +   HV  ERD+L  T S W+V L Y+FQD Q LYL MEF+PGGD  T+L+  
Sbjct: 403 KSEMYKKDQLAHVKAERDVLAGTDSPWIVSLYYSFQDAQYLYLIMEFLPGGDLMTMLIRW 462

Query: 265 KFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSME 324
           +       RFY++E   A+  +H+LG+ HRD+KP+N LID +GHIKL+DFGL++G     
Sbjct: 463 QLFTEDVTRFYMAECILAIETIHKLGFIHRDIKPDNILIDIRGHIKLSDFGLSTGFHKTH 522

Query: 325 RIESMKIRLQE----VKNLEFPEFRERSMD-------------DRRRMYNKLREEEVRYA 367
                K  LQ+     KN    +  + S +               R+     R+     A
Sbjct: 523 DSNYYKKLLQQDEATTKNGAPNDAGDGSNNRQTMIVDSINLTMSNRQQIQTWRKSRRLMA 582

Query: 368 HSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGNSTNETYENLRNWKH 427
           +STVG+PDY+A E+   + Y    D+WSLG I++E L+G+ PF   +  ETY  + N++ 
Sbjct: 583 YSTVGTPDYIAPEIFLYQGYGQDCDWWSLGAIMYECLIGWPPFCSETPQETYRKIMNFEQ 642

Query: 428 VLQRPKCDNGRYAFSDRTWELITRLIADPINRL---KSFEHVKRMRYFSEIDFNTLRTIH 484
            LQ P+  +  Y   D    LI RL+     RL      + +K   +F  +D+NT+R + 
Sbjct: 643 TLQFPEDVHISYEAED----LIRRLLTHSNQRLGRQGGADEIKSHPFFRGVDWNTIRQVE 698

Query: 485 PPFIPQLDNEEDVGYF 500
            P+IP+L +  D  +F
Sbjct: 699 APYIPKLSSITDTRFF 714

>YNL161W (CBK1) [4436] chr14 (332597..334867) Serine/threonine
           protein kinase required for sporulation and production
           of daughter specific proteins [2271 bp, 756 aa]
          Length = 756

 Score =  216 bits (549), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 142/470 (30%), Positives = 222/470 (47%), Gaps = 36/470 (7%)

Query: 99  VSVCQMYFLDYYCDMFDYVISRRERTRQVINYLEEQRRSNLMGTEQITNEWQGYLTKETN 158
            +  ++   ++Y     Y I R ER  +    LE +  S+    E+ + +      KE+ 
Sbjct: 283 AAAVKLKIENFYQSSVKYAIERNERRVE----LETELTSHNWSEERKSRQLSSLGKKESQ 338

Query: 159 ILRKRRLKPKHKDFEMITXXXXXXXXXXXLARKKDTKEICAXXXXXXXXXXXXEGTDHVL 218
            LR RR +   +DF  +            L +KKDT +I A            +   HV 
Sbjct: 339 FLRLRRTRLSLEDFHTVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKDQLAHVK 398

Query: 219 TERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISE 278
            ERD+L  + S W+V L Y+FQD Q LYL MEF+PGGD  T+L+  +       RFY++E
Sbjct: 399 AERDVLAGSDSPWVVSLYYSFQDAQYLYLIMEFLPGGDLMTMLIRWQLFTEDVTRFYMAE 458

Query: 279 MFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQE--- 335
              A+  +H+LG+ HRD+KP+N LID +GHIKL+DFGL++G          K  LQ+   
Sbjct: 459 CILAIETIHKLGFIHRDIKPDNILIDIRGHIKLSDFGLSTGFHKTHDSNYYKKLLQQDEA 518

Query: 336 VKNLEFPEFRERSMDD------------------RRRMYNKLREEEVRYAHSTVGSPDYM 377
              +  P     +  D                   R+     R+     A+STVG+PDY+
Sbjct: 519 TNGISKPGTYNANTTDTANKRQTMVVDSISLTMSNRQQIQTWRKSRRLMAYSTVGTPDYI 578

Query: 378 ALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNG 437
           A E+   + Y    D+WSLG I++E L+G+ PF   +  ETY  + N++  LQ P   + 
Sbjct: 579 APEIFLYQGYGQECDWWSLGAIMYECLIGWPPFCSETPQETYRKIMNFEQTLQFPDDIHI 638

Query: 438 RYAFSDRTWELITRLIADPINRL---KSFEHVKRMRYFSEIDFNTLRTIHPPFIPQLDNE 494
            Y   D    LI RL+     RL      + +K   +F  +D+NT+R +  P+IP+L + 
Sbjct: 639 SYEAED----LIRRLLTHADQRLGRHGGADEIKSHPFFRGVDWNTIRQVEAPYIPKLSSI 694

Query: 495 EDVGYF--DDFTNEEHMARYVDVFKRQDRLTAMVDDSL--SDSKLVGFTF 540
            D  +F  D+  N           K+++++T     +    D   +G+T+
Sbjct: 695 TDTRFFPTDELENVPDSPAMAQAAKQREQMTKQGGSAPVKEDLPFIGYTY 744

>KLLA0D07810g complement(669095..671251)
           gi|401646|sp|P31034|YL44_KLULA Kluyveromyces lactis
           Hypothetical 31.8 kDa protein in L44/L41 3 region, start
           by similarity
          Length = 718

 Score =  214 bits (544), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 150/490 (30%), Positives = 234/490 (47%), Gaps = 50/490 (10%)

Query: 91  SKTKSKRLVSVCQMYFLDYYCDMFDYVISRRERTRQVINYLEEQRRSNLMGTEQITNEWQ 150
           +KT   +  +V ++   ++Y     Y I R +R  ++ + L  Q  S      Q+ +  +
Sbjct: 227 TKTTQDKAAAV-KLKIENFYQSSVGYAIERNQRRLELESELASQDWSEERKNRQLASLGK 285

Query: 151 GYLTKETNILRKRRLKPKHKDFEMITXXXXXXXXXXXLARKKDTKEICAXXXXXXXXXXX 210
               KE+  LR RR +    DF  +            L +KKDT +I A           
Sbjct: 286 ----KESQFLRLRRTRLSLDDFNSVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYN 341

Query: 211 XEGTDHVLTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAP 270
            +   HV  ERD+L  + S W+V L Y+FQD Q LYL MEF+PGGD  T+L+  +     
Sbjct: 342 KDQLAHVKAERDVLAGSDSPWVVSLYYSFQDSQYLYLIMEFLPGGDLMTMLIRWQIFTED 401

Query: 271 HARFYISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMK 330
             RFY++E   A+  +H+LG+ HRD+KP+N LID +GHIKL+DFGL++G          K
Sbjct: 402 VTRFYMAECILAIEVIHKLGFIHRDIKPDNILIDIRGHIKLSDFGLSTGFHKTHDSSYYK 461

Query: 331 IRLQE------------------------------VKNLEFPEFRERSMDDRRRMYNKLR 360
             LQE                               +N    +    +M +R++M    R
Sbjct: 462 KLLQEDEAKKQQQQQQQQQQLNLQKPQLPNETNNGNRNTMLVDAIHLTMTNRQQM-QTWR 520

Query: 361 EEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGNSTNETYE 420
           +     A+STVG+PDY+A E+   + Y    D+WSLG I++E L+G+ PF   +  ETY 
Sbjct: 521 KSRRLMAYSTVGTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGWPPFCSETPQETYR 580

Query: 421 NLRNWKHVLQRPKCDNGRYAFSDRTWELITRLIADPINRL---KSFEHVKRMRYFSEIDF 477
            + N++  LQ P   +  Y   D    LI RL+    NRL      + +K   +FS +D+
Sbjct: 581 KIMNFEQTLQFPDDIHISYEAED----LIRRLLTHSENRLGRHGGADEIKAHPFFSGVDW 636

Query: 478 NTLRTIHPPFIPQLDNEEDVGYF--DDFTN-EEHMARYVDVFKRQDRLTAMVDDSLSDSK 534
           NT+R +  P+IP+L +  D  +F  D+  N  +  A      +R+  +T       S++K
Sbjct: 637 NTIRQVEAPYIPKLSSVTDTRFFPTDELENVPDSPAMAQAARQREQMMTQQQGVPQSNAK 696

Query: 535 ----LVGFTF 540
                +G+T+
Sbjct: 697 EDLPFIGYTY 706

>AFR035W [3227] [Homologous to ScYNL161W (CBK1) - SH]
           complement(498529..500688) [2160 bp, 719 aa]
          Length = 719

 Score =  213 bits (543), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 145/484 (29%), Positives = 231/484 (47%), Gaps = 44/484 (9%)

Query: 91  SKTKSKRLVSVCQMYFLDYYCDMFDYVISRRERTRQVINYLEEQRRSNLMGTEQITNEWQ 150
           SK+  ++  +V ++   ++Y    ++ I R +R  +    LE Q  S+    E+   +  
Sbjct: 234 SKSTQEKAAAV-KLKVENFYQSSVNHAIERNQRRVE----LESQLLSHGWSEERKNRQLS 288

Query: 151 GYLTKETNILRKRRLKPKHKDFEMITXXXXXXXXXXXLARKKDTKEICAXXXXXXXXXXX 210
               KE+  LR RR +   +DF  +            L +KKDT +I A           
Sbjct: 289 SLGKKESQFLRLRRTRLSLEDFHTVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYK 348

Query: 211 XEGTDHVLTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAP 270
            +   HV  ERD+L  + S W+V L Y+FQD Q LYL MEF+PGGD  T+L+  +     
Sbjct: 349 KDQLAHVKAERDVLAGSDSPWVVSLYYSFQDAQYLYLIMEFLPGGDLMTMLIRWQIFTED 408

Query: 271 HARFYISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMK 330
             RFY++E   A+ A+H+LG+ HRD+KP+N LID +GHIKL+DFGL++G          K
Sbjct: 409 VTRFYMAECILAIEAIHKLGFIHRDIKPDNILIDIRGHIKLSDFGLSTGFHKTHDSNYYK 468

Query: 331 IRLQE------------------------VKNLEFPEFRERSMDDRRRMYNKLREEEVRY 366
             LQE                         +N    +    +M +R++M    R+     
Sbjct: 469 KLLQEDEQQQNGGNMGKYPASGGGGNGGGNRNTMLVDAIHLTMTNRQQM-QTWRKSRRLM 527

Query: 367 AHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGNSTNETYENLRNWK 426
           A+STVG+PDY+A E+   + Y    D+WSLG I++E L+G+ PF   +  ETY  + N++
Sbjct: 528 AYSTVGTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGWPPFCSETPQETYRKIMNFE 587

Query: 427 HVLQRPKCDNGRYAFSDRTWELITRLIADPINRL--KSFEHVKRMRYFSEIDFNTLRTIH 484
             L  P   +  Y   D    LI RL++    RL       +K   +F  +D+ T+R + 
Sbjct: 588 QTLVFPDDIHISYEAED----LIRRLLSHADERLGRHGANEIKNHPFFRGVDWETIRQVG 643

Query: 485 PPFIPQLDNEEDVGYF--DDFTNEEHMARYVDVFKRQDRL------TAMVDDSLSDSKLV 536
            P+IP+L +  D  +F  D+  N           K+++++       A    +  D   +
Sbjct: 644 APYIPKLSSVTDTRFFPTDELENVPDSPAMAQAAKQREQMLKQGGSAANTAQAKEDLPFI 703

Query: 537 GFTF 540
           G+T+
Sbjct: 704 GYTY 707

>Scas_654.12
          Length = 737

 Score =  211 bits (536), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 143/449 (31%), Positives = 213/449 (47%), Gaps = 45/449 (10%)

Query: 85  DFYKKSSKTKSKRLVSVCQMYFLDYYCDMFDYVISRRERTRQVINYLEEQRRSNLMGTEQ 144
           D   KS++ K+    +  ++   ++Y     Y I R ER  +    LE +  S+    E+
Sbjct: 240 DLLTKSTQDKA----AAIKLKIENFYQSSVKYAIERNERRVE----LETELASHDWSEER 291

Query: 145 ITNEWQGYLTKETNILRKRRLKPKHKDFEMITXXXXXXXXXXXLARKKDTKEICAXXXXX 204
              +      KE+  LR RR +   +DF  +            L +K DT +I A     
Sbjct: 292 RNRQLASLGKKESQFLRLRRTRLSLEDFHTVKVIGKGAFGEVRLVQKIDTGKIYAMKTLL 351

Query: 205 XXXXXXXEGTDHVLTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNT 264
                  +   HV  ERD+L  + S W+V L Y+FQD Q LYL MEF+PGGD  T+L+  
Sbjct: 352 KSEMYKKDQLAHVKAERDVLAGSDSPWVVSLYYSFQDTQYLYLIMEFLPGGDLMTMLIRW 411

Query: 265 KFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSME 324
           +       RFY++E   A+  +H+LG+ HRD+KP+N LID +GHIKL+DFGL++G     
Sbjct: 412 QLFTEDVTRFYMAECILAIETIHKLGFIHRDIKPDNILIDIRGHIKLSDFGLSTGFHKTH 471

Query: 325 RIESMKIRLQE----VKNLEFP-------------------EFRERSMDD-------RRR 354
                K  LQE       L  P                   E R+  M D        R+
Sbjct: 472 DSNYYKKLLQEDEANTTGLSKPGQPGNINNDGSSNADGSNKENRQSMMVDSINLTMSNRQ 531

Query: 355 MYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGNS 414
                R+     A+STVG+PDY+A E+   + Y    D+WSLG I++E L+G+ PF   +
Sbjct: 532 QIQTWRKSRRLMAYSTVGTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGWPPFCSET 591

Query: 415 TNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITRLIADPINRL---KSFEHVKRMRY 471
             ETY  + N++  LQ P   +  Y   D    LI RL+     RL      + +K   +
Sbjct: 592 PQETYRKIMNFEQTLQFPDDIHISYEAED----LIRRLLTHADQRLGRHGGADEIKSHPF 647

Query: 472 FSEIDFNTLRTIHPPFIPQLDNEEDVGYF 500
           F  +D+NT+R +  P+IP+L +  D  +F
Sbjct: 648 FRGVDWNTIRQVEAPYIPKLSSITDTRFF 676

>Scas_689.25*
          Length = 409

 Score =  147 bits (372), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 97/302 (32%), Positives = 152/302 (50%), Gaps = 59/302 (19%)

Query: 214 TDHVLTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHAR 273
            +H   ER +L+ +   ++V+L   FQD + L++ M++V GG+  +LL  ++    P A+
Sbjct: 141 VEHTNDERRMLSVSVHAFIVRLWGTFQDSEHLFMIMDYVEGGELFSLLRRSQRFPNPVAK 200

Query: 274 FYISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRL 333
           FY +E+  A++ LH L   +RDLKPEN L+D  GHIK+TDFG A     +          
Sbjct: 201 FYAAEVCLALDYLHSLDIIYRDLKPENLLLDRNGHIKVTDFGFAKYVPDV---------- 250

Query: 334 QEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDY 393
                                             ++  G+PDY+A EV+ AK Y+ +VD+
Sbjct: 251 ---------------------------------TYTLCGTPDYIAPEVISAKPYNKSVDW 277

Query: 394 WSLGCILFESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITRLI 453
           WS G +++E L G+TPF  +ST +TYEN+ N    L+ PK       F+    +L++RLI
Sbjct: 278 WSFGILIYEMLSGHTPFYDSSTMKTYENILNAP--LKFPKY------FTPDAQDLLSRLI 329

Query: 454 A-DPINRLKSF----EHVKRMRYFSEIDFNTL--RTIHPPFIPQL-DNEEDVGYFDDFTN 505
             D   RL +     E +K   +FSE+ ++ L  R I  P+ P +   + D   FD +  
Sbjct: 330 TRDLTERLGNLQNGTEDIKNHAWFSEVIWDKLLDRCIETPYEPPIQQGQGDTSQFDRYPE 389

Query: 506 EE 507
           EE
Sbjct: 390 EE 391

>YNR047W (YNR047W) [4630] chr14 (708522..711203) Serine/threonine
           protein kinase of unknown function [2682 bp, 893 aa]
          Length = 893

 Score =  151 bits (382), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 108/366 (29%), Positives = 174/366 (47%), Gaps = 36/366 (9%)

Query: 128 INYLEEQRRSNLMGTEQITNEWQGYLTKETNILRKRRLKPKHKDFEMITXXXXXXXXXXX 187
           I+   E RRS  + T+  +N++Q  +                + FE I            
Sbjct: 465 ISDFPEPRRSRRLRTKSFSNKFQDIMVGP-------------QSFEKIRLLGQGDVGKVF 511

Query: 188 LARKKDTKEICAXXXXXXXXXXXXEGTDHVLTERDILTTTRSEWLVKLLYAFQDPQSLYL 247
           L R+K T  + A                 VLTE++IL T+   ++V L ++FQ    LYL
Sbjct: 512 LVREKKTNRVYALKVLSKDEMIKRNKIKRVLTEQEILATSNHPFIVTLYHSFQSEDYLYL 571

Query: 248 AMEFVPGGDFRTLLLN--TKFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFLIDS 305
            ME+  GG+F   L    TK +    ARFY SE+  A+  LH LG+ +RDLKPEN L+  
Sbjct: 572 CMEYCMGGEFFRALQTRKTKCICEDDARFYASEVTAALEYLHLLGFIYRDLKPENILLHQ 631

Query: 306 KGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEVR 365
            GHI L+DF L+        I++   ++  VK        + ++ D +   +  R     
Sbjct: 632 SGHIMLSDFDLS--------IQAKDSKVPVVKGSA-----QSTLVDTKICSDGFR----- 673

Query: 366 YAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGNSTNETYENLRNW 425
             +S VG+ +Y+A EV+    +   VD+W+LG +++E L G+TPF G++TNET+ N+   
Sbjct: 674 -TNSFVGTEEYIAPEVIRGNGHTAAVDWWTLGILIYEMLFGFTPFKGDNTNETFTNI--L 730

Query: 426 KHVLQRPKCDNGRYAFSDRTWELITRLIADPINRLKSFEHVKRMRYFSEIDFNTLRTIHP 485
           K+ +  P  +       D   +L+T+  +  +        VK+  +F ++ ++ LR   P
Sbjct: 731 KNEVSFPNNNEISRTCKDLIKKLLTKNESKRLGCKMGAADVKKHPFFKKVQWSLLRNQEP 790

Query: 486 PFIPQL 491
           P IP L
Sbjct: 791 PLIPVL 796

>CAGL0K07458g complement(736336..738450) similar to sp|P12688
           Saccharomyces cerevisiae YKL126w or sp|P18961
           Saccharomyces cerevisiae YMR104c ser/thr-specific
           protein kinases, start by similarity
          Length = 704

 Score =  149 bits (377), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 108/372 (29%), Positives = 167/372 (44%), Gaps = 73/372 (19%)

Query: 171 DFEMITXXXXXXXXXXXLARKKDTKEICAXXXXXXXXXXXXEGTDHVLTERDILTTTRSE 230
           DFE++T             RKKDT++I A                H L ER IL      
Sbjct: 376 DFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECP 435

Query: 231 WLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLG 290
           ++V L + FQ P+ LYL +  + GG+    L          ARFY SE+  A+++LH++ 
Sbjct: 436 FIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMD 495

Query: 291 YTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMD 350
             +RDLKPEN L+DS+GHI L DFGL                                  
Sbjct: 496 VVYRDLKPENILLDSQGHIALCDFGLC--------------------------------- 522

Query: 351 DRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPF 410
                  KL  ++     +  G+P+Y+A EVL  K Y   VD+W+LG +L+E L G  P+
Sbjct: 523 -------KLNMKDNEKTSTFCGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPY 575

Query: 411 SGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDR----TWELITRLIA-DPINRLKS--F 463
              + +E Y      K +L+ P        F D       +L+ RL+  DP  RL +   
Sbjct: 576 YDENVSEMY------KKILKSP------LIFPDGMDPDAKDLLKRLLNRDPNRRLGANGA 623

Query: 464 EHVKRMRYFSEIDFNTL--RTIHPPFIPQLDNEEDVGYFDDFTNEEHMARYVDVFKRQDR 521
           + +K  ++F+++ ++++  +   PPF P + N  D   FD   NE         F +Q  
Sbjct: 624 DEIKNHKFFNDLIWDSIWNKEYLPPFRPDVQNANDTSNFD---NE---------FTKQKP 671

Query: 522 LTAMVDDSLSDS 533
           + +++D+ LS+S
Sbjct: 672 VDSVIDEYLSES 683

>Scas_651.18
          Length = 371

 Score =  144 bits (362), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 101/355 (28%), Positives = 159/355 (44%), Gaps = 59/355 (16%)

Query: 161 RKRRLKPKHKDFEMITXXXXXXXXXXXLARKKDTKEICAXXXXXXXXXXXXEGTDHVLTE 220
           RK   K    DF+++            L R        A            +  +H   E
Sbjct: 48  RKTSGKYTLNDFQILRTLGTGSFGRVHLIRSNHNGRFYALKVLKKHTIVKLKQVEHTNDE 107

Query: 221 RDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMF 280
           R +L+     +LV++   FQD + +++ M+++ GG+  +LL  ++    P A+FY +E+ 
Sbjct: 108 RLMLSVVSHPFLVRMWGTFQDFEQVFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVC 167

Query: 281 CAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLE 340
            A+  LH +   +RDLKPEN L+D  GHIK+TDFG A     +                 
Sbjct: 168 LALEYLHSMDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDI----------------- 210

Query: 341 FPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCIL 400
                                      ++  G+PDY+A EV+  K Y+ +VD+WS G ++
Sbjct: 211 --------------------------TYTLCGTPDYIAPEVVSTKPYNKSVDWWSFGILI 244

Query: 401 FESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITRLIADPI--- 457
           +E L GYTPF  ++T +TYEN+ N K  L+ P        F D   +L+++LI   +   
Sbjct: 245 YEMLAGYTPFYDSNTMKTYENILNCK--LKFPNF------FHDDVKDLLSKLITKNLTER 296

Query: 458 --NRLKSFEHVKRMRYFSEIDFNTL--RTIHPPFIPQL-DNEEDVGYFDDFTNEE 507
             N     E VKR  +FSE+ +  L  R I  P+ P +   + D   FD +  EE
Sbjct: 297 LGNLQNGSEDVKRHPWFSEVIWEKLLSRNIETPYEPPIQQGQGDTSQFDRYPEEE 351

>KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1
           Kluyveromyces lactis MUP1 protein, hypothetical start
          Length = 774

 Score =  149 bits (376), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 108/377 (28%), Positives = 176/377 (46%), Gaps = 42/377 (11%)

Query: 120 RRERTRQVINYLEEQRRSNLMGTEQITNEWQGYLTKETNILRKRRLKPKHKDFEMITXXX 179
           RR       ++++  +RS  +  +  +N++Q  L                + FE I    
Sbjct: 340 RRGTVGADASFIQPPKRSERLRNKSFSNKFQDILVGP-------------QSFEKIRLLG 386

Query: 180 XXXXXXXXLARKKDTKEICAXXXXXXXXXXXXEGTDHVLTERDILTTTRSEWLVKLLYAF 239
                   L R+K T  + A            +    +LTE++IL T+   ++V L ++F
Sbjct: 387 QGDVGRVYLVREKQTNRLYALKIFSKPEMIKRKKIKRILTEQEILATSNHPFIVTLYHSF 446

Query: 240 QDPQSLYLAMEFVPGGDFRTLLLN--TKFLQAPHARFYISEMFCAVNALHQLGYTHRDLK 297
           Q    LYL ME+  GG+F   L    TK +    ARFY SE+  A+  LH +G+ +RDLK
Sbjct: 447 QTEDYLYLCMEYCMGGEFFRALQTRKTKCISEDDARFYSSEVTAALEYLHLMGFIYRDLK 506

Query: 298 PENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYN 357
           PEN L+   GHI L+DF L+             ++ ++ KN +       S+ D +   +
Sbjct: 507 PENILLHQSGHIMLSDFDLS-------------VQAKDTKNPQVKGNASHSLVDTKICSD 553

Query: 358 KLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGNSTNE 417
             R       +S VG+ +Y+A EV+    +   VD+W+LG +++E L G+TPF G++TN+
Sbjct: 554 GFR------TNSFVGTEEYIAPEVIRGNGHTAAVDWWTLGILIYEMLFGFTPFKGDNTNQ 607

Query: 418 TYENLRNWKHVLQRPKCDNGRYAFSDRTWELITRLIADPINRLKS---FEHVKRMRYFSE 474
           T+ N+   K+ +  P  +    A  D   +L   LI +   RL S      +K+  +F  
Sbjct: 608 TFSNI--LKNEVVIPNNNETSRACKDLIRKL---LIKNENKRLGSKLGASDIKKHPFFKN 662

Query: 475 IDFNTLRTIHPPFIPQL 491
             ++ LR   PP IP L
Sbjct: 663 DQWSLLRNQEPPLIPVL 679

>Scas_720.103
          Length = 804

 Score =  149 bits (375), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 100/336 (29%), Positives = 164/336 (48%), Gaps = 25/336 (7%)

Query: 165 LKPKHKDFEMITXXXXXXXXXXXLARKKDTKEICAXXXXXXXXXXXXEGTDHVLTERDIL 224
           +K   + FE I            L ++K T  + A            E    V+TE++IL
Sbjct: 398 IKVNPQSFEKIKLLGQGDVGKVFLVKEKKTNGLYAMKIYNKKDMIKREKIKRVITEQEIL 457

Query: 225 TTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLL--NTKFLQAPHARFYISEMFCA 282
            T+   ++V L ++FQ    LYL ME+  GG+F   L   ++K +    ARFY SE+  A
Sbjct: 458 ATSNHPFIVTLYHSFQTEDYLYLCMEYCMGGEFFRALQTRDSKCICEDDARFYASEVLAA 517

Query: 283 VNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFP 342
           +  LH LG+ +RDLKPEN L+   GHI L+DF L+             +  ++ KN   P
Sbjct: 518 LEYLHLLGFIYRDLKPENILLHKSGHIMLSDFDLS-------------VHAKDSKN---P 561

Query: 343 EFRERSM----DDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGC 398
            F +  +    +    +  K+  E  R  +S VG+ +Y+A EV+    +   VD+W+LG 
Sbjct: 562 IFMKDGILPTTNSNLIVDTKICSEGFR-TNSFVGTEEYIAPEVIRGNGHTVAVDWWTLGI 620

Query: 399 ILFESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITRLIADPIN 458
           ++FE L G TPF G++TNET+ N+       + P  ++      +   +L+T+     + 
Sbjct: 621 LIFEMLFGKTPFKGDTTNETFANI--LSKDFEFPNSNDITRNCKNLIKKLLTKNETKRLG 678

Query: 459 RLKSFEHVKRMRYFSEIDFNTLRTIHPPFIPQLDNE 494
                  +K+  +F  +++N LR   PP IP+L ++
Sbjct: 679 SKMGAAEIKKHSFFKNVNWNMLRNEEPPLIPELSSD 714

>Scas_629.16
          Length = 918

 Score =  147 bits (372), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 112/387 (28%), Positives = 178/387 (45%), Gaps = 36/387 (9%)

Query: 120 RRERTRQVINYLEEQRRSNLMGTEQ-ITNEWQGYLTKETNILRKRRLKPKH--------- 169
           +RE T +  N     +RSN +   + I +E       E    R RRL+ K          
Sbjct: 454 QRESTPEDNNSDINSKRSNTVSASKFIPSEPPRIPAVEEEPKRSRRLRNKSFSNKFKDIT 513

Query: 170 ---KDFEMITXXXXXXXXXXXLARKKDTKEICAXXXXXXXXXXXXEGTDHVLTERDILTT 226
              + FE I            L R+K T  + A            +    +L E++IL T
Sbjct: 514 VGPQSFEKIKLLGQGDVGKVYLVREKKTNRLYALKIFSKSEMIKRKKIKRILAEQEILAT 573

Query: 227 TRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLN--TKFLQAPHARFYISEMFCAVN 284
           +   ++V L ++FQ    LY  ME+  GG+F   L    TK +    ARFY SE+  A+ 
Sbjct: 574 SNHPFVVTLYHSFQSEDYLYFCMEYCMGGEFFRALQTRRTKCISEDDARFYASEVTAALE 633

Query: 285 ALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEF 344
            LH LG+ +RDLKPEN L+   GHI L+DF L+             ++ ++ K       
Sbjct: 634 YLHLLGFIYRDLKPENILLHKSGHIMLSDFDLS-------------VQAKDAKVPVMKGS 680

Query: 345 RERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESL 404
            E ++ D +   +  R       +S VG+ +Y+A EV+    +   VD+W+LG +++E L
Sbjct: 681 AESTVVDTKICSDGFR------TNSFVGTEEYIAPEVIRGNGHTAAVDWWTLGILIYEML 734

Query: 405 VGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITRLIADPINRLKSFE 464
            G+TPF G+S+NET+ N+   K+ +  P  ++      D   +L+ +  A  +       
Sbjct: 735 FGFTPFKGSSSNETFSNI--LKNDVSFPNNNDISRNCKDLIKKLLCKNEAKRLGSKMGAA 792

Query: 465 HVKRMRYFSEIDFNTLRTIHPPFIPQL 491
            VKR  +F ++ ++ LR   PP IP L
Sbjct: 793 DVKRHPFFKKVQWSFLRNQEPPLIPIL 819

>YMR104C (YPK2) [4061] chr13 complement(473419..475452)
           Serine/threonine protein kinase with similarity to
           Ypk1p, involved in the cell integrity signaling pathway
           [2034 bp, 677 aa]
          Length = 677

 Score =  147 bits (370), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 108/380 (28%), Positives = 169/380 (44%), Gaps = 62/380 (16%)

Query: 171 DFEMITXXXXXXXXXXXLARKKDTKEICAXXXXXXXXXXXXEGTDHVLTERDILTTTRSE 230
           DF+++              RKKDT++I A                H L ER +L      
Sbjct: 343 DFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCP 402

Query: 231 WLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLG 290
           ++V L ++FQ P+ LYL + F+ GG+    L +        +RFYI+E+ CA+++LH+L 
Sbjct: 403 FIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLD 462

Query: 291 YTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMD 350
             +RDLKPEN L+D +GHI L DFGL                                  
Sbjct: 463 VIYRDLKPENILLDYQGHIALCDFGLC--------------------------------- 489

Query: 351 DRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPF 410
                  KL  ++     +  G+P+Y+A E+L  + Y  TVD+W+LG +L+E + G  P+
Sbjct: 490 -------KLNMKDNDKTDTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPY 542

Query: 411 SGNSTNETYENLRNWKHVLQRPKC--DNGRYAFSDRTWELITRLIADPINRL--KSFEHV 466
              +    Y      K +LQ+P    D    A  D    L++R   DP  RL     + +
Sbjct: 543 YDENVPVMY------KKILQQPLLFPDGFDPAAKDLLIGLLSR---DPSRRLGVNGTDEI 593

Query: 467 KRMRYFSEIDFNT--LRTIHPPFIPQLDNEEDVGYFD-DFTNEEHMARYVDVF------K 517
           +   +F +I +    L+   PP+ P + +E D   FD +FT E+ +   VD +      K
Sbjct: 594 RNHPFFKDISWKKLLLKGYIPPYKPIVKSEIDTANFDQEFTKEKPIDSVVDEYLSASIQK 653

Query: 518 RQDRLTAMVDDSLSDSKLVG 537
           +    T + D+ L DS   G
Sbjct: 654 QFGGWTYIGDEQLGDSPSQG 673

>YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine
           protein kinase with unknown role [2163 bp, 720 aa]
          Length = 720

 Score =  146 bits (369), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 103/365 (28%), Positives = 173/365 (47%), Gaps = 43/365 (11%)

Query: 133 EQRRSNLMGTEQITNEWQGYLTKETNILRKRRLKPKHKDFEMITXXXXXXXXXXXLARKK 192
           E RRS  + T+   N++Q    +              + FE I            L R++
Sbjct: 298 EPRRSRRLRTKSFGNKFQDITVEP-------------QSFEKIRLLGQGDVGKVYLMRER 344

Query: 193 DTKEICAXXXXXXXXXXXXEGTDHVLTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFV 252
           DT +I A            +    VLTE++IL T+   ++V L ++FQ    LYL ME+ 
Sbjct: 345 DTNQIFALKVLNKHEMIKRKKIKRVLTEQEILATSDHPFIVTLYHSFQTKDYLYLCMEYC 404

Query: 253 PGGDFRTLLLN--TKFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIK 310
            GG+F   L    +K +    A+FY SE+  A+  LH LG+ +RDLKPEN L+   GH+ 
Sbjct: 405 MGGEFFRALQTRKSKCIAEEDAKFYASEVVAALEYLHLLGFIYRDLKPENILLHQSGHVM 464

Query: 311 LTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHST 370
           L+DF L+                     ++    ++ +M D   +  K+  +  R  +S 
Sbjct: 465 LSDFDLS---------------------IQATGSKKPTMKDSTYLDTKICSDGFR-TNSF 502

Query: 371 VGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGNSTNETYENL--RNWKHV 428
           VG+ +Y+A EV+    +   VD+W+LG +++E L G TPF G+++NET+ N+  ++ K  
Sbjct: 503 VGTEEYLAPEVIRGNGHTAAVDWWTLGILIYEMLFGCTPFKGDNSNETFSNILTKDVKFP 562

Query: 429 LQRPKCDNGRYAFSDRTWELITRLIADPINRLKSFEHVKRMRYFSEIDFNTLRTIHPPFI 488
             +    N +    D   +L+ +  A  +        +KR  +F ++ ++ LR   PP I
Sbjct: 563 HDKEVSKNCK----DLIKKLLNKNEAKRLGSKSGAADIKRHPFFKKVQWSFLRNQDPPLI 618

Query: 489 PQLDN 493
           P L++
Sbjct: 619 PALND 623

>Kwal_33.13846
          Length = 375

 Score =  141 bits (356), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 102/381 (26%), Positives = 172/381 (45%), Gaps = 58/381 (15%)

Query: 133 EQRRSNLMGTEQITNEWQGYLTKETNILRKRRLKPKH--KDFEMITXXXXXXXXXXXLAR 190
           + R+SN +G + +  +       ++  L  R+   K+   DF ++            L R
Sbjct: 29  QTRQSNSLGQQAVEAK-----HVQSAALHSRQTSGKYTLNDFHILRTLGTGSFGRVHLVR 83

Query: 191 KKDTKEICAXXXXXXXXXXXXEGTDHVLTERDILTTTRSEWLVKLLYAFQDPQSLYLAME 250
                   A            +  +H   ER +L+     +++++   FQD + +++ M+
Sbjct: 84  SNHNGRFYAMKVLKKRTIVKLKQVEHTNDERRMLSVVSHPFIIRMWGTFQDAEHVFMIMD 143

Query: 251 FVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIK 310
           ++ GG+  +LL  ++    P A+FY +E+  A+  LH     +RDLKPEN L+D  GH+K
Sbjct: 144 YIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHAQDIIYRDLKPENVLLDKNGHVK 203

Query: 311 LTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHST 370
           +TDFG A     +                                            ++ 
Sbjct: 204 ITDFGFAKFVPDV-------------------------------------------TYTL 220

Query: 371 VGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGNSTNETYENLRNWKHVLQ 430
            G+PDY+A EV+  K Y+ +VD+WS G ++FE L GYTPF  ++T +TYEN+ N +  LQ
Sbjct: 221 CGTPDYIAPEVVSTKPYNKSVDWWSFGILIFEMLAGYTPFYDSNTMKTYENILNAE--LQ 278

Query: 431 RPKCDNGRYAFSDRTWELITRLIADPINRLKS-FEHVKRMRYFSEIDFNTL--RTIHPPF 487
            P   +      D   +LITR ++  +  LK+  E VK   +FSE+ +  L  R I  P+
Sbjct: 279 FPPFFHSD--VQDLLSQLITRDLSKRLGNLKNGSEDVKNHAWFSEVVWEKLLCRNIETPY 336

Query: 488 IPQLD-NEEDVGYFDDFTNEE 507
            P +   + D   +D +  EE
Sbjct: 337 EPPVQAGQGDTSQYDRYPEEE 357

>ADR167W [1909] [Homologous to ScYNR047W - SH; ScYCR091W (KIN82) -
           SH] complement(994583..997204) [2622 bp, 873 aa]
          Length = 873

 Score =  146 bits (368), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 107/397 (26%), Positives = 187/397 (47%), Gaps = 45/397 (11%)

Query: 158 NILRKRRLKPKHKDFEMITXXXXXXXXXXXLARKKDTKEICAXXXXXXXXXXXXEGTDHV 217
           N  R+  + P+   FE I            L R+K +  + A            +    +
Sbjct: 449 NKFREAVVGPQ--SFEKIRLLGQGDVGKVYLVREKKSDRLYALKIFGKAEMIKRKKIKRI 506

Query: 218 LTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLN--TKFLQAPHARFY 275
           L E++IL T+   ++V L ++FQ    LYL ME+  GG+F   L    TK +    ARFY
Sbjct: 507 LAEQEILATSNHPFIVTLYHSFQTEDYLYLCMEYCMGGEFFRALQTRKTKCISEDDARFY 566

Query: 276 ISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQE 335
            SE+  A+  LH +G+ +RDLKPEN L+   GH+ L+DF L+             ++ + 
Sbjct: 567 ASEVTAALEYLHLMGFIYRDLKPENILLHQSGHVMLSDFDLS-------------VQAKG 613

Query: 336 VKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWS 395
            +N +     + S+ D +   +  R       +S VG+ +Y+A EV+    +  +VD+W+
Sbjct: 614 TRNPQVKGNAQSSLVDTKVCSDGFR------TNSFVGTEEYIAPEVIRGNGHTASVDWWT 667

Query: 396 LGCILFESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITRLIAD 455
           LG + +E L G+TPF G++TN+T+ N+   K+ +  P  ++      D   +L+ +  + 
Sbjct: 668 LGILTYEMLFGFTPFKGDNTNQTFSNI--LKNDVYFPNNNDISRTCKDLIKKLLVKKESK 725

Query: 456 PINRLKSFEHVKRMRYFSEIDFNTLRTIHPPFIP----------QLDNEEDV------GY 499
            +        +K+  +F  + +  LR   PP IP          +L +++DV      G 
Sbjct: 726 RLGSKFGASEIKKHPFFKTVQWALLRNQEPPLIPVLTEDGYDFAKLSHKKDVKKAEKFGP 785

Query: 500 FDDFTNEEHMARYVDVFKRQDRL----TAMVDDSLSD 532
             D T++  +A  +D  + Q+R+        DD++SD
Sbjct: 786 SGDSTHKFKVAASIDSVEEQERIMFEEKVEHDDAVSD 822

>KLLA0B07205g complement(624606..625973) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3
           cAMP-dependent protein kinase 3, catalytic chain,
           hypothetical start
          Length = 455

 Score =  142 bits (357), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 101/361 (27%), Positives = 163/361 (45%), Gaps = 61/361 (16%)

Query: 157 TNILRKRRLKPKHK--DFEMITXXXXXXXXXXXLARKKDTKEICAXXXXXXXXXXXXEGT 214
           T+ L+ R    K+   DF+++            L R        A            +  
Sbjct: 128 TSTLKARVTSGKYALYDFQILRTLGTGSFGRVHLVRSNHNGRFYAMKVLKKNTVVKLKQV 187

Query: 215 DHVLTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARF 274
           +H   ER++L+     +++++   FQD Q L++ M+++ GG+  +LL  ++    P A+F
Sbjct: 188 EHTNDERNMLSIVSHPFIIRMWGTFQDSQQLFMIMDYIEGGELFSLLRKSQRFPNPVAKF 247

Query: 275 YISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQ 334
           Y +E+  A+  LH  G  +RDLKPEN L+D  GHIKLTDFG A     +           
Sbjct: 248 YAAEVCLALEYLHSKGIIYRDLKPENILLDKNGHIKLTDFGFAKYVPDV----------- 296

Query: 335 EVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYW 394
                                            ++  G+PDY+A EV+  K Y+ +VD+W
Sbjct: 297 --------------------------------TYTLCGTPDYIAPEVVSTKPYNKSVDWW 324

Query: 395 SLGCILFESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITRLIA 454
           S G +++E L GYTPF  ++T +TYEN+ N    ++ P        F     +LI++LI 
Sbjct: 325 SFGVLIYEMLAGYTPFYDSNTIKTYENILNAP--VRFPPF------FHSDAQDLISKLIT 376

Query: 455 -DPINRLKSF----EHVKRMRYFSEIDFNTL--RTIHPPFIPQLD-NEEDVGYFDDFTNE 506
            D   RL +     E VK   +FSE+ +  L  + I  P+ P +   + D   +D +  E
Sbjct: 377 RDLSQRLGNLQNGSEDVKNHPWFSEVVWEKLLCKNIETPYEPPIQAGQGDTSQYDRYPEE 436

Query: 507 E 507
           E
Sbjct: 437 E 437

>Kwal_23.6458
          Length = 868

 Score =  144 bits (364), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 103/341 (30%), Positives = 166/341 (48%), Gaps = 36/341 (10%)

Query: 170 KDFEMITXXXXXXXXXXXLARKKDTKEICAXXXXXXXXXXXXEGTDHVLTERDILTTTRS 229
           + FE I            L ++K T  + A            +    +L E++IL T+  
Sbjct: 462 QSFEKIKLLGQGDVGKVYLVKEKKTNRLYALKIFSKEEMIKRKKIKRILAEQEILATSNH 521

Query: 230 EWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLN--TKFLQAPHARFYISEMFCAVNALH 287
            ++V L ++FQ    LYL ME+  GG+F   L    TK +    ARFY SE+  A+  LH
Sbjct: 522 PFIVTLYHSFQSEDYLYLCMEYCMGGEFFRALQTRKTKCIDEDDARFYSSEVVAAIEYLH 581

Query: 288 QLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRER 347
            +G+ +RDLKPEN L+   GHI L+DF L+             ++ ++ KN       + 
Sbjct: 582 LMGFIYRDLKPENILLHKSGHIMLSDFDLS-------------VQAKDTKNPVVKGSAQS 628

Query: 348 SMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGY 407
           S+ D +   +  R       +S VG+ +Y+A EV+    +   VD+W+LG +++E L G+
Sbjct: 629 SLLDTKICSDGFR------TNSFVGTEEYIAPEVIRGNGHTAAVDWWTLGILIYEMLFGF 682

Query: 408 TPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITR-LIADPINRLKS---F 463
           TP+ G++TN+T+ N+   K+ +  P  +      S    +LI + LI     RL S    
Sbjct: 683 TPYKGDNTNKTFSNV--LKNEVSFPNNNE----VSRNCKDLIRKLLIKSETRRLGSKFGA 736

Query: 464 EHVKRMRYFSEIDFNTLRTIHPPFIPQLDNEEDVGYFDDFT 504
             +K+  +F ++ ++ LR   PP IP L    + GY  DFT
Sbjct: 737 SDIKKHPFFKKVQWSLLRNQEPPLIPVL---TENGY--DFT 772

>CAGL0C03509g complement(350846..353533) similar to sp|P53739
           Saccharomyces cerevisiae YNR047w or sp|P25341
           Saccharomyces cerevisiae YCR091w KIN82, hypothetical
           start
          Length = 895

 Score =  144 bits (362), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 115/417 (27%), Positives = 192/417 (46%), Gaps = 56/417 (13%)

Query: 131 LEEQRRSNLMGTEQITNEWQGYLTKETNILRKRRLKPKHKDFEMITXXXXXXXXXXXLAR 190
           ++E RRS+ +  +  +N++Q                   + FE I            L +
Sbjct: 469 IKEPRRSSRLRNKSFSNKFQDITVGP-------------QSFEKIRLLGQGDVGKVYLVK 515

Query: 191 KKDTKEICAXXXXXXXXXXXXEGTDHVLTERDILTTTRSEWLVKLLYAFQDPQSLYLAME 250
           +K T  + A            +    +L E++IL T+   ++V L ++FQ    LYL ME
Sbjct: 516 EKRTNRLYALKIFSKSEMIKRKKIKRILAEQEILATSNHPFVVTLYHSFQSEDYLYLCME 575

Query: 251 FVPGGDFRTLLLN--TKFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFLIDSKGH 308
           +  GG+F   L    +K +    A+FY SE+  A+  LH LG+ +RDLKPEN L+   GH
Sbjct: 576 YCMGGEFFRALQTRKSKCISEEDAKFYASEVTAALEYLHLLGFIYRDLKPENILLHQSGH 635

Query: 309 IKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAH 368
           I L+DF L+        I++   ++  VK        + ++ D +   +  R       +
Sbjct: 636 IMLSDFDLS--------IQAKDAKVPVVKG-----NAQSTVVDTKICSDGFR------TN 676

Query: 369 STVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGNSTNETYENLRNWKHV 428
           S VG+ +Y+A EV+    +   VD+W+LG +++E L G+TPF G +TNET+ N      +
Sbjct: 677 SFVGTEEYIAPEVIRGNGHTAAVDWWTLGILIYEMLFGFTPFKGENTNETFSN------I 730

Query: 429 LQRPKCDNGRYAFSDRTWELITR-LIADPINRLKS---FEHVKRMRYFSEIDFNTLRTIH 484
           L++          S    +LI + LI +   RL S      +K+  +F ++++  LR   
Sbjct: 731 LKKDVTFPNNNEVSRNCKDLIKKLLIKNESKRLGSKMGAADIKKHPFFKKVNWTLLRNQE 790

Query: 485 PPFIPQLDNEEDVGYFDDFTNEEHMARYVDVFKRQDRLTAMVDDSLSDSKLVGFTFR 541
           PP IP L    + GY  DFT        +   K ++R      DS+ + + + F  R
Sbjct: 791 PPLIPVL---TENGY--DFTK-------LSSNKNKNRANGTEKDSIDEQERIMFEER 835

>ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C
           (YPK2) - SH] complement(345955..348123) [2169 bp, 722
           aa]
          Length = 722

 Score =  142 bits (357), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 100/353 (28%), Positives = 155/353 (43%), Gaps = 56/353 (15%)

Query: 171 DFEMITXXXXXXXXXXXLARKKDTKEICAXXXXXXXXXXXXEGTDHVLTERDILTTTRSE 230
           DF+++              +KKDT +I A                H L ER +L    + 
Sbjct: 388 DFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNP 447

Query: 231 WLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLG 290
           ++V L ++FQ P+ LYL + F+ GG+    L          ARFY +E+ CA+  LH L 
Sbjct: 448 FIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSLN 507

Query: 291 YTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMD 350
             +RDLKPEN L+D +GHI L DFGL                                  
Sbjct: 508 VIYRDLKPENILLDYQGHIALCDFGLC--------------------------------- 534

Query: 351 DRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPF 410
                  KL  ++    ++  G+P+Y+A E+L  + Y   VD+W+LG +L+E L G  P+
Sbjct: 535 -------KLNMKDQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPY 587

Query: 411 SGNSTNETYENLRNWKHVLQRP-KCDNGRYAFSDRTWELITRLIA-DPINRL--KSFEHV 466
                 + Y      K +LQ P +  +G   F      L+  L+  DP  RL     + +
Sbjct: 588 YDEDVPKMY------KKILQEPLRFPDG---FDREAKNLLIELLCRDPKRRLGYNGADEI 638

Query: 467 KRMRYFSEIDFNTL--RTIHPPFIPQLDNEEDVGYFD-DFTNEEHMARYVDVF 516
           KR  +FS++ +  L  +   PP+ P + +  D   FD +FT E+ +   V+ F
Sbjct: 639 KRHPFFSQLSWKRLWMKGYIPPYKPPVMSALDTSNFDQEFTREKPVDSVVNDF 691

>YKL126W (YPK1) [3140] chr11 (205353..207395) Serine/threonine
           protein kinase involved in the cell integrity signaling
           pathway and required for endocytosis, possibly involved
           in a sphingolipid-mediated signaling pathway, has
           similarity to protein kinase C [2043 bp, 680 aa]
          Length = 680

 Score =  141 bits (356), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 111/391 (28%), Positives = 173/391 (44%), Gaps = 71/391 (18%)

Query: 171 DFEMITXXXXXXXXXXXLARKKDTKEICAXXXXXXXXXXXXEGTDHVLTERDILTTTRSE 230
           DF+++              RKKDT+++ A                H L ER +L      
Sbjct: 346 DFDLLKVIGKGSFGKVMQVRKKDTQKVYALKAIRKSYIVSKSEVTHTLAERTVLARVDCP 405

Query: 231 WLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLG 290
           ++V L ++FQ P+ LY  + F+ GG+    L          ARFY +E+ CA++ LH+L 
Sbjct: 406 FIVPLKFSFQSPEKLYFVLAFINGGELFYHLQKEGRFDLSRARFYTAELLCALDNLHKLD 465

Query: 291 YTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMD 350
             +RDLKPEN L+D +GHI L DFGL             K+ +++              D
Sbjct: 466 VVYRDLKPENILLDYQGHIALCDFGLC------------KLNMKD--------------D 499

Query: 351 DRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPF 410
           D+   +               G+P+Y+A E+L    Y   VD+W+LG +L+E L G  P+
Sbjct: 500 DKTDTF--------------CGTPEYLAPELLLGLGYTKAVDWWTLGVLLYEMLTGLPPY 545

Query: 411 SGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWE--LITRLIADPINRL--KSFEHV 466
                 + Y      K +LQ P      +   DR  +  LI  L  DP  RL     + +
Sbjct: 546 YDEDVPKMY------KKILQEPLVFPDGF---DRDAKDLLIGLLSRDPTRRLGYNGADEI 596

Query: 467 KRMRYFSEIDFNTL--RTIHPPFIPQLDNEEDVGYFDDFTNEEHMARYVDVFKRQDRLTA 524
           +   +FS++ +  L  +   PP+ P + N  D   FD    EE        F R+  + +
Sbjct: 597 RNHPFFSQLSWKRLLMKGYIPPYKPAVSNSMDTSNFD----EE--------FTREKPIDS 644

Query: 525 MVDDSLSDS---KLVGFTFRHRNGKDGSSGV 552
           +VD+ LS+S   +  G+T+   N + GSS V
Sbjct: 645 VVDEYLSESVQKQFGGWTYVG-NEQLGSSMV 674

>YKL166C (TPK3) [3104] chr11 complement(134514..135710) Catalytic
           subunit of cAMP-dependent protein kinase 3, protein
           kinase A or PKA [1197 bp, 398 aa]
          Length = 398

 Score =  137 bits (345), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 89/298 (29%), Positives = 148/298 (49%), Gaps = 51/298 (17%)

Query: 214 TDHVLTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHAR 273
            +H   ER +L+     +++++   FQD Q +++ M+++ GG+  +LL  ++    P A+
Sbjct: 130 VEHTNDERRMLSIVSHPFIIRMWGTFQDSQQVFMVMDYIEGGELFSLLRKSQRFPNPVAK 189

Query: 274 FYISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRL 333
           FY +E+  A+  LH     +RDLKPEN L+D  GHIK+TDFG A     +          
Sbjct: 190 FYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDV---------- 239

Query: 334 QEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDY 393
                                             ++  G+PDY+A EV+  K Y+ +VD+
Sbjct: 240 ---------------------------------TYTLCGTPDYIAPEVVSTKPYNKSVDW 266

Query: 394 WSLGCILFESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITRLI 453
           WS G +++E L GYTPF  ++T +TYEN+ N +  L+ P   +      D   +LITR +
Sbjct: 267 WSFGVLIYEMLAGYTPFYNSNTMKTYENILNAE--LKFPPFFHPDA--QDLLKKLITRDL 322

Query: 454 ADPINRLKS-FEHVKRMRYFSEIDFNTL--RTIHPPFIPQL-DNEEDVGYFDDFTNEE 507
           ++ +  L++  E VK   +F+E+ +  L  R I  P+ P +   + D   FD +  EE
Sbjct: 323 SERLGNLQNGSEDVKNHPWFNEVIWEKLLARYIETPYEPPIQQGQGDTSQFDRYPEEE 380

>AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C
           (TPK1) - SH] (405062..406222) [1161 bp, 386 aa]
          Length = 386

 Score =  135 bits (340), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 87/297 (29%), Positives = 145/297 (48%), Gaps = 51/297 (17%)

Query: 215 DHVLTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARF 274
           +H   ER +L+     +++++   FQD   +++ M+++ GG+  +LL  ++    P A+F
Sbjct: 119 EHTNDERKMLSVVSHPFIIRMWGTFQDAHQVFMIMDYIEGGELFSLLRKSQRFPNPVAKF 178

Query: 275 YISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQ 334
           Y +E+  A+  LH     +RDLKPEN L+D  GHIKLTDFG A     +           
Sbjct: 179 YAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKLTDFGFAKYVPDV----------- 227

Query: 335 EVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYW 394
                                            ++  G+PDY+A EV+  K Y+ +VD+W
Sbjct: 228 --------------------------------TYTLCGTPDYIAPEVVSTKPYNKSVDWW 255

Query: 395 SLGCILFESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITRLIA 454
           S G +++E L GYTPF   +T  TYEN+ N +  ++ P   N +    D   +LITR ++
Sbjct: 256 SFGILIYEMLAGYTPFYDQNTMGTYENILNAE--VKFPPFFNAK--VRDLLSQLITRDLS 311

Query: 455 DPINRLKSFEH-VKRMRYFSEIDFNTL--RTIHPPFIPQLD-NEEDVGYFDDFTNEE 507
             +  L++    VK   +FSE+ ++ L  R I  P+ P +   + D   +D +  E+
Sbjct: 312 KRLGNLQNGSQDVKAHPWFSEVIWDKLLCRNIETPYEPPIHAGQGDTSQYDRYPEED 368

>YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic
           subunit of cAMP-dependent protein kinase 1, protein
           kinase A or PKA [1194 bp, 397 aa]
          Length = 397

 Score =  135 bits (340), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 93/347 (26%), Positives = 158/347 (45%), Gaps = 59/347 (17%)

Query: 169 HKDFEMITXXXXXXXXXXXLARKKDTKEICAXXXXXXXXXXXXEGTDHVLTERDILTTTR 228
           +K+F+++            L R +      A            +  +H   ER +L+   
Sbjct: 84  YKNFQILRTLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVVRLKQVEHTNDERLMLSIVT 143

Query: 229 SEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQ 288
             +++++   FQD Q +++ M+++ GG+  +LL  ++    P A+FY +E+  A+  LH 
Sbjct: 144 HPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHS 203

Query: 289 LGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERS 348
               +RDLKPEN L+D  GHIK+TDFG A     +                         
Sbjct: 204 KDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDV------------------------- 238

Query: 349 MDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYT 408
                              ++  G+PDY+A EV+  K Y+ ++D+WS G +++E L GYT
Sbjct: 239 ------------------TYTLCGTPDYIAPEVVSTKPYNKSIDWWSFGILIYEMLAGYT 280

Query: 409 PFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITRLIA-DPINRLKSF---- 463
           PF  ++T +TYE + N +  L+ P        F++   +L++RLI  D   RL +     
Sbjct: 281 PFYDSNTMKTYEKILNAE--LRFPPF------FNEDVKDLLSRLITRDLSQRLGNLQNGT 332

Query: 464 EHVKRMRYFSEIDFNTL--RTIHPPFIPQL-DNEEDVGYFDDFTNEE 507
           E VK   +F E+ +  L  R I  P+ P +   + D   FD +  E+
Sbjct: 333 EDVKNHPWFKEVVWEKLLSRNIETPYEPPIQQGQGDTSQFDKYPEED 379

>Scas_721.124
          Length = 684

 Score =  137 bits (345), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 100/353 (28%), Positives = 157/353 (44%), Gaps = 56/353 (15%)

Query: 171 DFEMITXXXXXXXXXXXLARKKDTKEICAXXXXXXXXXXXXEGTDHVLTERDILTTTRSE 230
           DF+++              RKKDT++I A                H L ER +L      
Sbjct: 350 DFDLLKVIGKGSFGKVMQVRKKDTQKIYALKAIRKAYIVSKSEVTHTLAERTVLARIDCP 409

Query: 231 WLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLG 290
           ++V L ++FQ P  LYL +  + GG+    L          +RFY +E+ CA+  LH L 
Sbjct: 410 FIVPLKFSFQSPDKLYLVLACINGGELFYHLQKEGRFDLSRSRFYAAELLCALETLHNLN 469

Query: 291 YTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMD 350
             +RDLKPEN L+D +GHI L DFGL             K+ +++              D
Sbjct: 470 VIYRDLKPENILLDYQGHIALCDFGLC------------KLNMKD--------------D 503

Query: 351 DRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPF 410
           D+   +               G+P+Y+A E+L  + Y   VD+W+LG +L+E L G  P+
Sbjct: 504 DKTDTF--------------CGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPY 549

Query: 411 SGNSTNETYENLRNWKHVLQRP-KCDNGRYAFSDRTWELITRLIA-DPINRL--KSFEHV 466
                 + Y      K +LQ P +  +G   F     +L+  L++ DP  RL     + +
Sbjct: 550 YDEDVPKMY------KKILQDPLRFPDG---FDRDAKDLLIGLLSRDPTRRLGCNGADEI 600

Query: 467 KRMRYFSEIDFNTL--RTIHPPFIPQLDNEEDVGYFD-DFTNEEHMARYVDVF 516
           K   +FS++ +  L  +   PP+ P + +  D   FD +FT E+ +   VD F
Sbjct: 601 KNHPFFSQLSWKRLLMKGYIPPYKPPVTSAIDTSNFDQEFTREKPVDSVVDEF 653

>CAGL0M08404g complement(836791..838179) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3 or
           sp|P06244 Saccharomyces cerevisiae YJL164c SRA3 or
           sp|P06245 Saccharomyces cerevisiae YPL203w TPK2,
           hypothetical start
          Length = 462

 Score =  134 bits (338), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 89/298 (29%), Positives = 146/298 (48%), Gaps = 51/298 (17%)

Query: 214 TDHVLTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHAR 273
            +H   ER +L+     +++++   FQD Q +++ M+++ GG+  +LL  ++    P A+
Sbjct: 194 VEHTNDERRMLSIVSHPFIIRMWGTFQDSQHVFMVMDYIEGGELFSLLRKSQRFPNPVAK 253

Query: 274 FYISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRL 333
           FY +E+  A+  LH     +RDLKPEN L+D  GHIK+TDFG A     +          
Sbjct: 254 FYAAEVCLALEYLHSKEIIYRDLKPENILLDKNGHIKITDFGFAKYVPDV---------- 303

Query: 334 QEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDY 393
                                             ++  G+PDY+A EV+  K Y+ +VD+
Sbjct: 304 ---------------------------------TYTLCGTPDYIAPEVVSTKPYNKSVDW 330

Query: 394 WSLGCILFESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITRLI 453
           WS G +++E L GYTPF   +T +TYE++ N +  L+ P   +      D   +LITR +
Sbjct: 331 WSFGILIYEMLAGYTPFYDANTMKTYEHILNSE--LKFPSFFHP--DVQDLLSKLITRDL 386

Query: 454 ADPINRLKS-FEHVKRMRYFSEIDFNTL--RTIHPPFIPQL-DNEEDVGYFDDFTNEE 507
           +  +  L++  E VK   +FSE+ +  L  R I  P+ P +   + D   FD +  EE
Sbjct: 387 SKRLGNLQNGSEDVKNHPWFSEVVWEKLLARYIETPYEPPIQQGQGDTSQFDRYPEEE 444

>Kwal_47.16761
          Length = 744

 Score =  137 bits (344), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 110/382 (28%), Positives = 165/382 (43%), Gaps = 66/382 (17%)

Query: 170 KDFEMITXXXXXXXXXXXLARKKDTKEICAXXXXXXXXXXXXEGTDHVLTERDILTTTRS 229
           +DFE++              RKKDTK I A                H + ER+IL  T S
Sbjct: 332 QDFEVLRLLGKGTFGQVYQVRKKDTKRIYAMKVLSKKVIVKKNEIAHTIGERNILVRTAS 391

Query: 230 E---WLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNAL 286
           +   ++V L ++FQ P  LYL  +F+ GG+    L          ARFYI+E+  A+  L
Sbjct: 392 KSCPFIVGLKFSFQTPADLYLVTDFMSGGELFWHLQKEGRFAEDRARFYIAELVLALEYL 451

Query: 287 HQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRE 346
           H+    +RDLKPEN L+D+ G+I L DFGL+                             
Sbjct: 452 HENDIVYRDLKPENILLDANGNIALCDFGLSKA--------------------------- 484

Query: 347 RSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALE-VLEAKNYDFTVDYWSLGCILFESLV 405
             + DR   +               G+ +Y+A E +L+   Y   VD+WSLG ++FE   
Sbjct: 485 -DLKDRTNTF--------------CGTTEYLAPELLLDESGYTKMVDFWSLGVLIFEMCC 529

Query: 406 GYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITRLIA-DPINRLKSFE 464
           G++PF      + Y+ +   K  ++ P     R   S      +  L+  +P +RL + +
Sbjct: 530 GWSPFFAEDNQKMYQKIAFGK--VKFP-----RDVLSPEGRSFVKGLLNRNPRHRLGAID 582

Query: 465 HVKRMR---YFSEIDFNTLRT--IHPPFIPQLDNEEDVGYFD-DFTNEEHMARYVDVFKR 518
             + +R   +F+EID+  LR   I PPF P L  E D   FD +FT      +    F  
Sbjct: 583 DGRELRAHPFFAEIDWEALRQKKIPPPFKPHLTGETDTSNFDPEFT------QTSTSFMN 636

Query: 519 QDRLTAMVDDSLSDSKLVGFTF 540
           +  + A        +K VGFTF
Sbjct: 637 KQGIAATPLSPAMQAKFVGFTF 658

>CAGL0G09020g 860266..861351 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, hypothetical start
          Length = 361

 Score =  131 bits (329), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 97/366 (26%), Positives = 166/366 (45%), Gaps = 63/366 (17%)

Query: 154 TKETNILRKRRLKPKHK----DFEMITXXXXXXXXXXXLARKKDTKEICAXXXXXXXXXX 209
           ++++ +L +R    K K    DF ++            L R        A          
Sbjct: 29  SQQSTLLAQRSTVSKGKYSLQDFHIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKAQVV 88

Query: 210 XXEGTDHVLTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQA 269
             +  +H   ER +L      +L+++   FQD ++L++ M+++ GG+  TLL  ++    
Sbjct: 89  KMKQIEHTNDERRMLKLVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFTLLRKSQRFPN 148

Query: 270 PHARFYISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESM 329
           P A+FY +E+  A+  LH     +RDLKPEN L+D  GHIK+TDFG A            
Sbjct: 149 PVAKFYAAEVTLALEYLHFHNIIYRDLKPENILLDRNGHIKITDFGFA------------ 196

Query: 330 KIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDF 389
               +EV+ + +                           +  G+PDY+A EV+  K Y+ 
Sbjct: 197 ----KEVETVTW---------------------------TLCGTPDYIAPEVIATKPYNK 225

Query: 390 TVDYWSLGCILFESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELI 449
           +VD+WSLG +++E L GYTPF   +  +TYE + + K V  +         F+    +L+
Sbjct: 226 SVDWWSLGVLIYEMLAGYTPFYDTTPMKTYEKILHGKVVYPQ--------FFNSDVIDLL 277

Query: 450 TRLI-ADPINRL----KSFEHVKRMRYFSEIDFNTL--RTIHPPFIPQLD-NEEDVGYFD 501
           ++L+ AD   R+    K  + +K   +F+E+ +  L  + I  P+ P +     D   FD
Sbjct: 278 SKLLTADLTRRIGNLQKGAQDIKSHPWFAEVVWEKLLAKDIETPYEPPITAGVGDTSLFD 337

Query: 502 DFTNEE 507
            +  E+
Sbjct: 338 QYPEEQ 343

>Kwal_26.7635
          Length = 691

 Score =  135 bits (340), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 98/353 (27%), Positives = 151/353 (42%), Gaps = 56/353 (15%)

Query: 171 DFEMITXXXXXXXXXXXLARKKDTKEICAXXXXXXXXXXXXEGTDHVLTERDILTTTRSE 230
           DFE++              RKKDT ++ A                H L ER +L    + 
Sbjct: 357 DFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENP 416

Query: 231 WLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLG 290
           ++V L + FQ P  LY+ + F+ GG+    L          AR Y +E+ CA+  LH L 
Sbjct: 417 FIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNLD 476

Query: 291 YTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMD 350
             +RDLKPEN L+D +GHI L DFGL                                  
Sbjct: 477 VIYRDLKPENILLDHQGHIALCDFGLC--------------------------------- 503

Query: 351 DRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPF 410
                  KL  +     ++  G+P+Y+A E+L  + Y   VD+W+LG +L+E + G  P+
Sbjct: 504 -------KLNMKGQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPY 556

Query: 411 SGNSTNETYENLRNWKHVLQRP-KCDNGRYAFSDRTWELITRLIA-DPINRL--KSFEHV 466
                 + Y      K +LQ P +  +G   F     +L+  L++ DP  RL     + +
Sbjct: 557 YDEDVPKMY------KKILQEPLRFPDG---FDKDAKDLLIGLLSRDPKRRLGFNGADEI 607

Query: 467 KRMRYFSEIDFNTL--RTIHPPFIPQLDNEEDVGYFD-DFTNEEHMARYVDVF 516
           K   +FS++ +  L  +   PP+ P + N  D   FD +FT E  +   V+ F
Sbjct: 608 KSHPFFSQLSWKRLWMKGYIPPYKPPVMNSLDTSNFDQEFTKELPVDSVVNDF 660

>YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway that is probably
           parallel to cAMP pathway, affects life span [2475 bp,
           824 aa]
          Length = 824

 Score =  135 bits (341), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 110/391 (28%), Positives = 174/391 (44%), Gaps = 66/391 (16%)

Query: 161 RKRRLKPKHKDFEMITXXXXXXXXXXXLARKKDTKEICAXXXXXXXXXXXXEGTDHVLTE 220
           +KR   P+  DFE++              +KKDT+ I A                H + E
Sbjct: 403 KKRHYGPQ--DFEVLRLLGKGTFGQVYQVKKKDTQRIYAMKVLSKKVIVKKNEIAHTIGE 460

Query: 221 RDILTTTRSE---WLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYIS 277
           R+IL TT S+   ++V L ++FQ P  LYL  +++ GG+    L          A+FYI+
Sbjct: 461 RNILVTTASKSSPFIVGLKFSFQTPTDLYLVTDYMSGGELFWHLQKEGRFSEDRAKFYIA 520

Query: 278 EMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVK 337
           E+  A+  LH     +RDLKPEN L+D+ G+I L DFGL+                    
Sbjct: 521 ELVLALEHLHDNDIVYRDLKPENILLDANGNIALCDFGLS-------------------- 560

Query: 338 NLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALE-VLEAKNYDFTVDYWSL 396
                   +  + DR   +               G+ +Y+A E +L+   Y   VD+WSL
Sbjct: 561 --------KADLKDRTNTF--------------CGTTEYLAPELLLDETGYTKMVDFWSL 598

Query: 397 GCILFESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITRLIA-D 455
           G ++FE   G++PF   +  + Y+ +   K  ++ P     R   S      +  L+  +
Sbjct: 599 GVLIFEMCCGWSPFFAENNQKMYQKIAFGK--VKFP-----RDVLSQEGRSFVKGLLNRN 651

Query: 456 PINRLKSFEHVKRMR---YFSEIDFNTLRT--IHPPFIPQLDNEEDVGYFD-DFTNEEHM 509
           P +RL + +  + +R   +F++ID+  L+   I PPF P L +E D   FD +FT     
Sbjct: 652 PKHRLGAIDDGRELRAHPFFADIDWEALKQKKIPPPFKPHLVSETDTSNFDPEFTTAS-- 709

Query: 510 ARYVDVFKRQDRLTAMVDDSLSDSKLVGFTF 540
             Y++  K Q  +TA        +K  GFTF
Sbjct: 710 TSYMN--KHQPMMTATPLSPAMQAKFAGFTF 738

>Scas_717.69
          Length = 674

 Score =  135 bits (339), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 97/354 (27%), Positives = 153/354 (43%), Gaps = 58/354 (16%)

Query: 171 DFEMITXXXXXXXXXXXLARKKDTKEICAXXXXXXXXXXXXEGTDHVLTERDILTTTRSE 230
           DF+++              RK+DT++I A                H L ER +L      
Sbjct: 344 DFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCP 403

Query: 231 WLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLG 290
           ++V L ++FQ P+ LYL +  + GG+    L      +   ARFY +E+ CA+  LH L 
Sbjct: 404 FIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNLD 463

Query: 291 YTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMD 350
             +RDLKPEN L+D +GHI L DFGL                                  
Sbjct: 464 VIYRDLKPENILLDYQGHIALCDFGLC--------------------------------- 490

Query: 351 DRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPF 410
                  KL  ++     +  G+P+Y+A E+L  + Y   VD+W+LG +L+E L G  P+
Sbjct: 491 -------KLNMKDQDKTDTFCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPY 543

Query: 411 SGNSTNETYENLRNWKHVLQRPKCDNGRY--AFSDRTWELITRLIA-DPINRL--KSFEH 465
                 + Y      + +LQ P     R+   F     +L+  L++ DP  RL       
Sbjct: 544 YDEDVPKMY------RKILQDPL----RFPEGFDRDAKDLLIGLLSRDPDRRLGCNGAHE 593

Query: 466 VKRMRYFSEIDFNTL--RTIHPPFIPQLDNEEDVGYFD-DFTNEEHMARYVDVF 516
           +K   +FS++ +  L  +   PP+ P + +  D   FD +FT E+ +   VD +
Sbjct: 594 IKNHPFFSQLSWKRLWNKGYIPPYKPPVSDAADTRNFDQEFTKEKPIDSVVDEY 647

>AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH]
           complement(274336..275376) [1041 bp, 346 aa]
          Length = 346

 Score =  129 bits (325), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 91/303 (30%), Positives = 145/303 (47%), Gaps = 60/303 (19%)

Query: 215 DHVLTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARF 274
           +H   ER +L      +L+++   FQD ++L++ M+++ GG+  +LL  ++    P A+F
Sbjct: 79  EHTNDERRMLKVVEHPFLIRMWGTFQDARNLFIVMDYIEGGELFSLLRKSQRFPNPVAKF 138

Query: 275 YISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQ 334
           Y +E+  A+  LH     +RDLKPEN L+D  GHIK+TDFG A                +
Sbjct: 139 YAAEVTLALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFA----------------K 182

Query: 335 EVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYW 394
           EV  + +                           +  G+PDY+A EV+  K Y+ ++D+W
Sbjct: 183 EVDTVTW---------------------------TLCGTPDYIAPEVITTKPYNKSIDWW 215

Query: 395 SLGCILFESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITRLIA 454
           SLG ++FE L GYTPF   +  +TYE +   K V            F     +L+ +LI 
Sbjct: 216 SLGILIFEMLAGYTPFYDVTPIKTYEKILAGKVVFPP--------FFHPDAIDLLGKLIT 267

Query: 455 DPINR----LKSFEH-VKRMRYFSEIDFNTL--RTIHPPFIPQLD-NEEDVGYFDDFTNE 506
           D + R    L+S    +K   +FSE+ +  L  + I  P+ P +     D   FD +  E
Sbjct: 268 DDLTRRLGNLQSGSQDIKSHPWFSEVIWEKLLAKDIETPYEPPITAGVGDSSLFDQYP-E 326

Query: 507 EHM 509
           EH+
Sbjct: 327 EHL 329

>CAGL0K03399g complement(310487..312598) highly similar to sp|P12688
           Saccharomyces cerevisiae YKL126w
           Serine/threonine-protein kinase, start by similarity
          Length = 703

 Score =  134 bits (338), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 105/384 (27%), Positives = 165/384 (42%), Gaps = 62/384 (16%)

Query: 171 DFEMITXXXXXXXXXXXLARKKDTKEICAXXXXXXXXXXXXEGTDHVLTERDILTTTRSE 230
           DF+++              RKKDTK+I A                H L ER +L      
Sbjct: 369 DFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCP 428

Query: 231 WLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLG 290
           ++V L ++FQ  + LYL +  + GG+    L          +RFY +E+ CA++ LH++ 
Sbjct: 429 FIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMD 488

Query: 291 YTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMD 350
             +RDLKPEN L+D +GHI L DFGL                                  
Sbjct: 489 VIYRDLKPENILLDYQGHIALCDFGLC--------------------------------- 515

Query: 351 DRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPF 410
                  KL  ++     +  G+P+Y+A E+L  + Y   VD+W+LG +L+E L G  P+
Sbjct: 516 -------KLNMKDEDKTDTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPY 568

Query: 411 SGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWE--LITRLIADPINRL--KSFEHV 466
              +  + Y      K +LQ P      +   DR  +  LI  L  DP  RL     + +
Sbjct: 569 YDENVPKMY------KKILQDPLVFPDGF---DRDAKDLLIGLLSRDPQRRLGYNGADEI 619

Query: 467 KRMRYFSEIDFNTL--RTIHPPFIPQLDNEEDVGYFD-DFTNEEHMARYVD------VFK 517
           K   +FS++ +  L  +   PP+ P + +  D   FD +FT E+ +   VD      V K
Sbjct: 620 KNHPFFSQLSWKRLLMKGYIPPYKPPVTSATDTSNFDQEFTREKPIDSVVDEYLSESVQK 679

Query: 518 RQDRLTAMVDDSLSDSKLVGFTFR 541
           +    T +  + L +S + G + R
Sbjct: 680 QFGGWTYVGSEQLGNSLVQGGSIR 703

>CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces
           cerevisiae YHR205w SCH9 serine/threonine protein kinase,
           start by similarity
          Length = 746

 Score =  134 bits (337), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 123/445 (27%), Positives = 184/445 (41%), Gaps = 77/445 (17%)

Query: 112 DMFDYVISRRERTRQVINYLEEQ---RRSNLMGTEQITNE----WQGYLTKETNILRKRR 164
           DMF   +  R       N   EQ    +S +M  E+IT E    W   LTK      KR 
Sbjct: 282 DMFLGQVRLRPNIHTTSNMSHEQWYPLQSRVM-DEKITGEILVKWHYTLTK------KRH 334

Query: 165 LKPKHKDFEMITXXXXXXXXXXXLARKKDTKEICAXXXXXXXXXXXXEGTDHVLTERDIL 224
             P+  DFE++              +KKDTK I A                H + ER+IL
Sbjct: 335 YGPQ--DFEVLRLLGKGTFGQVYQVKKKDTKRIYAMKVLSKKVIVKKNEIAHTIGERNIL 392

Query: 225 TTTRSE---WLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFC 281
            TT S+   ++V L ++FQ P  LYL  +++ GG+    L          A+FYI+E+  
Sbjct: 393 VTTSSKASPFIVGLKFSFQTPTDLYLVTDYMSGGELFWHLQREGRFTEDRAKFYIAELVL 452

Query: 282 AVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEF 341
           A+  LH     +RDLKPEN L+D+ G+I L DFGL+                        
Sbjct: 453 ALEHLHDNDIVYRDLKPENILLDANGNIALCDFGLSKA---------------------- 490

Query: 342 PEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALE-VLEAKNYDFTVDYWSLGCIL 400
                  + DR   +               G+ +Y+A E +L+   Y   VD+WSLG ++
Sbjct: 491 ------DLKDRTNTF--------------CGTTEYLAPELLLDESGYTKMVDFWSLGVLI 530

Query: 401 FESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITRLIADPINRL 460
           FE   G++PF      + Y+ +   K    R        +F      L+ R   +P +RL
Sbjct: 531 FEMCCGWSPFYAEDNQKMYQKIAFGKVKFPRDILSPEGRSFVKG---LLNR---NPKHRL 584

Query: 461 KSFEHVKRMR---YFSEIDFNTLRT--IHPPFIPQLDNEEDVGYFDDFTNEEHMARYVDV 515
            + +  + +R   +F++ID+  L+   I PPF P L +E D   FD     E        
Sbjct: 585 GAIDDGRELRAHPFFADIDWELLKQKKIPPPFKPHLVSETDTSNFD----PEFTQTSTSY 640

Query: 516 FKRQDRLTAMVDDSLSDSKLVGFTF 540
             +  ++ A        +K  GFTF
Sbjct: 641 MNKHHQMAATPLSPGMQAKFAGFTF 665

>Kwal_56.24059
          Length = 353

 Score =  129 bits (324), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 91/301 (30%), Positives = 144/301 (47%), Gaps = 59/301 (19%)

Query: 215 DHVLTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARF 274
           +H   ER +L      +L+++   FQD ++L++ M+++ GG+  +LL  ++    P A+F
Sbjct: 86  EHTNDERRMLKLVDHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKF 145

Query: 275 YISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQ 334
           Y +E+  A+  LH     +RDLKPEN L+D  GHIK+TDFG A                +
Sbjct: 146 YAAEVILALEYLHSHDIIYRDLKPENILLDRNGHIKITDFGFA----------------K 189

Query: 335 EVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYW 394
           EV  + +                           +  G+PDY+A EV+  K Y+ +VD+W
Sbjct: 190 EVDTVTW---------------------------TLCGTPDYIAPEVIATKPYNKSVDWW 222

Query: 395 SLGCILFESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITRLI- 453
           SLG ++FE L GYTPF   +  +TYE +   K V   P        F     +L+ +LI 
Sbjct: 223 SLGILIFEMLAGYTPFYDATPMKTYEKILQGK-VAYPP-------FFHPDVVDLLCKLIT 274

Query: 454 ADPINRLKSFEH----VKRMRYFSEIDFNTL--RTIHPPFIPQLD-NEEDVGYFDDFTNE 506
           +D   RL + +     VK   +FSE+ +  L  + I  P+ P +     D   FD +  E
Sbjct: 275 SDLTRRLGNLQSGPQDVKSHPWFSEVVWEKLLAKDIETPYEPPITAGVGDTSLFDQYPEE 334

Query: 507 E 507
           +
Sbjct: 335 Q 335

>Scas_703.5
          Length = 749

 Score =  134 bits (337), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 108/390 (27%), Positives = 165/390 (42%), Gaps = 65/390 (16%)

Query: 161 RKRRLKPKHKDFEMITXXXXXXXXXXXLARKKDTKEICAXXXXXXXXXXXXEGTDHVLTE 220
           +KR   P   DFE++              +KKDTK I A                H + E
Sbjct: 335 KKRHYGPN--DFEVLRLLGKGTFGQVYQVKKKDTKRIYAMKVLSKKVIVKKNEVAHTIGE 392

Query: 221 RDILTTTR---SEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYIS 277
           R+IL TT    S ++V L ++FQ P  LYL  +F+ GG+    L          A+FYI+
Sbjct: 393 RNILVTTATKASPFIVGLKFSFQTPTDLYLVTDFMSGGELFWHLQKEGRFTEERAKFYIA 452

Query: 278 EMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVK 337
           E+  A+  LH     +RDLKPEN L+D+ G+I L DFGL+                    
Sbjct: 453 ELVLALEYLHDNDIVYRDLKPENILLDANGNIALCDFGLS-------------------- 492

Query: 338 NLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALE-VLEAKNYDFTVDYWSL 396
                   +  + DR   +               G+ +Y+A E +L+   Y   VD+WSL
Sbjct: 493 --------KADLKDRTNTF--------------CGTTEYLAPELLLDEAGYTKMVDFWSL 530

Query: 397 GCILFESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITRLIA-D 455
           G ++FE   G++PF      + Y+ +   K  ++ P     R   S      +  L+  +
Sbjct: 531 GVLIFEMCCGWSPFFAEDNQKMYQKIAFGK--VKFP-----RDVLSPEGRSFVKGLLNRN 583

Query: 456 PINRLKSFEHVKRMR---YFSEIDFNTLR--TIHPPFIPQLDNEEDVGYFDDFTNEEHMA 510
           P +RL + +  + +R   +F++ID++ LR   I PPF P L +E D   FD     E   
Sbjct: 584 PKHRLGAIDDGRELRAHPFFADIDWDALREKKIPPPFKPHLVSETDTSNFD----PEFTQ 639

Query: 511 RYVDVFKRQDRLTAMVDDSLSDSKLVGFTF 540
                  +   + A        +K  GFTF
Sbjct: 640 TSTSYMNKHQPIAATPLSPAMQAKFAGFTF 669

>Kwal_56.22788
          Length = 515

 Score =  132 bits (331), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 71/198 (35%), Positives = 102/198 (51%), Gaps = 23/198 (11%)

Query: 215 DHVLTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARF 274
           +    ER IL+      +VKL Y+F D   LYL ++F+PGG+    L     L      F
Sbjct: 182 ERTFAERTILSQLEHPNIVKLFYSFHDHHKLYLILQFIPGGELFYHLKEQGTLDEDTVAF 241

Query: 275 YISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQ 334
           Y +E+ CA+  LH+ G  +RDLKPEN L+D +GH+ LTDFGL+  + S            
Sbjct: 242 YAAEISCALRFLHKRGVVYRDLKPENCLLDERGHLVLTDFGLSKVSAS------------ 289

Query: 335 EVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYW 394
                      + S D      N    E V   HS +G+P+Y A E+LE K Y    D++
Sbjct: 290 -----------DDSADGGDVNTNGHEGESVCTLHSIIGTPEYCAPEILEGKPYTQNCDWY 338

Query: 395 SLGCILFESLVGYTPFSG 412
           SLGC++F+ L+G  P++G
Sbjct: 339 SLGCLIFDMLIGKPPYTG 356

>Scas_690.13
          Length = 354

 Score =  127 bits (318), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 88/301 (29%), Positives = 141/301 (46%), Gaps = 59/301 (19%)

Query: 215 DHVLTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARF 274
           +H   ER +L      +L+++   FQD ++L++ M+++ GG+  +LL  ++    P A+F
Sbjct: 87  EHTNDERRMLKLVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKF 146

Query: 275 YISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQ 334
           Y +E+   +  LH     +RDLKPEN L+D  GHIK+TDFG A                +
Sbjct: 147 YAAEVTLGLEYLHSHNIIYRDLKPENILLDRNGHIKITDFGFA----------------K 190

Query: 335 EVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYW 394
           EV  + +                           +  G PDY+A EV+  K Y+ +VD+W
Sbjct: 191 EVDTVTW---------------------------TLCGPPDYIAPEVIATKPYNKSVDWW 223

Query: 395 SLGCILFESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITRLI- 453
           SLG ++FE L GYTPF   +  +TYE +   K V            F     +L+ +LI 
Sbjct: 224 SLGVLIFEMLAGYTPFYDTTPMKTYEKILQGKVVYPT--------FFHPDVVDLLGKLIT 275

Query: 454 ADPINRLKSFEH----VKRMRYFSEIDFNTL--RTIHPPFIPQLDNE-EDVGYFDDFTNE 506
           AD   R+ + +     +K   +FSE+ +  L  + I  P+ P +     D   FD +  E
Sbjct: 276 ADLTRRIGNLQSGSKDIKCHPWFSEVVWEKLLAKDIETPYEPPITTGIGDTSLFDQYPEE 335

Query: 507 E 507
           +
Sbjct: 336 Q 336

>KLLA0B03586g complement(326871..329075) similar to sp|P11792
           Saccharomyces cerevisiae YHR205w SCH9 serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway, start by similarity
          Length = 734

 Score =  131 bits (329), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 109/391 (27%), Positives = 170/391 (43%), Gaps = 68/391 (17%)

Query: 161 RKRRLKPKHKDFEMITXXXXXXXXXXXLARKKDTKEICAXXXXXXXXXXXXEGTDHVLTE 220
           +KR+  P+  DFE++              RKKDT  I A                H + E
Sbjct: 316 KKRQYGPQ--DFEVLRLLGKGTFGQVYQVRKKDTMRIYAMKVLSKKVIVKKNEIAHTIGE 373

Query: 221 RDILTTTRSE---WLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYIS 277
           R+IL  T S+   ++V L ++FQ P  LYL  +F+ GG+    L          A+FYI+
Sbjct: 374 RNILVRTASKSSPFIVGLKFSFQTPTDLYLVTDFMSGGELFWHLQKEGRFTEDRAKFYIA 433

Query: 278 EMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVK 337
           E+  A+  LH     +RDLKPEN L+D+ G+I L DFGL+                    
Sbjct: 434 ELVLALEYLHDNDIVYRDLKPENILLDANGNIALCDFGLS-------------------- 473

Query: 338 NLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVL-EAKNYDFTVDYWSL 396
                   +  + DR   +               G+ +Y+A E+L +   Y   VD+WSL
Sbjct: 474 --------KADLKDRTNTF--------------CGTTEYLAPELLMDETGYTKMVDFWSL 511

Query: 397 GCILFESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITRLIA-D 455
           G ++FE   G++PF  +   + Y+ +   K  ++ P     R   S      +  L+  +
Sbjct: 512 GVLIFEMCCGWSPFFASDNQKMYQKIAFGK--VKFP-----RDVLSPEGRSFVKGLLNRN 564

Query: 456 PINRLKSFEHVKRMR---YFSEIDFNTLRT--IHPPFIPQLDNEEDVGYFD-DFTNEEHM 509
           P +RL + +  + +R   +F++ID+  +R   I PPF P L +E D   FD +FT     
Sbjct: 565 PKHRLGAIDDGRELRAHPFFNDIDWEAVRQKKIPPPFKPHLISETDTSNFDPEFTQTS-- 622

Query: 510 ARYVDVFKRQDRLTAMVDDSLSDSKLVGFTF 540
                 F  +  + A        +K VGFTF
Sbjct: 623 ----TSFMNKQPIAATPLSPAMQAKFVGFTF 649

>KLLA0D03190g 267933..269051 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, start by similarity
          Length = 372

 Score =  127 bits (319), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 88/301 (29%), Positives = 142/301 (47%), Gaps = 59/301 (19%)

Query: 215 DHVLTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARF 274
           +H   ER +L      +L+++   FQD ++L++ M+++ GG+  +LL  ++    P A+F
Sbjct: 105 EHTNDERRMLKLVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKF 164

Query: 275 YISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQ 334
           Y +E+  A+  LH     +RDLKPEN L+D  GHIK+TDFG A                 
Sbjct: 165 YAAEVTLALEYLHSHNIIYRDLKPENILLDRNGHIKITDFGFA----------------- 207

Query: 335 EVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYW 394
                                     +E +    +  G+PDY+A EV+  K Y+ +VD+W
Sbjct: 208 --------------------------KEVITVTWTLCGTPDYIAPEVITTKPYNKSVDWW 241

Query: 395 SLGCILFESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITRLI- 453
           SLG ++FE L GYTPF   +  +TYE +     V+  P        F     +L+ +LI 
Sbjct: 242 SLGILIFEMLAGYTPFYDVTPMKTYEKILA-GEVVYPP-------FFHPDVVDLLGKLIT 293

Query: 454 ADPINRLKSFEH----VKRMRYFSEIDFNTL--RTIHPPFIPQLD-NEEDVGYFDDFTNE 506
           AD   RL + +     +K   +F+E+ +  L  + I  P+ P +     D   FD +  E
Sbjct: 294 ADLTRRLGNLQSGPDDIKSHPWFAEVIWEKLVAKDIETPYEPPIAVGVGDSSLFDQYPEE 353

Query: 507 E 507
           +
Sbjct: 354 Q 354

>KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces
           cerevisiae YKL126w YPK1 ser/thr-specific protein kinase,
           start by similarity
          Length = 716

 Score =  130 bits (327), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 96/354 (27%), Positives = 151/354 (42%), Gaps = 58/354 (16%)

Query: 171 DFEMITXXXXXXXXXXXLARKKDTKEICAXXXXXXXXXXXXEGTDHVLTERDILTTTRSE 230
           DF+++              RK+DT +I A                H L ER +L    + 
Sbjct: 381 DFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNP 440

Query: 231 WLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLG 290
           ++V L ++FQ  + LYL + F+ GG+    L          +RFY +E+ CA+ ALH   
Sbjct: 441 FIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFD 500

Query: 291 YTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMD 350
             +RDLKPEN L+D +GHI L DFGL                                  
Sbjct: 501 IIYRDLKPENILLDYQGHIALCDFGLC--------------------------------- 527

Query: 351 DRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPF 410
                  KL  ++     +  G+P+Y+A E+L  + Y   VD+W+LG +L+E L G  P+
Sbjct: 528 -------KLNMKDQEKTTTFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPY 580

Query: 411 SGNSTNETYENLRNWKHVLQRPKCDNGRYA--FSDRTWELITRLIA-DPINRL--KSFEH 465
                 + Y      K +LQ P     R+   F     +L+  L+  DP  RL     + 
Sbjct: 581 YDEDVPKMY------KKILQDPL----RFPDDFDKDAKDLLIGLLCRDPKRRLGYHGSDE 630

Query: 466 VKRMRYFSEIDFNTLRTIH--PPFIPQLDNEEDVGYFD-DFTNEEHMARYVDVF 516
           +K   +F+++ +  L+     PP+ P +    D   FD +FT E+ +   V+ F
Sbjct: 631 IKSHPFFNQLSWKRLKMKGYIPPYKPPVMGAMDTSNFDQEFTREQPVDSVVNDF 684

>ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH]
           complement(27643..29778) [2136 bp, 711 aa]
          Length = 711

 Score =  129 bits (324), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 110/390 (28%), Positives = 164/390 (42%), Gaps = 68/390 (17%)

Query: 162 KRRLKPKHKDFEMITXXXXXXXXXXXLARKKDTKEICAXXXXXXXXXXXXEGTDHVLTER 221
           KR   P+  DFE++              RKKDTK I A                H + ER
Sbjct: 296 KRHYGPQ--DFEVLRLLGKGTFGQVYQVRKKDTKRIYAMKVLSKKVIVKKNEIAHTIGER 353

Query: 222 DILTTTRSE---WLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISE 278
           +IL  T S+   ++V L ++FQ P  LYL  +F+ GG+    L          A+FYI+E
Sbjct: 354 NILVRTASKSCPFIVGLKFSFQTPTDLYLVTDFLSGGELFWHLQKEGRFTEERAKFYIAE 413

Query: 279 MFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKN 338
           +  A+  LH     +RDLKPEN L+D+ G+I L DFGL+                     
Sbjct: 414 LVLALEYLHDNDIVYRDLKPENILLDANGNIALCDFGLSKA------------------- 454

Query: 339 LEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALE-VLEAKNYDFTVDYWSLG 397
                     + DR   +               G+ +Y+A E +L+   Y   VD+WSLG
Sbjct: 455 ---------DLKDRTNTF--------------CGTTEYLAPELLLDETGYTKMVDFWSLG 491

Query: 398 CILFESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITRLIA-DP 456
            ++FE   G++PF      + Y+ +   K  ++ P     R   S      +  L+  +P
Sbjct: 492 VLIFEMCCGWSPFFAEDNQKMYQKIAFGK--VKFP-----RDVLSPEGRSFVKGLLNRNP 544

Query: 457 INRLKSFEHVKRMR---YFSEIDFNTLRT--IHPPFIPQLDNEEDVGYFD-DFTNEEHMA 510
            +RL +      +R   + S+ID+  LR   I PPF P L +E D   FD +FT      
Sbjct: 545 KHRLGAVNDGAEVRAHPFLSDIDWEALRNKQIPPPFKPHLTSETDTSNFDPEFT------ 598

Query: 511 RYVDVFKRQDRLTAMVDDSLSDSKLVGFTF 540
           +    F  +  + A        +K  GFTF
Sbjct: 599 QTSTSFMNKQPIAATPLSPAMQAKFAGFTF 628

>CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces
           cerevisiae YBR028c, start by similarity
          Length = 542

 Score =  126 bits (316), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 77/246 (31%), Positives = 119/246 (48%), Gaps = 33/246 (13%)

Query: 215 DHVLTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARF 274
           +    ER IL+      +VKL Y+F D   LYL ++++PGG+    L     L+     F
Sbjct: 215 ERTFAERTILSQLEHPNIVKLFYSFHDTSKLYLLLQYIPGGELFFHLKEHGTLEEDTVAF 274

Query: 275 YISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQ 334
           Y +E+ CA+  LH  G  +RDLKPEN L++  GH+ LTDFGL+  + S    E +    +
Sbjct: 275 YAAEISCALKFLHSKGVVYRDLKPENCLLNQNGHLVLTDFGLSKSSASNASQEDLGAGNE 334

Query: 335 EVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYW 394
                                      E+V   HS +G+P+Y A E+L  + Y    D++
Sbjct: 335 --------------------------GEDVNELHSIIGTPEYCAPEILLGQPYTANCDWY 368

Query: 395 SLGCILFESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITRLI- 453
           SLGC+L++ L G  P++G +       ++N K   Q PK     Y  SD   +++  L+ 
Sbjct: 369 SLGCLLYDMLTGKPPYTGANHKVIANKIKNDK---QGPKI---PYYLSDGMKDVLGALLK 422

Query: 454 ADPINR 459
           +DP  R
Sbjct: 423 SDPKKR 428

>Scas_593.14d
          Length = 495

 Score =  124 bits (312), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 66/198 (33%), Positives = 102/198 (51%), Gaps = 23/198 (11%)

Query: 215 DHVLTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARF 274
           +    E+ IL       +VKL Y+F D   LYL ++++PGG+    L     L      F
Sbjct: 193 ERTFAEKSILAELEHPNIVKLFYSFHDNSKLYLLLQYIPGGELFFHLKEQGTLDEDTVAF 252

Query: 275 YISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQ 334
           Y +E+ CA+  LH  G  +RDLKPEN L++ KGH+ LTDFGL+  +V+            
Sbjct: 253 YAAEISCALKFLHDKGIVYRDLKPENCLLNDKGHLVLTDFGLSKKSVTQNSANP-----S 307

Query: 335 EVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYW 394
           EV +L  P                   E++   HS +G+P+Y A E+L+   Y+   D++
Sbjct: 308 EVTSLNEP------------------SEDLSTLHSIIGTPEYCAPEILQGLPYNKNCDWY 349

Query: 395 SLGCILFESLVGYTPFSG 412
           SLGC++++ L G  P++G
Sbjct: 350 SLGCLIYDMLSGKPPYTG 367

>YBR028C (YBR028C) [220] chr2 complement(294387..295964)
           Serine/threonine protein kinase with similarity to
           Ypk2p/Ykr2p and Ypk1p [1578 bp, 525 aa]
          Length = 525

 Score =  121 bits (304), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 66/200 (33%), Positives = 102/200 (51%), Gaps = 30/200 (15%)

Query: 215 DHVLTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARF 274
           +    ER IL+      +VKL Y+F D   LYL ++++PGG+    L     L      F
Sbjct: 197 ERTFAERSILSEIEHPNIVKLFYSFHDNSKLYLLLQYIPGGELFYHLKEHGTLDETTVSF 256

Query: 275 YISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQ 334
           Y +E+ CA+  LH  G  +RDLKPEN L++ +GH+ LTDFGL+  + +   ++       
Sbjct: 257 YAAEISCALRFLHTKGVVYRDLKPENCLLNQRGHLVLTDFGLSKKSANDSAVDE------ 310

Query: 335 EVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYW 394
                E P                   E V   +S +G+P+Y A E+L  K Y    D++
Sbjct: 311 -----EDP-------------------ENVNALYSIIGTPEYCAPEILLGKAYSQNCDWY 346

Query: 395 SLGCILFESLVGYTPFSGNS 414
           SLGC+L++ LVG  P++G++
Sbjct: 347 SLGCLLYDMLVGKPPYTGSN 366

>KLLA0F24618g complement(2288943..2290613) similar to sp|P38070
           Saccharomyces cerevisiae YBR028c, start by similarity
          Length = 556

 Score =  121 bits (304), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 64/198 (32%), Positives = 101/198 (51%), Gaps = 30/198 (15%)

Query: 215 DHVLTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARF 274
           +    ER IL+      +VKL Y+F D   LYL ++++PGG+    L     L      F
Sbjct: 226 ERTFAERTILSQLEHPNIVKLFYSFHDNHKLYLVLQYIPGGELFYHLKEQGTLDEGTVAF 285

Query: 275 YISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQ 334
           Y +E+ CA+  LH  G  +RDLKPEN L++ +GH+ LTDFGL+  +V             
Sbjct: 286 YAAELSCALKFLHSKGIVYRDLKPENCLLNERGHLVLTDFGLSKKSV------------- 332

Query: 335 EVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYW 394
                    F + +  +     N+L        +S +G+P+Y A E+L  + Y    D++
Sbjct: 333 ---------FDDAATPEEGENVNQL--------YSIIGTPEYCAPEILAGEPYTQNCDWY 375

Query: 395 SLGCILFESLVGYTPFSG 412
           SLGC++++ L+G  PF+G
Sbjct: 376 SLGCLVYDMLIGKPPFTG 393

>Scas_715.34
          Length = 1150

 Score =  120 bits (301), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 87/335 (25%), Positives = 147/335 (43%), Gaps = 72/335 (21%)

Query: 188  LARKKDTKEICAXXXXXXXXXXXXEGTDHVLTERDIL---TTTRSEWLVKLLYAFQDPQS 244
            L+R K+T  +CA               +    E+ +    T T+  +L  L  +FQ    
Sbjct: 839  LSRSKNTGRLCAIKVLKKDNIIQNHDIESARAEKKVFLLATKTKHPFLTNLYCSFQTENR 898

Query: 245  LYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFLID 304
            +Y AMEF+ GGD    + N + L    A+FY +E+  A+   H  G  +RDLK EN L+ 
Sbjct: 899  IYFAMEFIGGGDLMWHVQNQR-LSVRRAKFYAAEVLLALKYFHDNGVIYRDLKLENILLT 957

Query: 305  SKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEV 364
             +GHIK+ D+GL                                            ++E+
Sbjct: 958  PQGHIKIADYGLC-------------------------------------------KDEM 974

Query: 365  RYAHST---VGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGNSTNETYEN 421
             Y + T    G+P++MA E+L+ + Y   VD+W+ G +L++ L+  +PFSG+  +E +  
Sbjct: 975  WYNNKTSTFCGTPEFMAPEILKEQGYTRAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNA 1034

Query: 422  LRNWKHVLQRPKCDNGRYAFSDRTWELIT----RLIADPINRLKSFE----HVKRMRYFS 473
            +            D   Y   D   +++      L  DP NRL + +     V    +F 
Sbjct: 1035 ILT----------DEPLYPI-DMAGDIVQIFQGLLTKDPENRLGAGQRDALEVMEEPFFR 1083

Query: 474  EIDFNTLRT--IHPPFIPQLDNEEDVGYFD-DFTN 505
             I+F  +    + PP++P++ + ED  YF+ +FT+
Sbjct: 1084 NINFEDILNLRVQPPYVPEIKSPEDTSYFEHEFTS 1118

>AEL083W [2423] [Homologous to ScYBR028C - SH]
           complement(470964..472574) [1611 bp, 536 aa]
          Length = 536

 Score =  118 bits (296), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 71/224 (31%), Positives = 105/224 (46%), Gaps = 41/224 (18%)

Query: 214 TDHVLTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHAR 273
            +    ER IL+      +VKL Y+F D   LYL ++++PGG+    L     L      
Sbjct: 208 VERTFAERTILSQLEHPNIVKLFYSFHDHHKLYLVLQYIPGGELFYHLKEQGTLDEVTVS 267

Query: 274 FYISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRL 333
           FY +E+ CA+  LH  G  +RDLKPEN L+D KGH+ LTDFGL+   V+           
Sbjct: 268 FYAAEISCALKFLHSKGIVYRDLKPENCLLDDKGHLVLTDFGLSKRGVNQAD-------- 319

Query: 334 QEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDY 393
                                  + L  E+V   +S +G+P+Y A E+L  + Y    D+
Sbjct: 320 -----------------------SPLGGEQVEELYSIIGTPEYCAPEILCGQPYTQNCDW 356

Query: 394 WSLGCILFESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNG 437
           +SLG + ++ L+G  PF+G           N K +L + K D G
Sbjct: 357 YSLGSLTYDMLIGKPPFTG----------ANHKVILSKIKQDKG 390

>YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase C,
            regulates MAP kinase cascade involved in regulating cell
            wall metabolism [3456 bp, 1151 aa]
          Length = 1151

 Score =  119 bits (299), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 87/335 (25%), Positives = 147/335 (43%), Gaps = 72/335 (21%)

Query: 188  LARKKDTKEICAXXXXXXXXXXXXEGTDHVLTERDIL---TTTRSEWLVKLLYAFQDPQS 244
            L++ K+T  +CA               +    E+ +    T T+  +L  L  +FQ    
Sbjct: 840  LSKSKNTDRLCAIKVLKKDNIIQNHDIESARAEKKVFLLATKTKHPFLTNLYCSFQTENR 899

Query: 245  LYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFLID 304
            +Y AMEF+ GGD    + N + L    A+FY +E+  A+   H  G  +RDLK EN L+ 
Sbjct: 900  IYFAMEFIGGGDLMWHVQNQR-LSVRRAKFYAAEVLLALKYFHDNGVIYRDLKLENILLT 958

Query: 305  SKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEV 364
             +GHIK+ D+GL                                            ++E+
Sbjct: 959  PEGHIKIADYGLC-------------------------------------------KDEM 975

Query: 365  RYAHST---VGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGNSTNETYEN 421
             Y + T    G+P++MA E+L+ + Y   VD+W+ G +L++ L+  +PFSG+  +E +  
Sbjct: 976  WYGNRTSTFCGTPEFMAPEILKEQEYTKAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNA 1035

Query: 422  LRNWKHVLQRPKCDNGRYAFSDRTWELIT----RLIADPINRL----KSFEHVKRMRYFS 473
            +            D   Y   D   E++      L  DP  RL    +  + V    +F 
Sbjct: 1036 ILT----------DEPLYPI-DMAGEIVQIFQGLLTKDPEKRLGAGPRDADEVMEEPFFR 1084

Query: 474  EIDFNTLRT--IHPPFIPQLDNEEDVGYFD-DFTN 505
             I+F+ +    + PP+IP++ + ED  YF+ +FT+
Sbjct: 1085 NINFDDILNLRVKPPYIPEIKSPEDTSYFEQEFTS 1119

>YOL100W (PKH2) [4721] chr15 (129236..132481) Serine/threonine
           protein kinase with similarity to mammalian
           3-phosphoinositide-dependent protein kinase,
           phosphorylates and activates Ypk2p, required for
           endocytosis [3246 bp, 1081 aa]
          Length = 1081

 Score =  118 bits (295), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 84/329 (25%), Positives = 145/329 (44%), Gaps = 38/329 (11%)

Query: 150 QGYLTKETNILRKRRLKPKHKDFEMITXXXXXXXXXXXLARKKDTKEICAXXXXXXXXXX 209
           Q  + KE++  +K  +K   KDF+  +           LA   DTK+  A          
Sbjct: 157 QKPIAKESSKAQKNIIKKGIKDFKFGSVIGDGAYSTVMLATSIDTKKRYAAKVLNKEYLI 216

Query: 210 XXEGTDHVLTERDILTT-TRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQ 268
             +   +V  E+  L     S  +V+L   FQD  SLY  +E+ P GDF +L+     L 
Sbjct: 217 RQKKVKYVSIEKTALQKLNNSPSVVRLFSTFQDESSLYFLLEYAPNGDFLSLMKKYGSLD 276

Query: 269 APHARFYISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIES 328
              AR+Y +++  A++ LH  G  HRD+KPEN L+D +  IKLTDFG A           
Sbjct: 277 ETCARYYAAQIIDAIDYLHSNGIIHRDIKPENILLDGEMKIKLTDFGTA----------- 325

Query: 329 MKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYD 388
            K+      ++  PE+    +  R + +              VG+ +Y++ E+L     D
Sbjct: 326 -KLLNPTNNSVSKPEY---DLSTRSKSF--------------VGTAEYVSPELLNDSFTD 367

Query: 389 FTVDYWSLGCILFESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWEL 448
           +  D W+ GCILF+ + G  PF   +   T++ +   ++             F     +L
Sbjct: 368 YRCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTP--------GFPLIIRDL 419

Query: 449 ITRLIADPINRLKSFEHVKRMRYFSEIDF 477
           + +++   ++R  +   +K   +F +++F
Sbjct: 420 VKKILVKNLDRRLTISQIKEHHFFKDLNF 448

>Kwal_56.22693
          Length = 984

 Score =  117 bits (294), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 91/345 (26%), Positives = 148/345 (42%), Gaps = 56/345 (16%)

Query: 141 GTEQITNEWQGYLTKETNILRKRRLKPKHKDFEMITXXXXXXXXXXXLARKKDTKEICAX 200
           G  +I  E    L  ET ++ +  +K   KDF               LAR  D+ +  A 
Sbjct: 130 GAAKIVKE---VLNPETGVMARHVIKKGIKDFRFGEVLGDGSYSTVMLARSNDSGKKYAV 186

Query: 201 XXXXXXXXXXXEGTDHVLTERDILTTTR-SEWLVKLLYAFQDPQSLYLAMEFVPGGDFRT 259
                      +   +V  E++ L        ++KL + FQD  SLY  +E+ P GDF +
Sbjct: 187 KVLNKEYLIRQKKVKYVNIEKNTLQRLNDGRGVIKLYFTFQDEASLYFLLEYAPNGDFLS 246

Query: 260 LLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASG 319
           ++     L    A +Y +++  A++ LH  G  HRD+KPEN L+D    +KLTDFG A  
Sbjct: 247 VIKKFGSLSQECAVYYSAQILDAIDYLHHKGIVHRDIKPENILLDKDMKVKLTDFGTA-- 304

Query: 320 TVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMAL 379
                       R+ E              D+  + +N L       + S VG+ +Y++ 
Sbjct: 305 ------------RILE-------------KDETTQTFNLLER-----SKSFVGTAEYVSP 334

Query: 380 EVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRY 439
           E+L     D+  D W+ GCILF+ + G  PF   +   T++            K    +Y
Sbjct: 335 ELLNDNYVDYKCDIWAFGCILFQMIAGKPPFKATNEYLTFQ------------KVMKVQY 382

Query: 440 AFSDRTWELITR------LIADPINRLKSFEHVKRMRYFSEIDFN 478
           AF+   + L+ R      L+  P  RL +   +K+  +F +++FN
Sbjct: 383 AFT-AGFPLVIRDLIKKILVKSPEQRLDA-SQIKKHHFFKDVNFN 425

>YDR490C (PKH1) [1306] chr4 complement(1431956..1434256)
           Serine/threonine protein kinase, functions similarly to
           mammalian 3-phosphoinositide-dependent protein kinase,
           phosphorylates and activates Ypk1p, required for
           endocytosis [2301 bp, 766 aa]
          Length = 766

 Score =  117 bits (292), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 90/325 (27%), Positives = 143/325 (44%), Gaps = 42/325 (12%)

Query: 157 TNILRKRRLKPKHKDFEMITXXXXXXXXXXXLARKKDTKEICAXXXXXXXXXXXXEGTDH 216
           T  L K  +K   KDF+              LA  +D+ +  A            +   +
Sbjct: 110 TGELTKHVVKMGIKDFKFGEQLGDGSYSSVVLATARDSGKKYAVKVLSKEYLIRQKKVKY 169

Query: 217 VLTERDILTTTR-SEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFY 275
           V  E+  L     ++ + KL + FQD  SLY  +E+ P GDF  L+     L    AR+Y
Sbjct: 170 VTVEKLALQKLNGTKGIFKLFFTFQDEASLYFLLEYAPHGDFLGLIKKYGSLNETCARYY 229

Query: 276 ISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQE 335
            S++  AV++LH +G  HRD+KPEN L+D    +KLTDFG A            KI    
Sbjct: 230 ASQIIDAVDSLHNIGIIHRDIKPENILLDKNMKVKLTDFGTA------------KI---- 273

Query: 336 VKNLEFPEFRERSMDDRR--RMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDY 393
                 PE    + D +    +Y K        + S VG+ +Y++ E+L     D   D 
Sbjct: 274 -----LPEEPSNTADGKPYFDLYAK--------SKSFVGTAEYVSPELLNDNYTDSRCDI 320

Query: 394 WSLGCILFESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITRLI 453
           W+ GCIL++ L G  PF   +   T++ +   ++             F     +L+ +L+
Sbjct: 321 WAFGCILYQMLAGKPPFKAANEYLTFQKVMKIQYAFTA--------GFPQIVKDLVKKLL 372

Query: 454 A-DPINRLKSFEHVKRMRYFSEIDF 477
             DP +RL + + +K   +F E++F
Sbjct: 373 VRDPNDRL-TIKQIKAHLFFHEVNF 396

>CAGL0M09361g complement(928484..931918) highly similar to sp|P24583
            Saccharomyces cerevisiae YBL105c PKC1 ser/thr protein
            kinase, start by similarity
          Length = 1144

 Score =  116 bits (290), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 87/328 (26%), Positives = 146/328 (44%), Gaps = 58/328 (17%)

Query: 188  LARKKDTKEICAXXXXXXXXXXXXEGTDHVLTERDIL---TTTRSEWLVKLLYAFQDPQS 244
            L+R K+T  +CA               +    E+ +    T T+  +L  L  +FQ    
Sbjct: 833  LSRSKNTNRLCAIKVLKKDNIIQNHDIESARAEKKVFLLATKTKHPFLTNLYCSFQTENR 892

Query: 245  LYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFLID 304
            +Y AMEF+ GGD    + N + L    A+FY +E+  A+   H  G  +RDLK EN L+ 
Sbjct: 893  IYFAMEFIGGGDLMWHVQNQR-LSVRRAKFYAAEVLLALKFFHDNGVIYRDLKLENILLT 951

Query: 305  SKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEV 364
             +GHIK+ D+GL                                            ++ +
Sbjct: 952  PEGHIKIADYGLC-------------------------------------------KDGM 968

Query: 365  RYAHST---VGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGNSTNETYEN 421
             Y + T    G+P++MA E+L  ++Y   VD+W+ G +L++ L+  +PFSG+  +E +  
Sbjct: 969  WYGNKTSTFCGTPEFMAPELLREQDYTKAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNA 1028

Query: 422  LRNWKHVLQRPKCDNGRYAFSD-RTWELITRLIADPINRLKSFEHVKRMRYFSEIDFNTL 480
            +   + +       +    F    T +   RL A P + L+  E      +F  I+F+ L
Sbjct: 1029 ILTDEPLYPIDMAGDIVQIFQGLLTKDPEKRLGAGPRDALEIMEEP----FFRNINFDDL 1084

Query: 481  RT--IHPPFIPQLDNEEDVGYFD-DFTN 505
                I PP+IP++ + ED  YF+ +FT+
Sbjct: 1085 LNLRIKPPYIPEIKSAEDTSYFEQEFTS 1112

>AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)
           [2181 bp, 726 aa]
          Length = 726

 Score =  115 bits (287), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 76/249 (30%), Positives = 123/249 (49%), Gaps = 46/249 (18%)

Query: 232 LVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGY 291
           ++KL Y F D ++LY  M+  PGG+   LL   +      AR Y+ ++   V  +H +G 
Sbjct: 73  IIKLYYTFHDQENLYFVMDLAPGGELLQLLRRQRVFSEAWARHYMCQLVDTVEYIHSMGV 132

Query: 292 THRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDD 351
            HRDLKPEN L+D +G + + DFG A+ TV      S                       
Sbjct: 133 IHRDLKPENVLLDKEGRLMIADFG-AAYTVGQSDAGS----------------------- 168

Query: 352 RRRMYNKLREEEVRYAHSTVGSPDYMALE-VLEAKNYDFTVDYWSLGCILFESLVGYTPF 410
                     +  + A S VG+ +Y++ E +LE K+Y ++ D W+LGC+L++ L G  PF
Sbjct: 169 ----------DGDKPATSFVGTAEYVSPELLLENKSY-YSSDVWALGCMLYQFLQGTPPF 217

Query: 411 SGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITR-LIADPINRLKSFEHVKRM 469
            G +  ET+E + N  +  + P   N   A       L+++ L+ DP  R  + E +K+ 
Sbjct: 218 RGQNEMETFEQIVNLDYTWRIPA--NPLAA------GLVSKILVLDPSQRY-TLEQIKKH 268

Query: 470 RYFSEIDFN 478
           ++FS +D+N
Sbjct: 269 KWFSGVDWN 277

>KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732.1
            Kluyveromyces lactis protein kinase C, start by
            similarity
          Length = 1161

 Score =  115 bits (288), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 86/335 (25%), Positives = 144/335 (42%), Gaps = 72/335 (21%)

Query: 188  LARKKDTKEICAXXXXXXXXXXXXEGTDHVLTERDIL---TTTRSEWLVKLLYAFQDPQS 244
            LAR K+T  +CA               +    E+ +    T T+  +L  L  +FQ    
Sbjct: 850  LARSKNTSNLCAIKVLKKDNIIKNHDIESARAEKKVFLLATETKHPFLTNLYCSFQTENR 909

Query: 245  LYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFLID 304
            +Y AMEF+ GGD    + N + L    A+FY +E+  ++   H  G  +RDLK EN L+ 
Sbjct: 910  IYFAMEFIGGGDLMWHVQNRR-LSVRRAKFYAAEVLLSLKYFHDNGVIYRDLKLENILLT 968

Query: 305  SKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEV 364
             +GHIK+ D+GL                                            ++ +
Sbjct: 969  PEGHIKIADYGLC-------------------------------------------KDNM 985

Query: 365  RYAHST---VGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGNSTNETYEN 421
             Y + T    G+P++MA E+L+ + Y   VD+W+ G +L++ L+  +PFSG   +E +  
Sbjct: 986  WYGNKTSTFCGTPEFMAPEILKGQAYTKAVDWWTFGVLLYQMLLCQSPFSGEDEDEVFNA 1045

Query: 422  LRNWKHVLQRPKCDNGRYAFSDRTWELIT----RLIADPINRL----KSFEHVKRMRYFS 473
            +            D   Y   D   +++      L  DP  RL    K    +    +FS
Sbjct: 1046 ILT----------DEPLYPI-DMAGDIVQIFQGLLTKDPEKRLGAGPKDALEIMAEPFFS 1094

Query: 474  EIDFNTLRT--IHPPFIPQLDNEEDVGYFD-DFTN 505
             I+F+ +    + PPF+P++   +D  YF+ +FT+
Sbjct: 1095 NINFDDILNLRVEPPFVPEIKAADDTSYFEKEFTS 1129

>YMR001C (CDC5) [3966] chr13 complement(269019..271136)
           Serine/threonine protein kinase required for exit from
           mitosis and for inactivation of the Rad53p checkpoint
           kinase during adaptation to unrepaired DNA damage,
           member of the polo family of protein kinases [2118 bp,
           705 aa]
          Length = 705

 Score =  112 bits (280), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 90/348 (25%), Positives = 140/348 (40%), Gaps = 61/348 (17%)

Query: 191 KKDTKEICAXXXXXXXXXXXXEGTDHVLTERDILTTTRSEWLVKLLYAFQDPQSLYLAME 250
           K D+ EI A            +    +L+E  I  +     +V+ +  F+D  ++Y+ +E
Sbjct: 100 KDDSGEIFAAKTVAKASIKSEKTRKKLLSEIQIHKSMSHPNIVQFIDCFEDDSNVYILLE 159

Query: 251 FVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIK 310
             P G    LL   K L  P  RF+ +++  A+  +H     HRDLK  N   DS  ++K
Sbjct: 160 ICPNGSLMELLKRRKVLTEPEVRFFTTQICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLK 219

Query: 311 LTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHST 370
           + DFGLA+   +                                      E E +Y  + 
Sbjct: 220 IGDFGLAAVLAN--------------------------------------ESERKY--TI 239

Query: 371 VGSPDYMALEVLEAKN--YDFTVDYWSLGCILFESLVGYTPFSGNSTNETYENL--RNWK 426
            G+P+Y+A EVL  K+  + F VD WSLG +L+  L+G  PF     N  YE +  R++ 
Sbjct: 240 CGTPNYIAPEVLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFS 299

Query: 427 HVLQRPKCDNGRYAFSDRTWELITRLIADPINRLKSFEHVKRMRYFSEIDFNTLRTIHPP 486
               +P  D G+    D        L  DPI R  S   +        +D+   R   PP
Sbjct: 300 FPRDKPISDEGKILIRD-------ILSLDPIER-PSLTEI--------MDYVWFRGTFPP 343

Query: 487 FIPQLDNEEDVGYFDDFTNEEHMARYVDVFKRQDRLTAMVDDSLSDSK 534
            IP     E    F+D   E+ +  + D  ++   L +M  D +   K
Sbjct: 344 SIPSTVMSE-APNFEDIPEEQSLVNFKDCMEKSLLLESMSSDKIQRQK 390

>Kwal_27.10581
          Length = 1154

 Score =  112 bits (281), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 90/367 (24%), Positives = 151/367 (41%), Gaps = 77/367 (20%)

Query: 161  RKRRLKPKHK-----DFEMITXXXXXXXXXXXLARKKDTKEICAXXXXXXXXXXXXEGTD 215
            R +R  PK +     DF ++            LA  K+ + +CA               +
Sbjct: 811  RHKRRTPKRRKISLDDFVLLKVLGKGNFGKVLLAESKNNERLCAIKVLKKDHIIKNHDIE 870

Query: 216  HVLTERDIL---TTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHA 272
                E+ +    T  +  +L  L  +FQ    +Y AMEF+ GGD    + N + L    A
Sbjct: 871  SARAEKKVFLLATKAKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQR-LSVRRA 929

Query: 273  RFYISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIR 332
            +FY +E+  A+   H  G  +RDLK EN L+  +GHIK+ D+GL                
Sbjct: 930  KFYAAEVLLALKYFHDNGVIYRDLKLENILLTPEGHIKIADYGLC--------------- 974

Query: 333  LQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHST---VGSPDYMALEVLEAKNYDF 389
                                        ++E+ Y + T    G+P++MA E+L+ + Y  
Sbjct: 975  ----------------------------KDEMWYGNKTSTFCGTPEFMAPEILKEQEYTK 1006

Query: 390  TVDYWSLGCILFESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELI 449
             VD+W+ G +L++ L+  +PFSG   +E +  +            D   Y   D   +++
Sbjct: 1007 AVDWWAFGVLLYQMLLCQSPFSGEDEDEVFNAILT----------DEPLYPI-DMAGDIV 1055

Query: 450  T----RLIADPINRL----KSFEHVKRMRYFSEIDFNTLRT--IHPPFIPQLDNEEDVGY 499
                  L  DP  RL    +    V    +F  I F+ +    + PP+IP++   +D  Y
Sbjct: 1056 QIFQGLLTKDPERRLGAGPRDAAEVMAEPFFRNIVFDDILNLRVQPPYIPEIKAADDTSY 1115

Query: 500  FD-DFTN 505
            F+ +FT+
Sbjct: 1116 FEKEFTS 1122

>ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..683847)
            [3450 bp, 1149 aa]
          Length = 1149

 Score =  112 bits (280), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 91/366 (24%), Positives = 151/366 (41%), Gaps = 77/366 (21%)

Query: 161  RKRRLKPKHK-----DFEMITXXXXXXXXXXXLARKKDTKEICAXXXXXXXXXXXXEGTD 215
            R +R  PK +     DF ++            LAR K+T  +CA               +
Sbjct: 806  RHKRKTPKRRKVSLDDFILLKVLGKGNFGKVLLARSKNTDRLCAIKVLKKDHIIQNHDIE 865

Query: 216  HVLTERDIL---TTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHA 272
                E+ +    T  +  +L  L  +FQ    +Y AMEF+ GGD    + N + L    A
Sbjct: 866  SARAEKKVFLLATKAKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQR-LSVRRA 924

Query: 273  RFYISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIR 332
            +FY +E+  A+   H  G  +RDLK EN L+  +GHIK+ D+GL                
Sbjct: 925  KFYAAEVLLALKYFHDNGIIYRDLKLENILLTLEGHIKIADYGLC--------------- 969

Query: 333  LQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHST---VGSPDYMALEVLEAKNYDF 389
                                        ++E+ + + T    G+P++MA E+L  + Y  
Sbjct: 970  ----------------------------KDEMWFGNRTSTFCGTPEFMAPEILREQAYTK 1001

Query: 390  TVDYWSLGCILFESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELI 449
             VD+W+ G +L++ L+  +PFSG+  +E +  +            D   Y   D   +++
Sbjct: 1002 AVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAILT----------DEPLYPI-DMAGDIV 1050

Query: 450  T----RLIADPINRLKSFE----HVKRMRYFSEIDFNTLRT--IHPPFIPQLDNEEDVGY 499
                  L  DP  RL +       V    +F  I+F+ +    + PP+IP +   +D  Y
Sbjct: 1051 QIFQGLLTKDPEKRLGAGSRDALEVMEEPFFRNINFDDILNLRVEPPYIPTIKAADDTSY 1110

Query: 500  FD-DFT 504
            F+ +FT
Sbjct: 1111 FEKEFT 1116

>YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine
           protein kinase of unknown function [2697 bp, 898 aa]
          Length = 898

 Score =  111 bits (278), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 70/262 (26%), Positives = 121/262 (46%), Gaps = 32/262 (12%)

Query: 222 DILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFC 281
           ++L       ++KL Y F D ++LY  ++F PGG+  +LL           R + +++  
Sbjct: 65  NLLAQKHHAGIIKLYYTFHDEENLYFVLDFAPGGELLSLLHKMGTFNDIWTRHFTAQLID 124

Query: 282 AVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEF 341
           A+  +H  G  HRDLKPEN L+D  G + +TDFG A+        +S K          F
Sbjct: 125 ALEFIHSHGIIHRDLKPENVLLDRDGRLMITDFGAAATIDPSLSGDSAK----------F 174

Query: 342 PEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILF 401
                 S D++                S VG+ +Y++ E+L      +  D W+LGC+++
Sbjct: 175 NSDSNGSKDNQN-------------CASFVGTAEYVSPELLLYNQCGYGSDIWALGCMIY 221

Query: 402 ESLVGYTPFSGNSTNETYENLRNWKHVLQRP-----KCDNGRYAFSDRTWELITRLIADP 456
           + + G  PF G +  +T+E +      L  P     + +N     +     L+ +++   
Sbjct: 222 QFVQGQPPFRGENELKTFEKIV----ALDYPWGPNNRINNSTSPINPLVINLVQKILVIE 277

Query: 457 INRLKSFEHVKRMRYFSEIDFN 478
           +N   S E +KR  YFS++D+N
Sbjct: 278 VNERISLEQIKRHPYFSKVDWN 299

>KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, start by
           similarity
          Length = 925

 Score =  107 bits (267), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 66/255 (25%), Positives = 116/255 (45%), Gaps = 51/255 (20%)

Query: 229 SEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQ 288
           ++ ++ L + FQD  SLY  +E+ P GD  +L+     +     ++Y +++  A+  +H 
Sbjct: 213 TKGIISLYFTFQDESSLYFLLEYAPNGDLLSLMRKHGSVNEKCTQYYAAQIIDALGFMHD 272

Query: 289 LGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERS 348
            G  HRDLKPEN L+D    +KLTDFG A                               
Sbjct: 273 KGVIHRDLKPENILLDVDMKVKLTDFGTA------------------------------- 301

Query: 349 MDDRRRMYNKLREEEVRY-----AHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFES 403
                R+ +   E++++Y     ++S VG+ +Y++ E+L     DF  D W+ GCILF+ 
Sbjct: 302 -----RLLDSTSEDDLKYDLLTRSNSFVGTAEYVSPELLNDNYVDFRCDIWAFGCILFQM 356

Query: 404 LVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITR-LIADPINRLKS 462
           + G  PF  N+   T++ +   +              F     +L+   LI +P  RL  
Sbjct: 357 IAGKPPFKANNEYLTFQKVMKVQFAFT--------AGFPMTVRDLVKNILIKNPERRL-L 407

Query: 463 FEHVKRMRYFSEIDF 477
              +K  ++F++++F
Sbjct: 408 INQIKAHQFFADVNF 422

>YFL033C (RIM15) [1651] chr6 complement(69113..74425)
           Serine/threonine protein kinase, positive regulator of
           IME2 expression and of sporulation [5313 bp, 1770 aa]
          Length = 1770

 Score =  105 bits (263), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 66/195 (33%), Positives = 96/195 (49%), Gaps = 13/195 (6%)

Query: 133 EQRRSNLMGTEQITNEWQGYLTKETNILRKRRLK---------PKHKDFEMITXXXXXXX 183
           EQ  SN+  T+ I N     LT     L    L          P  KD++++        
Sbjct: 749 EQHPSNIARTDSINN---AMLTSPNMPLSPLLLATNQTVKSPTPSIKDYDILKPISKGAY 805

Query: 184 XXXXLARKKDTKEICAXXXXXXXXXXXXEGTDHVLTERDILTTTRSE-WLVKLLYAFQDP 242
               LARKK T +  A                +V +ER I+     + ++ +L  +FQ+ 
Sbjct: 806 GSVYLARKKLTGDYFAIKVLRKSDMIAKNQVTNVKSERAIMMVQSDKPYVARLFASFQNK 865

Query: 243 QSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFL 302
            +L+L ME++PGGD  TL+    +L    A+ Y++E+   VN +HQ G  H DLKPEN L
Sbjct: 866 DNLFLVMEYLPGGDLATLIKMMGYLPDQWAKQYLTEIVVGVNDMHQNGIIHHDLKPENLL 925

Query: 303 IDSKGHIKLTDFGLA 317
           ID+ GH+KLTDFGL+
Sbjct: 926 IDNAGHVKLTDFGLS 940

 Score = 83.6 bits (205), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 72/137 (52%), Gaps = 9/137 (6%)

Query: 372  GSPDYMALEVLEAKNYDF-TVDYWSLGCILFESLVGYTPFSGNSTNETYENLRNWKHVLQ 430
            G+PDY+A E +E K  D    D+WS+GCI FE L+GY PF   + +  ++ +     V+Q
Sbjct: 1149 GTPDYLAPETIEGKGEDNKQCDWWSVGCIFFELLLGYPPFHAETPDAVFKKI--LSGVIQ 1206

Query: 431  RPKCDNGRYA---FSDRTWELITR-LIADPINRL--KSFEHVKRMRYFSEIDFNTLRTIH 484
             P+  N        +    +LI + L+ DP  RL  K  + +K   YF  +D++ +    
Sbjct: 1207 WPEFKNEEEEREFLTPEAKDLIEKLLVVDPAKRLGAKGIQEIKDHPYFKNVDWDHVYDEE 1266

Query: 485  PPFIPQLDNEEDVGYFD 501
              F+P +DN ED  YFD
Sbjct: 1267 ASFVPTIDNPEDTDYFD 1283

>Scas_660.20
          Length = 957

 Score =  105 bits (261), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 72/299 (24%), Positives = 133/299 (44%), Gaps = 43/299 (14%)

Query: 191 KKDTKEICAXXXXXXXXXXXXEGTDHVLTERD---ILTTTRSEWLVKLLYAFQDPQSLYL 247
           K++TK I A                +V  E++   +L       +VKL Y F D ++LY 
Sbjct: 31  KRNTKRIFAIKVCSKAHIIKESKVKYVTIEKNTLNLLAKAHHPGIVKLYYTFHDEENLYY 90

Query: 248 AMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFLIDSKG 307
            ++++PGG+  +LL   K      ++ +  ++   +  +H  G  HRDLKPEN L+D  G
Sbjct: 91  VLDYLPGGELLSLLHKMKTFSEVWSKHFTVQLVDTLEFIHSQGVIHRDLKPENVLLDRDG 150

Query: 308 HIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYA 367
            + +TDFG A  T +                                       +  + +
Sbjct: 151 KLMITDFGAAYTTTAGN------------------------------------NDANKSS 174

Query: 368 HSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGNSTNETYENLRNWKH 427
            S VG+ +Y++ E+L      F+ D W+LGC++F+ + G  PF G +  +T+E +    +
Sbjct: 175 SSFVGTAEYVSPELLLHNQCSFSSDVWALGCMIFQFVTGSPPFRGENELKTFEKIVALDY 234

Query: 428 VLQRPKCDNGRYA--FSDRTWELITR-LIADPINRLKSFEHVKRMRYFSEIDFNTLRTI 483
                   N ++    +     L+ + L+ +P +RL S + +K+  +F+ +++N   TI
Sbjct: 235 PWSSTNIHNNKFLNNINPLIINLVRKILVLEPKDRL-SLKKIKQDPWFATVNWNDRNTI 292

>CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces
           cerevisiae YOL100w PKH2, start by similarity
          Length = 1076

 Score =  104 bits (259), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 87/341 (25%), Positives = 143/341 (41%), Gaps = 47/341 (13%)

Query: 141 GTEQITNEWQGYLT--KETNILRKRRLKPKHKDFEMITXXXXXXXXXXXLARKKDTKEIC 198
           G  QI  E     T  +E  I+RK       KDF+              LA  KD+ +  
Sbjct: 154 GAAQIVKESVNPKTGEREKKIIRK-----GIKDFKFGEMVGDGAYSTVMLATAKDSGKKY 208

Query: 199 AXXXXXXXXXXXXEGTDHVLTERDILT-TTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDF 257
           A            +   +V  E++ L     S  +VKL + FQD  SLY  +E+ P GDF
Sbjct: 209 AVKVLNKEYLIKQKKVKYVNIEKNALQRLNNSRGIVKLFFTFQDESSLYFLLEYAPNGDF 268

Query: 258 RTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLA 317
            +++     L     R+Y +++   +  LH  G  HRD+KPEN L+D    +K+TDFG A
Sbjct: 269 LSVMKKYGSLSEDCTRYYSAQIIDGIKYLHSKGIIHRDIKPENILLDKDMKVKITDFGTA 328

Query: 318 SGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYM 377
                         ++ E KN           D+    +N L       + S VG+ +Y+
Sbjct: 329 --------------KILEPKN----------EDEDNPEFNLLTR-----SKSFVGTAEYV 359

Query: 378 ALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNG 437
           + E+L     D   D W+ GC++F+ + G  PF   +   T++ +   ++          
Sbjct: 360 SPELLNDSYVDARCDIWAFGCMVFQMIAGKPPFKATNEYLTFQKVMKVQYAFT------- 412

Query: 438 RYAFSDRTWELITR-LIADPINRLKSFEHVKRMRYFSEIDF 477
              F     +L+ R L+  P  RL +   +++  ++ +I F
Sbjct: 413 -AGFPVVVRDLVKRILLKVPEQRL-TIPQIEKHHFYKDISF 451

>AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C
           (PKH1) - SH] (1046762..1049863) [3102 bp, 1033 aa]
          Length = 1033

 Score =  103 bits (257), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 74/260 (28%), Positives = 126/260 (48%), Gaps = 52/260 (20%)

Query: 224 LTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAV 283
           L ++R   ++KL + FQD  +LY  +E+ P GDF +++     L     ++Y +++  A+
Sbjct: 255 LNSSRVPGVIKLYFTFQDEANLYFLLEYAPNGDFLSVMKRFGTLSEECTKYYGAQILDAI 314

Query: 284 NALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPE 343
           + LH+ G  HRD+KPEN L+D    IKLTDFG A            K+  +E +N  +  
Sbjct: 315 HHLHKQGIIHRDVKPENILLDKTMKIKLTDFGTA------------KLIGREDENKPY-- 360

Query: 344 FRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFES 403
                ++ R + +              VG+ +Y++ E+L     D   D W+ GCILF+ 
Sbjct: 361 ----DLNTRSKSF--------------VGTAEYVSPELLNDNYVDSRCDIWAFGCILFQM 402

Query: 404 LVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITR------LIADPI 457
           + G  PF   +TNE Y   +    V         +YAF+   + +I R      L+  P 
Sbjct: 403 VAGKPPF--KATNE-YLTFQKVMRV---------QYAFTA-GFPMILRDLIKQLLVKKPE 449

Query: 458 NRLKSFEHVKRMRYFSEIDF 477
            RL   + +++  +F++I+F
Sbjct: 450 QRLTILQ-IEKHHFFNDINF 468

>CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces
           cerevisiae YFL033c RIM15 protein kinase involved in
           expression of meiotic genes, hypothetical start
          Length = 1682

 Score =  101 bits (252), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 62/165 (37%), Positives = 83/165 (50%), Gaps = 2/165 (1%)

Query: 163 RRLKPKHKDFEMITXXXXXXXXXXXLARKKDTKEICAXXXXXXXXXXXXEGTDHVLTERD 222
           + L P  KD+++I            LARKK T +  A                +V +ER 
Sbjct: 773 KPLTPSIKDYDIIKPISKGAYGSVYLARKKLTGDYFAIKVLRKSDMIAKNQVTNVKSERA 832

Query: 223 ILTTTRSEWLVKLLYA-FQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFC 281
           I+     +  V  LYA FQ+  +L+L ME++PGGD  TLL     L     + Y+SE+  
Sbjct: 833 IMMVQSDKPYVARLYATFQNKDNLFLVMEYLPGGDLATLLKMMGCLPDEWVKQYLSEIII 892

Query: 282 AVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLA-SGTVSMER 325
            V  +H  G  H DLKPEN LID  GH+KLTDFGL+ +G V   R
Sbjct: 893 GVEDMHNNGIIHHDLKPENLLIDVSGHLKLTDFGLSRAGLVKRHR 937

 Score = 78.2 bits (191), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 71/136 (52%), Gaps = 8/136 (5%)

Query: 372  GSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGNSTNETYENLRNWKHVLQR 431
            G+PDY+A E +E    D   D+WS+GCILFE + GY PF   + ++ + N+   K  +  
Sbjct: 1105 GTPDYLAPETIEGTGEDNQCDWWSVGCILFEMVFGYPPFHAETPDQVFRNILEGK--IDW 1162

Query: 432  PKCDN---GRYAFSDRTWELITR-LIADPINRL--KSFEHVKRMRYFSEIDFNTLRTIHP 485
            P  D+    R   S    +LI + LI DP  RL     E +K   YF ++ ++ +     
Sbjct: 1163 PIFDSIEEEREYISPEAKDLIMKFLITDPHKRLGYNGTEEIKNHPYFKDVKWDHVYDETA 1222

Query: 486  PFIPQLDNEEDVGYFD 501
             ++P +++ ED  YFD
Sbjct: 1223 SYVPNIEDPEDTDYFD 1238

>KLLA0E03487g complement(323764..325707) similar to sgd|S0002874
           Saccharomyces cerevisiae YDR466w, start by similarity
          Length = 647

 Score =  100 bits (250), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 62/247 (25%), Positives = 110/247 (44%), Gaps = 48/247 (19%)

Query: 232 LVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGY 291
           ++KL Y F D ++LY  ++F PGG+   LL           + ++ ++  A+  +H    
Sbjct: 73  IIKLYYTFHDSENLYFVLDFAPGGELLQLLQTQGRFNEAWTKHFMCQLIDALEYIHGCKV 132

Query: 292 THRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDD 351
            HRDLKPEN L+ S+G + +TDFG+AS   + + + S                       
Sbjct: 133 VHRDLKPENLLLSSEGKLMITDFGVASNLAATDNLSS----------------------- 169

Query: 352 RRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFS 411
                            S VG+ +Y++ E+L     +F  D W++GC+L++   G  PF 
Sbjct: 170 ---------------TSSFVGTAEYVSPELLLQNKSNFCSDIWAVGCMLYQFTQGTPPFR 214

Query: 412 GNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITR-LIADPINRLKSFEHVKRMR 470
           G +    +E + N  +        +  Y  S    +L+++ L+ DP +R  +   +K   
Sbjct: 215 GENELAAFEKIVNLDY--------HWIYMVSQHITDLVSKILVLDPDSRY-TLPQIKNHA 265

Query: 471 YFSEIDF 477
           +F  ID+
Sbjct: 266 WFQGIDW 272

>CAGL0G04609g complement(437162..440059) similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, hypothetical
           start
          Length = 965

 Score = 99.8 bits (247), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 71/277 (25%), Positives = 122/277 (44%), Gaps = 42/277 (15%)

Query: 216 HVLTERDILTTTRS-EWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARF 274
           +V  E+  L   +S   ++ L + FQD  +LY  +E+ P GDF +L+     L      +
Sbjct: 163 YVNIEKTALQNLKSVTGVINLSFTFQDEANLYFLLEYAPNGDFLSLIKKFGTLNEECTIY 222

Query: 275 YISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQ 334
           Y +++  A+ ++H  G  HRD+KPEN L+D    IKLTDFG A                 
Sbjct: 223 YSAQIIDAIGSMHSHGIIHRDIKPENILLDGNMKIKLTDFGTAK---------------- 266

Query: 335 EVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYW 394
                     +++S  + +  YN L       + S VG+ +Y++ E+L     D+  D W
Sbjct: 267 --------LLQKKSDKNGKPHYNLLTR-----SSSFVGTAEYVSPELLSDNYTDYKCDIW 313

Query: 395 SLGCILFESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITR-LI 453
           + GC++++ + G  PF   +   T++ +   +              F     +L+   L+
Sbjct: 314 AFGCLVYQMIAGKPPFKATNEYLTFQKVMKVQFAFTA--------GFPTIIRDLVKNILV 365

Query: 454 ADPINRLKSFEHVKRMRYFSEIDF--NTLRTIHPPFI 488
             P  RL +   +K    F  I+F  N++    PP I
Sbjct: 366 KQPEKRL-TIPQIKEHCLFENINFSDNSVWNRDPPKI 401

>KLLA0F09020g 836287..839073 weakly similar to sp|P43565
           Saccharomyces cerevisiae YFL033c RIM15 protein kinase
           involved in expression of meiotic genes, start by
           similarity
          Length = 928

 Score = 97.8 bits (242), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 56/156 (35%), Positives = 82/156 (52%), Gaps = 1/156 (0%)

Query: 163 RRLKPKHKDFEMITXXXXXXXXXXXLARKKDTKEICAXXXXXXXXXXXXEGTDHVLTERD 222
           + + P  +D+++I            LA+K+ T E  A                +V +ER 
Sbjct: 693 KSIIPSIRDYDVIKPISKGAYGSVYLAKKRVTGEYFAIKVLKKSDMIAKNQVTNVKSERA 752

Query: 223 ILTTTRSEWLVKLLYA-FQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFC 281
           I+     +  V  LYA FQ+ ++L+L M+++ GGD  TL+     L    A+ YI E+  
Sbjct: 753 IMMVQSDKPYVARLYATFQNKENLFLVMQYLSGGDMATLIKMMGNLPEKWAKQYICEVIS 812

Query: 282 AVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLA 317
            V+ +HQ G  H DLKP+N LIDS GHIKLTDFGL+
Sbjct: 813 GVDDMHQNGIIHHDLKPDNLLIDSLGHIKLTDFGLS 848

>CAGL0K06479g 636296..639271 some similarities with tr|Q03306
           Saccharomyces cerevisiae YDR466w, start by similarity
          Length = 991

 Score = 97.1 bits (240), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 61/246 (24%), Positives = 117/246 (47%), Gaps = 17/246 (6%)

Query: 232 LVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGY 291
           +VKL Y F D ++LY  +++  GG+  +LL          A+ + +++   +  +H  G 
Sbjct: 75  IVKLYYTFHDEENLYFVLDYASGGELLSLLHKMGTFTDSWAKHFAAQLVDTLEFMHARGV 134

Query: 292 THRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDD 351
            HRDLKPEN L+  +G + +TDFG A+   +     S K   +   N   P+    S  D
Sbjct: 135 IHRDLKPENVLLSKEGILMITDFGAAATQNNF----SDKDNTRSNANEGIPKDDVPSSGD 190

Query: 352 RRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFS 411
           +                S VG+ +Y++ E+L      F  D W+LGC++++ + G+ PF 
Sbjct: 191 KTE------------CSSFVGTAEYVSPELLLYNKCSFGSDIWALGCMVYQFIQGFPPFR 238

Query: 412 GNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITRLIADPINRLKSFEHVKRMRY 471
           G +  +T+E + +  +    P+        + +   L+ R++     +  + + +KR  +
Sbjct: 239 GENELKTFEKIVSLDYSWN-PERQTNFGTINIQVVNLVRRMLTIDTTQRATIDQIKRDPW 297

Query: 472 FSEIDF 477
           F+ +D+
Sbjct: 298 FANVDW 303

>Scas_707.3
          Length = 1598

 Score = 95.9 bits (237), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 57/186 (30%), Positives = 98/186 (52%), Gaps = 6/186 (3%)

Query: 161 RKRRLKPKHKDFEMITXXXXXXXXXXXLARKKDTKEICAXXXXXXXXXXXXEGTDHVLTE 220
           + + L P  KD+ ++            LARKK T +  A                +V +E
Sbjct: 688 QTKNLTPTIKDYTILKPISKGAYGSVYLARKKITGDYFAIKVLKKSDMIAKNQVTNVKSE 747

Query: 221 RDILTTTRSEWLVKLLYA-FQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEM 279
           R I+     +  V  L+A FQ+ ++L+L ME++PGGD  TL+    +L     + Y++E+
Sbjct: 748 RAIMMVQSDKPYVARLFATFQNKENLFLVMEYLPGGDLATLIKMMGYLPDQWVKQYLTEI 807

Query: 280 FCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLA-SGTVS----MERIESMKIRLQ 334
              V+ +H+    H DLKP+N LID+ GH+KLTDFGL+ +G +     ++R++S+    +
Sbjct: 808 IVGVDDMHRNWIIHHDLKPDNLLIDNLGHVKLTDFGLSRAGLIHRHKFVDRVKSLSPSTE 867

Query: 335 EVKNLE 340
            + N++
Sbjct: 868 ILSNIK 873

 Score = 79.7 bits (195), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 74/136 (54%), Gaps = 8/136 (5%)

Query: 372  GSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGNSTNETYENLRNWKHVLQR 431
            G+PDY+A E +E        D+WS+GCI+FE L GY PF  N+    +  + + K  ++ 
Sbjct: 1007 GTPDYLAPETIEGTGEGDQCDWWSVGCIMFELLFGYPPFHTNTPEGVFRKILSGK--IEW 1064

Query: 432  PKCDN---GRYAFSDRTWELITR-LIADPINRLKS--FEHVKRMRYFSEIDFNTLRTIHP 485
            P+ D+    R   S    +LI + L+ DP  RL +   + +K+  YF +++++ +     
Sbjct: 1065 PQFDSIEEEREILSPEAKDLIMKLLVVDPSKRLGANGADEIKQHPYFKDVNWDHVYDEEA 1124

Query: 486  PFIPQLDNEEDVGYFD 501
             F+P ++N ED  YFD
Sbjct: 1125 SFVPTVENPEDTDYFD 1140

>Kwal_56.22476
          Length = 697

 Score = 95.1 bits (235), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 60/219 (27%), Positives = 95/219 (43%), Gaps = 42/219 (19%)

Query: 217 VLTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYI 276
           +L+E  I  + R   +V+ +  F+D  ++Y+ +E  P G    LL   K L  P  RF+ 
Sbjct: 123 LLSEIQIHKSMRHTNIVQFVDCFEDDTNVYILLEICPNGSLMDLLKRRKMLTEPEVRFFT 182

Query: 277 SEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEV 336
           +++  AV  +H     HRDLK  N   D   ++K+ DFGLA+                  
Sbjct: 183 TQIVGAVKYMHSRRVIHRDLKLGNIFFDKHYNLKVGDFGLAAVLA--------------- 227

Query: 337 KNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKN--YDFTVDYW 394
                        +DR R Y            +  G+P+Y+A EVL  K+  + + VD W
Sbjct: 228 -------------NDRERKY------------TVCGTPNYIAPEVLTGKHTGHSYEVDIW 262

Query: 395 SLGCILFESLVGYTPFSGNSTNETYENLRNWKHVLQRPK 433
           S G +++  L+G  PF     N  YE ++    V  + K
Sbjct: 263 SCGVMIYALLIGKPPFQAKEVNIIYERIKCGDFVFPKDK 301

>Kwal_47.18307
          Length = 621

 Score = 94.7 bits (234), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 69/269 (25%), Positives = 120/269 (44%), Gaps = 53/269 (19%)

Query: 216 HVLTERDILTTTRSEW---LVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHA 272
           +V  E+D+L          +VKL   F D ++LY  +E+V GG+   L+     L    +
Sbjct: 55  YVTIEKDLLNMLAKGGHLGIVKLFCTFHDIENLYFVLEYVSGGELLALIQRLGRLTEDLS 114

Query: 273 RFYISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIR 332
           R   +++   V+ +H  G  HRDLKPEN L+  +G + +TDFG A               
Sbjct: 115 RHITAQLVDTVDYMHSKGVIHRDLKPENVLLSQEGRVVITDFGAAC-------------- 160

Query: 333 LQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVD 392
                          +  DR+        E  +   S VG+ +Y++ E+L      F+ D
Sbjct: 161 ---------------TAADRKF-------ENTKRTASFVGTAEYVSPELLLHSQCGFSSD 198

Query: 393 YWSLGCILFESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELI--- 449
            W+LGCI+++   G  PF G +  +T+E +    +          ++ FS+    +    
Sbjct: 199 IWALGCIIYQLNQGKPPFRGENELQTFEKIVALDY----------KWLFSNSPQVVSIVQ 248

Query: 450 TRLIADPINRLKSFEHVKRMRYFSEIDFN 478
           + L+ DP+ R  S   +K+  +F+ ID++
Sbjct: 249 SILVTDPLKR-PSAAQLKQNPWFASIDWD 276

>Kwal_14.1159
          Length = 1521

 Score = 95.1 bits (235), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 60/170 (35%), Positives = 87/170 (51%), Gaps = 2/170 (1%)

Query: 167 PKHKDFEMITXXXXXXXXXXXLARKKDTKEICAXXXXXXXXXXXXEGTDHVLTERDILTT 226
           P  KD+++I            LA+++ T E  A                +V +ER I+  
Sbjct: 672 PSIKDYDVIKPISKGAYGSVFLAKRRITGEYFAIKVLKKSDMIAKNQVTNVKSERAIMMV 731

Query: 227 TRSEWLVKLLYA-FQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNA 285
             ++  V  LYA FQ+  +L+L ME++ GGD  TL+     L     + YISE+   V  
Sbjct: 732 QSNKPYVAKLYATFQNRGNLFLVMEYLSGGDLGTLIKMMGSLPDQWVKQYISEVIYGVED 791

Query: 286 LHQLGYTHRDLKPENFLIDSKGHIKLTDFGLAS-GTVSMERIESMKIRLQ 334
           +HQ G  H DLKP+N LID +GH+KLTDFGL+  G V+     + K RL+
Sbjct: 792 MHQSGIIHHDLKPDNLLIDQRGHLKLTDFGLSRMGLVTRHTGATQKSRLR 841

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 67/137 (48%), Gaps = 10/137 (7%)

Query: 372  GSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGNSTNETYENLR----NWKH 427
            G+PDY+A E +E      + D+WS+GC+LFE + GY PF  ++  E + N+     +W  
Sbjct: 960  GTPDYLAPETIEGTGETDSSDWWSVGCMLFEFVFGYPPFHASTVEEVFSNILAGNIDWPA 1019

Query: 428  VLQRPKCDNGRYAFSDRTWELITR-LIADPINRLKS--FEHVKRMRYFSEIDFNTLRTIH 484
                P     R   S    +LI + L+ DP  RL +   E +    YF ++D+  L    
Sbjct: 1020 F---PDEATEREYISPEARDLIEKLLVVDPDKRLGANGAEEIFEHPYFQDVDWENLYKDT 1076

Query: 485  PPFIPQLDNEEDVGYFD 501
              F+P + + E   YFD
Sbjct: 1077 GSFVPDIAHPESTDYFD 1093

>ACR218W [1265] [Homologous to ScYFL033C (RIM15) - SH]
           complement(731433..736142) [4710 bp, 1569 aa]
          Length = 1569

 Score = 94.7 bits (234), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 56/152 (36%), Positives = 79/152 (51%), Gaps = 1/152 (0%)

Query: 167 PKHKDFEMITXXXXXXXXXXXLARKKDTKEICAXXXXXXXXXXXXEGTDHVLTERDILTT 226
           P  KD+++I            LA K+ T E  A                +V +ER I+  
Sbjct: 677 PSIKDYDIIKPISKGAYGSVYLAYKRITGEYFAIKVLRKSDMIAKNQVTNVKSERVIMMV 736

Query: 227 TRSEWLVKLLYA-FQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNA 285
              +  V  LYA FQ+ ++L+L ME++ GGD  TL+     L    A+ YI+E+   V+ 
Sbjct: 737 QSEKPYVAKLYATFQNKENLFLVMEYLSGGDLATLIKMMGNLPDKWAKQYITEVIIGVDD 796

Query: 286 LHQLGYTHRDLKPENFLIDSKGHIKLTDFGLA 317
           +H  G  H DLKP+N LIDS GH+KLTDFGL+
Sbjct: 797 MHMSGIIHHDLKPDNLLIDSNGHVKLTDFGLS 828

 Score = 75.1 bits (183), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 42/136 (30%), Positives = 72/136 (52%), Gaps = 8/136 (5%)

Query: 372  GSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGNSTNETYENLRNWKHVLQR 431
            G+PDY++ E +         D+WS+GCILFE L+GY PF  ++  + ++N+ + +  +  
Sbjct: 1003 GTPDYLSPETILGTGESGASDWWSVGCILFEFLLGYPPFHASTVEDVFKNILSGQ--IDW 1060

Query: 432  PKCDNGRYA---FSDRTWELITRLI-ADPINRLKS--FEHVKRMRYFSEIDFNTLRTIHP 485
            P   N        S    +LI +L+ ++P  RL +   + +K   YF  I+++ +     
Sbjct: 1061 PSFPNKETELEYLSPEAKDLILKLLESNPEERLGANGAQEIKEHPYFKGINWSKVYDEEA 1120

Query: 486  PFIPQLDNEEDVGYFD 501
             F+P +DN ED  YFD
Sbjct: 1121 SFVPTVDNPEDTDYFD 1136

>ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH]
           complement(344395..346521) [2127 bp, 708 aa]
          Length = 708

 Score = 94.4 bits (233), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 60/235 (25%), Positives = 99/235 (42%), Gaps = 42/235 (17%)

Query: 191 KKDTKEICAXXXXXXXXXXXXEGTDHVLTERDILTTTRSEWLVKLLYAFQDPQSLYLAME 250
           K D+ ++ A            +    +L+E  I  + +   +V+    F+D  ++Y+ +E
Sbjct: 91  KDDSGKVFAAKTVAKISIKSEKTRKKLLSEIQIHKSMKHPNIVQFTDCFEDDTNVYILLE 150

Query: 251 FVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIK 310
             P G    LL   K L  P  RF+ +++  A+  +H     HRDLK  N   D   ++K
Sbjct: 151 ICPNGSLMDLLKQRKQLTEPEVRFFTTQIVGAIKYMHSRRIIHRDLKLGNIFFDKHFNLK 210

Query: 311 LTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHST 370
           + DFGLA+                               +DR R Y            + 
Sbjct: 211 IGDFGLAAVLA----------------------------NDRERKY------------TI 230

Query: 371 VGSPDYMALEVLEAKN--YDFTVDYWSLGCILFESLVGYTPFSGNSTNETYENLR 423
            G+P+Y+A EVL  K+  + F VD WS+G +++  L+G  PF     N  YE ++
Sbjct: 231 CGTPNYIAPEVLTGKHTGHSFEVDIWSIGVMIYALLIGKPPFQAKEVNTIYERIK 285

>KLLA0F11143g complement(1026129..1028570) similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, start by similarity
          Length = 813

 Score = 93.6 bits (231), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 65/220 (29%), Positives = 97/220 (44%), Gaps = 52/220 (23%)

Query: 215 DHVLTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARF 274
           D V  E D+L       +VKL   F+D  + Y+ MEFV GGD    +     +     R 
Sbjct: 233 DGVKRELDVLQKLNHPRIVKLKDFFEDNDNYYMLMEFVSGGDLMDFVAAHGTVGEDAGRE 292

Query: 275 YISEMFCAVNALHQLGYTHRDLKPENFLI--DSKGHIKLTDFGLASGTVSMERIESMKIR 332
              ++  AV  +H  G +HRDLKP+N +I  D    IK+TDFGLA            K++
Sbjct: 293 ITRQVLEAVKYMHDQGISHRDLKPDNIMIEQDDPVLIKITDFGLA------------KVQ 340

Query: 333 LQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKN------ 386
            Q                               + ++  G+  Y+A EV++ KN      
Sbjct: 341 NQNT-----------------------------FLNTFCGTLAYVAPEVIDGKNAEDKTN 371

Query: 387 ---YDFTVDYWSLGCILFESLVGYTPFSGNSTNETYENLR 423
              Y   VD WS+GC+++  L G+ PFSG S NE ++ ++
Sbjct: 372 RDLYSSLVDMWSIGCLVYVILTGHLPFSGQSQNELFKQIK 411

>Scas_502.2
          Length = 1116

 Score = 93.6 bits (231), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 64/252 (25%), Positives = 111/252 (44%), Gaps = 46/252 (18%)

Query: 229 SEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQ 288
           S  +++L + FQD  SLY  +E+ P GD  +L+     L      +Y +++  A+  +H 
Sbjct: 232 SRSIIRLFFTFQDEASLYFLLEYAPNGDLLSLMKKFGSLNEECCCYYGAQIIDAIKFMHS 291

Query: 289 LGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERS 348
            G  HRD+KPEN L+D    +K+TDFG A                             + 
Sbjct: 292 KGIIHRDIKPENILLDKDMKVKITDFGTA-----------------------------KI 322

Query: 349 MDDRR--RMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVG 406
           +D++     Y+ L       + S VG+ +Y++ E+L     D   D W+ GCI+F+ + G
Sbjct: 323 LDNKPPGTSYDLLTR-----SKSFVGTAEYVSPELLNDNYTDARSDIWAFGCIVFQMIAG 377

Query: 407 YTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITR-LIADPINRLKSFEH 465
             PF   +   T++ +   ++             F     +L+ R LI  P  RL + E 
Sbjct: 378 KPPFKATNEYLTFQKVMKVQYAFT--------AGFPTVVRDLVKRILIKAPEQRL-TIEA 428

Query: 466 VKRMRYFSEIDF 477
           +++  +F   +F
Sbjct: 429 IEKHHFFRSKNF 440

>CAGL0K08514g complement(853314..857783) similar to sp|P34244
           Saccharomyces cerevisiae YKL101w
           serine/threonine-protein kinase, hypothetical start
          Length = 1489

 Score = 93.2 bits (230), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 80/261 (30%), Positives = 113/261 (43%), Gaps = 66/261 (25%)

Query: 213 GTDHVLT----ERDI--LTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKF 266
           GTD  L     ER+I  +       ++ LL  +++   LYL +E+V GG+    L++   
Sbjct: 163 GTDSALNPYGIEREIVIMKLISHPNVMGLLEVWENKSELYLVLEYVDGGELFDYLVSKGK 222

Query: 267 LQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFLIDSKGH-IKLTDFGLASGTVSMER 325
           L  P A  Y +++   V+  H     HRDLKPEN L+D K   IK+ DFG+A+       
Sbjct: 223 LSEPEAVHYFTQIIQGVSYCHSFNICHRDLKPENLLLDKKNKVIKIADFGMAA------- 275

Query: 326 IESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAK 385
                        LE P              NKL E       ++ GSP Y + E++  K
Sbjct: 276 -------------LELP--------------NKLLE-------TSCGSPHYASPEIVMGK 301

Query: 386 NY-DFTVDYWSLGCILFESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYA---- 440
            Y     D WS G ILF  L G+ PF          N  N K +L   K   GR+     
Sbjct: 302 PYHGGPSDVWSCGIILFALLTGHLPF----------NDDNIKKLLL--KVQAGRFQLPPY 349

Query: 441 FSDRTWELITR-LIADPINRL 460
            ++   +LITR L+ +P  RL
Sbjct: 350 LTNDAKDLITRILVTNPEKRL 370

>ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH]
           complement(597519..600032) [2514 bp, 837 aa]
          Length = 837

 Score = 92.0 bits (227), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 73/262 (27%), Positives = 114/262 (43%), Gaps = 58/262 (22%)

Query: 214 TDHVLTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHAR 273
            D V  E ++L       +V L   ++D +S YL MEFV GGD    +     +     R
Sbjct: 257 VDGVTRELEVLRRLNHPRIVSLKGFYEDDESYYLLMEFVSGGDLMDFVAAHGSVGEDAGR 316

Query: 274 FYISEMFCAVNALHQLGYTHRDLKPENFLI--DSKGHIKLTDFGLASGTVSMERIESMKI 331
               ++  AV  +H+ G +HRDLKP+N LI  D    +K+TDFGLA            KI
Sbjct: 317 EITRQILEAVRYIHEQGISHRDLKPDNILIEQDDPVLVKITDFGLA------------KI 364

Query: 332 RLQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKN----- 386
                                        ++   +  +  G+  Y+A EV+  KN     
Sbjct: 365 -----------------------------QDNTTFMKTFCGTLAYVAPEVIGGKNPEGNG 395

Query: 387 -----YDFTVDYWSLGCILFESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAF 441
                Y   VD WS+GC+++  L G+ PFSG++  + Y+ + N  +  + P  D   Y  
Sbjct: 396 ANGNLYSSLVDMWSIGCLVYVILTGHLPFSGSTQEQLYKQIANGSY-HEGPLKD---YWI 451

Query: 442 SDRTWELITRLIA-DPINRLKS 462
           SD   + I  L+  +P++RL +
Sbjct: 452 SDEARDFIDSLLQINPVDRLTA 473

>CAGL0J11638g complement(1128620..1130860) highly similar to
           sp|P32562 Saccharomyces cerevisiae YMR001c CDC5 involved
           in regulation of DNA replication, hypothetical start
          Length = 746

 Score = 90.9 bits (224), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 61/257 (23%), Positives = 107/257 (41%), Gaps = 44/257 (17%)

Query: 191 KKDTKEICAXXXXXXXXXXXXEGTDHVLTERDILTTTRSEWLVKLLYAFQDPQSLYLAME 250
           K D+ +I A            +    +L+E  I  +     +V+ +  F+D  ++Y+ +E
Sbjct: 99  KDDSGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMSHTNIVQFIDCFEDNVNVYILLE 158

Query: 251 FVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIK 310
             P G    L+   K +  P  RF+++++   +  +H     HRDLK  N   D   ++K
Sbjct: 159 ICPNGSLMELIKKRKTITEPEVRFFMTQICGGIQYMHSNRVIHRDLKLGNIFFDEHYNLK 218

Query: 311 LTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHST 370
           + DFGLA+                               +DR R +            + 
Sbjct: 219 IGDFGLAAVLA----------------------------NDRERKF------------TI 238

Query: 371 VGSPDYMALEVLEAKN--YDFTVDYWSLGCILFESLVGYTPFSGNSTNETYENL--RNWK 426
            G+P+Y+A EVL  K+  + + VD WS+G +L+  L+G  PF     N  YE +  RN+ 
Sbjct: 239 CGTPNYIAPEVLMGKHSGHSYEVDIWSIGVMLYALLIGKPPFQAKDVNTIYERIKQRNFA 298

Query: 427 HVLQRPKCDNGRYAFSD 443
           +   +    + +Y   D
Sbjct: 299 YPKDKKISQDAKYLIDD 315

>Kwal_26.8796
          Length = 796

 Score = 90.5 bits (223), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 73/259 (28%), Positives = 110/259 (42%), Gaps = 56/259 (21%)

Query: 215 DHVLTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARF 274
           D V  E ++L       +V L   ++D  S YL MEFV GGD    +     +     R 
Sbjct: 229 DGVARELEVLQRLDHPRIVSLKGFYEDKDSHYLVMEFVSGGDLMDFVAAHGSVGEDAGRE 288

Query: 275 YISEMFCAVNALHQLGYTHRDLKPENFLI--DSKGHIKLTDFGLASGTVSMERIESMKIR 332
              ++  AV  +H +G +HRDLKP+N LI  D    +K+TDFGLA            KI 
Sbjct: 289 ITRQILEAVKYIHSMGISHRDLKPDNILIERDDPVLVKITDFGLA------------KI- 335

Query: 333 LQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKN------ 386
                                       +    +  +  G+  Y+A EV+  KN      
Sbjct: 336 ----------------------------QGNGTFMKTFCGTLAYVAPEVISGKNSGEKEG 367

Query: 387 --YDFTVDYWSLGCILFESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDR 444
             Y   VD WS+GC+++  L G+ PFSG++ N+ Y+ +    +  + P  D   Y  SD 
Sbjct: 368 NTYSSLVDMWSIGCLVYVILTGHLPFSGSTQNDLYKQITAGSY-HEGPLKD---YRISDD 423

Query: 445 TWELITRLI-ADPINRLKS 462
             + I   +  DP NR+ +
Sbjct: 424 ARDFIESFLQVDPRNRMTA 442

>KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces
           cerevisiae YDR507c GIN4 ser/thr protein kinase, start by
           similarity
          Length = 1112

 Score = 89.7 bits (221), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 74/258 (28%), Positives = 116/258 (44%), Gaps = 52/258 (20%)

Query: 232 LVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGY 291
           +++L   ++  + LY+ +E+V  G+   LL+    L    A  +  ++   ++  H LG 
Sbjct: 88  VLRLYDVWETSKDLYMVLEYVEKGELFNLLVERGPLPENEAVRFFRQIIIGISYCHALGI 147

Query: 292 THRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDD 351
            HRDLKPEN L+D K ++KL DFG+A+       +ES                       
Sbjct: 148 VHRDLKPENLLLDHKFNVKLADFGMAA-------LESK---------------------- 178

Query: 352 RRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNY-DFTVDYWSLGCILFESLVGYTPF 410
                +KL E       ++ GSP Y A E++    Y  F  D WS G IL+  L G  PF
Sbjct: 179 -----DKLLE-------TSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPF 226

Query: 411 SGNSTNETYENLRNWKHVLQRPKCD-NGRYAFSDRTWELITRLI-ADPINRLKSFEHVKR 468
                +E   N+RN    +Q  K +  G    S    +LI R++  DP  R+K+ E +K 
Sbjct: 227 -----DEEDGNIRNLLLKVQSGKFEMPGDDEISSEAQDLIARILTVDPEQRIKTREILKH 281

Query: 469 ---MRYFSEIDFNTLRTI 483
               +Y S  D  ++R +
Sbjct: 282 PLLRKYPSIKDSKSIRNL 299

>AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W
           (KCC4) - SH] (1721689..1725117) [3429 bp, 1142 aa]
          Length = 1142

 Score = 89.7 bits (221), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 74/258 (28%), Positives = 116/258 (44%), Gaps = 52/258 (20%)

Query: 232 LVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGY 291
           +++L   ++  Q LY+ +E+V  G+   LL+    L    A  +  ++   ++  H LG 
Sbjct: 90  VLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIGISYCHALGI 149

Query: 292 THRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDD 351
            HRDLKPEN L+D K +IKL DFG+A+       +ES                       
Sbjct: 150 VHRDLKPENLLLDHKFNIKLADFGMAA-------LES----------------------- 179

Query: 352 RRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNY-DFTVDYWSLGCILFESLVGYTPF 410
                +KL E       ++ GSP Y A E++    Y  F  D WS G IL+  L G  PF
Sbjct: 180 ----KDKLLE-------TSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPF 228

Query: 411 SGNSTNETYENLRNWKHVLQRPKCD-NGRYAFSDRTWELITRLI-ADPINRLKSFEHVKR 468
                +E   N+RN    +Q  K +  G    S    +LI +++  +P  R+K+ E +K 
Sbjct: 229 -----DEEDGNIRNLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKH 283

Query: 469 ---MRYFSEIDFNTLRTI 483
               +Y S  D  ++R +
Sbjct: 284 PLLQKYPSIKDSKSIRNL 301

>Kwal_56.24091
          Length = 381

 Score = 87.4 bits (215), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 75/299 (25%), Positives = 122/299 (40%), Gaps = 51/299 (17%)

Query: 171 DFEMITXXXXXXXXXXXLARKKDTKEICAXXXXXXXXXXXXEGTDHVLTERDILTTTRSE 230
           DFE+               + K T  ICA                    E +I ++ +  
Sbjct: 122 DFEVGKKLGKGKFGKVYCVKHKRTGFICALKAMKKSEIVQYNVQKQFRREVEIQSSLKHP 181

Query: 231 WLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLG 290
            L +L   F D + +YL ME++  G+    L +        A  ++ +M  A+N +H   
Sbjct: 182 NLTRLYGYFHDEKRVYLLMEYLVNGELYKHLRSHGPFNDITASHFVHQMADALNYMHSKN 241

Query: 291 YTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMD 350
             HRD+KPEN L+  +  +KLTDFG +   V   + +++                     
Sbjct: 242 ILHRDIKPENILLGFQNTLKLTDFGWSVSNVGNSKRKTL--------------------- 280

Query: 351 DRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPF 410
                                G+ DY++ E+++++ YD  VD W+LG + +E LVG  PF
Sbjct: 281 --------------------CGTMDYLSPELIKSREYDNKVDVWALGVLTYELLVGSPPF 320

Query: 411 SGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITRLIA-DPINRLKSFEHVKR 468
             ++   TY+  R  K  L+ P         S    +LI+RL+  DP NR+   + VKR
Sbjct: 321 EEDTKELTYK--RIIKRDLRFPD------QVSPHARDLISRLLEYDPQNRI-PLKDVKR 370

>CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces
           cerevisiae YBR274w CHK1 regulats inhibitory Cdk
           phosphorylation of PDS1, start by similarity
          Length = 528

 Score = 88.2 bits (217), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 79/168 (47%), Gaps = 38/168 (22%)

Query: 245 LYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFLID 304
           L++ +E   GGD    +     +    A+FY  ++  A+N LH +G  HRD+KPEN L+D
Sbjct: 90  LWIMLEMADGGDLFDKIEPDVGVDPDVAQFYFQQLIRALNYLHDVGVAHRDIKPENILLD 149

Query: 305 SKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEV 364
            KG++KL DFGLAS                        +FR              ++  +
Sbjct: 150 KKGNLKLADFGLAS------------------------QFRR-------------KDGTL 172

Query: 365 RYAHSTVGSPDYMALEVLEAKNYDFTV-DYWSLGCILFESLVGYTPFS 411
           R +    GSP YMA E+L ++ Y   + D WS G +LF  L G  P+S
Sbjct: 173 RVSTDQRGSPPYMAPEILSSQGYYANITDIWSAGVLLFVLLTGEIPWS 220

>KLLA0B02332g complement(206863..207948) similar to sp|P38991
           Saccharomyces cerevisiae YPL209c IPL1 ser/thr protein
           kinase, start by similarity
          Length = 361

 Score = 85.9 bits (211), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 63/253 (24%), Positives = 105/253 (41%), Gaps = 41/253 (16%)

Query: 170 KDFEMITXXXXXXXXXXXLARKKDTKEICAXXXXXXXXXXXXEGTDHVLTERDILTTTRS 229
           +DFE+               + ++T  ICA                    E +I  + + 
Sbjct: 98  QDFEIGKILGKGKFGKVYCVKHRETGLICALKAMEKKEIVQYTIQKQFRREVEIQGSFKH 157

Query: 230 EWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQL 289
           + L +L   F D + +YL ME+V  G+    L N   L    A +++ +M  A++ +H  
Sbjct: 158 KNLTQLYGFFYDEKRVYLLMEYVYYGELYKFLKNNGPLNETLASYFVYQMANALDYMHSK 217

Query: 290 GYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSM 349
              HRD+KPEN LI     IKLTDFG +                                
Sbjct: 218 NILHRDIKPENILIGFNNTIKLTDFGWS-------------------------------- 245

Query: 350 DDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTP 409
                +YN    E+ +   +  G+ DY++ E+++++ Y+  VD W+LG + +E LVG  P
Sbjct: 246 -----VYN----EDGQKRKTLCGTIDYLSPELIKSREYNNKVDVWALGVLTYELLVGSPP 296

Query: 410 FSGNSTNETYENL 422
           F  ++   TY  +
Sbjct: 297 FEEDTKEMTYRRI 309

>KLLA0F09031g 839103..841004 similar to sp|P43565 Saccharomyces
           cerevisiae YFL033c RIM15 protein kinase involved in
           expression of meiotic genes, hypothetical start
          Length = 633

 Score = 87.4 bits (215), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 46/136 (33%), Positives = 75/136 (55%), Gaps = 8/136 (5%)

Query: 372 GSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGNSTNETYENLRNWKHVLQR 431
           G+PDY+A E ++      T D+WS+GCI FE L GY PF G + +E +EN+     V++ 
Sbjct: 65  GTPDYLAPETIKGTGESDTCDWWSVGCIFFEFLFGYPPFHGTTVDEVFENIIGG--VIRW 122

Query: 432 PKCDNG----RYAFSDRTWELITRLIADPINRLKS--FEHVKRMRYFSEIDFNTLRTIHP 485
           P+  +      Y   D    +I  L+ DP  RL +   + +K   YF ++D++ +    P
Sbjct: 123 PEFPDAETEMEYISPDAKDLVIKLLVLDPNKRLGASGSQEIKEHPYFKDVDWDHVYDEQP 182

Query: 486 PFIPQLDNEEDVGYFD 501
            F+P++++ ED  YFD
Sbjct: 183 SFVPRVEHPEDTEYFD 198

>KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication, start by similarity
          Length = 708

 Score = 87.4 bits (215), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 66/274 (24%), Positives = 109/274 (39%), Gaps = 64/274 (23%)

Query: 217 VLTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYI 276
           +L+E  I  + +   +V+    F+D  ++Y+ +E  P G    LL   K L  P  RF +
Sbjct: 134 LLSEIQIHKSMKHPNIVQFTDCFEDDTNVYILLEICPNGSVMELLRQRKHLTEPEVRFCM 193

Query: 277 SEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEV 336
            ++  A+  +H     HRDLK  N   D + ++K+ DFGLA+                  
Sbjct: 194 IQIIGAIRYMHSRRVIHRDLKLGNIFFDKEYNLKIGDFGLAAVLA--------------- 238

Query: 337 KNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKN--YDFTVDYW 394
                        +D+ R Y            +  G+P+Y+A EVL  K+  + + VD W
Sbjct: 239 -------------NDKERKY------------TICGTPNYIAPEVLTGKHTGHSYEVDIW 273

Query: 395 SLGCILFESLVGYTPFSGNSTNETYENLRN------------------WKHVLQ-RPKCD 435
           S+G +L+  L G  PF        YE ++                     H+LQ  P   
Sbjct: 274 SIGVMLYALLFGKPPFQAKEVETIYERIKCRDFIFPADKPVSSDAKNLISHLLQLNPAAR 333

Query: 436 NGRYAFSDRTW---ELITRLIADPINRLKSFEHV 466
              Y  +D  W      +RL +     + +F+H+
Sbjct: 334 PSLYEITDNVWFRNTFPSRLPSTITKEIPNFDHL 367

>Scas_493.2
          Length = 1117

 Score = 87.4 bits (215), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 69/253 (27%), Positives = 108/253 (42%), Gaps = 59/253 (23%)

Query: 223 ILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCA 282
           I+   R   ++ L   ++   +LY+ +E+   G+   LL+    L    A  +  ++   
Sbjct: 87  IMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQIIIG 146

Query: 283 VNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFP 342
           ++  H LG  HRDLKPEN L+D K +IK+ DFG+A+                        
Sbjct: 147 ISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAA------------------------ 182

Query: 343 EFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNY-DFTVDYWSLGCILF 401
                             E E +   ++ GSP Y A E++    Y  F  D WS G ILF
Sbjct: 183 -----------------LETEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILF 225

Query: 402 ESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSD------RTWELITRLI-A 454
             L G  PF     +E   N+RN   +L   K  +G++   D         +LI+R++  
Sbjct: 226 ALLTGRLPF-----DEEDGNIRNL--LL---KVQSGQFEMPDDDEMSRDAQDLISRILTV 275

Query: 455 DPINRLKSFEHVK 467
           DP  R+K+ E +K
Sbjct: 276 DPTKRIKTREILK 288

>Scas_644.15
          Length = 726

 Score = 87.0 bits (214), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 61/243 (25%), Positives = 102/243 (41%), Gaps = 47/243 (19%)

Query: 219 TERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISE 278
           +E  I  + +   +V  +  F+D  ++Y+ +E    G    L+   K L  P  RF+ ++
Sbjct: 138 SEIQIHKSMKHPNIVHFVDCFEDDTNVYILLEICSNGSLMDLMKKRKTLTEPEVRFFTTQ 197

Query: 279 MFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKN 338
           +  AV  +H     HRDLK  N   D   ++K+ DFGLA+                    
Sbjct: 198 ICGAVKYMHSRRVIHRDLKLGNIFFDKDYNLKVGDFGLAAVLA----------------- 240

Query: 339 LEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKN--YDFTVDYWSL 396
                      ++R R Y            +  G+P+Y+A EVL  K+  + F VD WS+
Sbjct: 241 -----------NNRERKY------------TVCGTPNYIAPEVLMGKHAGHSFEVDIWSI 277

Query: 397 GCILFESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITRLIADP 456
           G +++  LVG  PF     N  Y+ ++  ++   + K     Y  S+    +   L  DP
Sbjct: 278 GVMIYALLVGKPPFQAKDVNVIYDRIKACQYGYPKDK-----YVSSEAKTLIADILCVDP 332

Query: 457 INR 459
           + R
Sbjct: 333 VER 335

>CAGL0K05709g complement(555903..559214) similar to sp|Q12263
           Saccharomyces cerevisiae YDR507c GIN4, start by
           similarity
          Length = 1103

 Score = 86.7 bits (213), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 69/263 (26%), Positives = 110/263 (41%), Gaps = 62/263 (23%)

Query: 232 LVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGY 291
           +++L   ++    LYL +E+   G+   +L+    L    A     ++   ++  H LG 
Sbjct: 91  VLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQIIIGISYCHSLGV 150

Query: 292 THRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDD 351
            HRDLKPEN L+D+K +IK+ DFG+A+                                 
Sbjct: 151 VHRDLKPENLLLDNKLNIKIADFGMAA--------------------------------- 177

Query: 352 RRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYD-FTVDYWSLGCILFESLVGYTPF 410
                    E E +   ++ GSP Y A E++    Y+ F+ D WS G ILF  L G  PF
Sbjct: 178 --------LESEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPF 229

Query: 411 SGNSTNETYENLRNWKHVLQRPKCDNGRYAFSD------RTWELITRLI-ADPINRLKSF 463
                +E   N+RN    +Q+     G +   D         +L+ RL+  DP  R+   
Sbjct: 230 -----DEEDGNIRNLLLKVQK-----GEFEMPDDDEITKEAQDLLARLLTVDPSKRITIR 279

Query: 464 EHVKR---MRYFSEIDFNTLRTI 483
           E +K     +Y S  D  ++R +
Sbjct: 280 EILKHPLLQKYPSIKDSRSIRNL 302

>Scas_627.7
          Length = 349

 Score = 84.0 bits (206), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 67/252 (26%), Positives = 101/252 (40%), Gaps = 41/252 (16%)

Query: 171 DFEMITXXXXXXXXXXXLARKKDTKEICAXXXXXXXXXXXXEGTDHVLTERDILTTTRSE 230
           DFE+               R K+T  ICA                    E +I T+    
Sbjct: 90  DFEIGKKLGKGKFGKVYCVRHKETGFICALKVMDKAEIVQYNLQKQFRREVEIQTSLNHP 149

Query: 231 WLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLG 290
            L KL   F D + +YL ME++  G+   LL +        A  ++ ++  A+N LH   
Sbjct: 150 NLTKLYGHFHDEKRVYLLMEYLVYGELYKLLRSHGPFNDVIASRFVFQIADALNYLHDKQ 209

Query: 291 YTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMD 350
             HRDLKPEN LI     IKLTDFG                                S+ 
Sbjct: 210 IIHRDLKPENILIGFNNVIKLTDFGW-------------------------------SII 238

Query: 351 DRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPF 410
           + R +  K          +  G+ DY++ E++ ++ YD  VD W+LG + +E +VG  PF
Sbjct: 239 NPRGVKRK----------TLCGTIDYLSPEMIRSREYDDKVDVWALGVLTYELIVGSPPF 288

Query: 411 SGNSTNETYENL 422
             ++   TY+ +
Sbjct: 289 EEDTKELTYKRI 300

>YDR507C (GIN4) [1321] chr4 complement(1462346..1465774)
           Serine/threonine-protein kinase required for septin
           organization at the bud neck, has similarity to Ycl024p
           [3429 bp, 1142 aa]
          Length = 1142

 Score = 85.5 bits (210), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 68/244 (27%), Positives = 99/244 (40%), Gaps = 50/244 (20%)

Query: 245 LYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFLID 304
           LYL +E+   G+   LL+    L    A  +  ++   V+  H LG  HRDLKPEN L+D
Sbjct: 106 LYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLD 165

Query: 305 SKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEV 364
            K +IK+ DFG+A+                                          E E 
Sbjct: 166 HKYNIKIADFGMAA-----------------------------------------LETEG 184

Query: 365 RYAHSTVGSPDYMALEVLEAKNYD-FTVDYWSLGCILFESLVGYTPFSGNSTNETYENLR 423
           +   ++ GSP Y A E++    Y  F  D WS G ILF  L G  PF     N     L+
Sbjct: 185 KLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLK 244

Query: 424 NWKHVLQRPKCDNGRYAFSDRTWELITRLI-ADPINRLKS---FEHVKRMRYFSEIDFNT 479
             K   + P  D      S    +LI +++  DP  R+K+    +H    +Y S  D  +
Sbjct: 245 VQKGEFEMPSDDE----ISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKS 300

Query: 480 LRTI 483
           +R +
Sbjct: 301 IRGL 304

>Scas_616.10
          Length = 1461

 Score = 85.1 bits (209), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 68/234 (29%), Positives = 100/234 (42%), Gaps = 56/234 (23%)

Query: 232 LVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGY 291
           ++ L   +++   LYL +E+V GG+    L++   L    A  Y  ++   V+  H    
Sbjct: 198 VMALYEVWENKSELYLVLEYVDGGELFDYLVSKGKLSEKEAVHYFKQIIQGVSYCHSFNI 257

Query: 292 THRDLKPENFLIDSKG-HIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMD 350
            HRDLKPEN L+D K   IK+ DFG+A+                    LE P        
Sbjct: 258 CHRDLKPENLLLDKKNKSIKIADFGMAA--------------------LELP-------- 289

Query: 351 DRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNY-DFTVDYWSLGCILFESLVGYTP 409
                 NKL +       ++ GSP Y + E++  K+Y     D WS G ILF  L G+ P
Sbjct: 290 ------NKLLQ-------TSCGSPHYASPEIVMGKSYHGGPSDVWSCGIILFALLTGHLP 336

Query: 410 FSGNSTNETYENLRNWKHVLQRPKCDNGRY--AFSDRTWELITR-LIADPINRL 460
           F          N  N K +L + +    R     S    +LI+R L+ DP  R+
Sbjct: 337 F----------NDDNIKKLLLKVQAGKFRMPSTLSPEAQDLISRILVIDPSKRI 380

>AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH]
           (249144..250247) [1104 bp, 367 aa]
          Length = 367

 Score = 82.0 bits (201), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 90/203 (44%), Gaps = 41/203 (20%)

Query: 220 ERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEM 279
           E +I ++ R   L +L   F D + +YL ME++  G+    L          A +Y+ +M
Sbjct: 157 EVEIQSSLRHPNLTQLYGYFHDEKRVYLLMEYLVNGELYKHLKGRSHFNDVVASYYVYQM 216

Query: 280 FCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNL 339
             A++ +H+    HRD+KPEN +I     IKLTDFG +  T                   
Sbjct: 217 ADALDYMHERNILHRDIKPENIIIGFNNTIKLTDFGWSVIT------------------- 257

Query: 340 EFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCI 399
             P+  +R                     +  G+ DY++ E++ ++ Y+  VD W+LG +
Sbjct: 258 --PKGSKRK--------------------TLCGTVDYLSPELIRSREYNEKVDVWALGVL 295

Query: 400 LFESLVGYTPFSGNSTNETYENL 422
            +E LVG  PF   S   TY+ +
Sbjct: 296 TYELLVGSPPFEEESKELTYKRI 318

>CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces
           cerevisiae YPL209c IPL1 ser/thr protein kinase, start by
           similarity
          Length = 358

 Score = 81.6 bits (200), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 78/293 (26%), Positives = 114/293 (38%), Gaps = 52/293 (17%)

Query: 170 KDFEMITXXXXXXXXXXXLARKKDTKEICAXXXXXXXXXXXXEGTDHVLTERDILTTTRS 229
           KDFE+               R K +  ICA                 +  E DI      
Sbjct: 98  KDFEVGRKLGKGKFGKVYCVRHKKSGFICALKAIEKNEILQFNLLKQLKREVDIQLGMDH 157

Query: 230 EWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQL 289
             ++KL   F D + +YL ME    G+    L N        A  YI ++  A++ +H+ 
Sbjct: 158 PNIIKLYAHFHDEKRVYLLMEHSINGELYKSLKNNGPFNDVLASHYIYQIADALHYMHKK 217

Query: 290 GYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSM 349
              HRD+KPEN LI     +KL DFG +                     +  PE  +R  
Sbjct: 218 RIIHRDVKPENVLIGFDNVVKLADFGWS---------------------ILNPEGSKRK- 255

Query: 350 DDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTP 409
                              +  G+ DY++ E++  + YD  VD W+LG + +E +VG  P
Sbjct: 256 -------------------TLCGTIDYLSPEMITPREYDEQVDVWALGVLAYELVVGVPP 296

Query: 410 FSGNSTNETYENLRNWKHVLQRPKCD-NGRYAFSDRTWELITR-LIADPINRL 460
           F  NS   TY      K +L   KCD N   + S    +LI++ L+ D   RL
Sbjct: 297 FEENSKELTY------KRIL---KCDLNFPESISKDAKDLISKLLVTDTTQRL 340

>Scas_700.54
          Length = 698

 Score = 82.4 bits (202), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 72/274 (26%), Positives = 114/274 (41%), Gaps = 63/274 (22%)

Query: 215 DHVLTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARF 274
           + V  E ++L       +V+L   ++D  S Y+ MEFV GGD    +     +     + 
Sbjct: 264 EGVSRELEVLQQLDHPRIVRLKGFYEDKDSYYMVMEFVSGGDLMDFVAAHGAVGEEAGKE 323

Query: 275 YISEMFCAVNALHQLGYTHRDLKPENFLI--DSKGHIKLTDFGLASGTVSMERIESMKIR 332
              ++  AV  +H  G +HRDLKP+N LI  D    +K+TDFGLA               
Sbjct: 324 ISRQILEAVKYIHSKGISHRDLKPDNILIEQDDPVLVKITDFGLAK-------------- 369

Query: 333 LQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKN------ 386
                                       +    +  +  G+  Y+A EV+  K       
Sbjct: 370 ---------------------------VQGNGSFMKTFCGTLAYVAPEVIGGKGETNEER 402

Query: 387 --YDFTVDYWSLGCILFESLVGYTPFSGNSTNETYENL-RNWKHVLQRPKCDNGRYAFSD 443
             Y   VD WS+GC+++  L G+ PFSG++  + Y+ + R   H  + P  D   +  SD
Sbjct: 403 NEYSSLVDMWSMGCLVYVILTGHLPFSGSTQEQLYKQISRGSYH--EGPLKD---FRISD 457

Query: 444 RTWELITRLI-ADPINRL---KSFEH--VKRMRY 471
                I  L+  +P NRL   ++ EH  +K  +Y
Sbjct: 458 EARSFIDSLLQVNPGNRLTAARALEHPWIKMAQY 491

>Scas_700.28
          Length = 896

 Score = 82.4 bits (202), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 63/237 (26%), Positives = 98/237 (41%), Gaps = 49/237 (20%)

Query: 231 WLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLG 290
           ++ KL         +++A+E+ PG +    +L+   +         +++   V+  H L 
Sbjct: 90  YITKLYEVIITETKVWMALEYCPGKELYDRVLSMHRVPTDECVQLFAQIVGGVHYAHSLN 149

Query: 291 YTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMD 350
             HRDLK EN L+D  G  KLTDFG     ++   +E++                     
Sbjct: 150 CVHRDLKLENILLDKSGDAKLTDFGFTRECMTKTTLETI--------------------- 188

Query: 351 DRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYD-FTVDYWSLGCILFESLVGYTP 409
                                G+  YMA E++E K+YD F +D WSLG IL+  + G  P
Sbjct: 189 --------------------CGTTVYMAPELIERKSYDGFKIDIWSLGVILYTMINGSMP 228

Query: 410 FSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITRLIADPINRLKSFEHV 466
           F     +E  E    WK V Q P+  N     +D   +LI RL+A   N   + E +
Sbjct: 229 F-----DEDDETKTEWKIVHQTPQL-NENIVTAD-AKDLILRLLAKNPNDRPTVEQI 278

>KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 843

 Score = 82.4 bits (202), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 52/181 (28%), Positives = 77/181 (42%), Gaps = 42/181 (23%)

Query: 231 WLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLG 290
           ++ KL         +++ +E+  G +    LL  + L    ++   S++  AV   H+L 
Sbjct: 89  YITKLYEVIVTESRVWMVLEYCSGHELYEHLLKEQRLSLEESKKLFSQIASAVYYAHELK 148

Query: 291 YTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMD 350
             HRDLK EN L+D  GH KLTDFG      +  ++E++                     
Sbjct: 149 CVHRDLKLENVLLDGNGHAKLTDFGFTREMATRSQLETI--------------------- 187

Query: 351 DRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYD-FTVDYWSLGCILFESLVGYTP 409
                                G+  YMA E++E K YD F VD WSLG IL+  + GY P
Sbjct: 188 --------------------CGTTVYMAPELIERKCYDGFKVDIWSLGIILYTMINGYMP 227

Query: 410 F 410
           F
Sbjct: 228 F 228

>YKL101W (HSL1) [3161] chr11 (248566..253122) Serine/threonine
           protein kinase that genetically interacts with histone
           mutants and negatively regulates Swe1p protein kinase
           [4557 bp, 1518 aa]
          Length = 1518

 Score = 82.4 bits (202), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 69/243 (28%), Positives = 105/243 (43%), Gaps = 60/243 (24%)

Query: 232 LVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGY 291
           ++ L   +++   LYL +E+V GG+    L++   L    A  Y  ++   V+  H    
Sbjct: 176 VMALFEVWENKSELYLVLEYVDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNI 235

Query: 292 THRDLKPENFLIDSKG-HIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMD 350
            HRDLKPEN L+D K   IK+ DFG+A+                    LE P        
Sbjct: 236 CHRDLKPENLLLDKKNRRIKIADFGMAA--------------------LELP-------- 267

Query: 351 DRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNY-DFTVDYWSLGCILFESLVGYTP 409
                 NKL +       ++ GSP Y + E++  + Y     D WS G +LF  L G+ P
Sbjct: 268 ------NKLLK-------TSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLP 314

Query: 410 FSGNSTNETYENLRNWKHVLQRPKCDNGRYA----FSDRTWELITR-LIADPINRLKSFE 464
           F          N  N K +L   K  +G+Y      S    +LI++ L+ DP  R+ + E
Sbjct: 315 F----------NDDNIKKLLL--KVQSGKYQMPSNLSSEARDLISKILVIDPEKRITTQE 362

Query: 465 HVK 467
            +K
Sbjct: 363 ILK 365

>YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase,
           required for metaphase DNA-damage checkpoint [1584 bp,
           527 aa]
          Length = 527

 Score = 80.9 bits (198), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 54/169 (31%), Positives = 78/169 (46%), Gaps = 40/169 (23%)

Query: 245 LYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALH-QLGYTHRDLKPENFLI 303
           +++ +E   GGD    +     + +  A+FY  ++  A+N LH + G  HRD+KPEN L+
Sbjct: 91  MWIILEMADGGDLFDKIEPDVGVDSDVAQFYFQQLVSAINYLHVECGVAHRDIKPENILL 150

Query: 304 DSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEE 363
           D  G++KL DFGLAS                        +FR              ++  
Sbjct: 151 DKNGNLKLADFGLAS------------------------QFRR-------------KDGT 173

Query: 364 VRYAHSTVGSPDYMALEVL--EAKNYDFTVDYWSLGCILFESLVGYTPF 410
           +R +    GSP YMA EVL  E   Y    D WS+G +LF  L G TP+
Sbjct: 174 LRVSMDQRGSPPYMAPEVLYSEEGYYADRTDIWSIGILLFVLLTGQTPW 222

>CAGL0M02233g complement(267332..269635) highly similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, hypothetical start
          Length = 767

 Score = 81.3 bits (199), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 59/227 (25%), Positives = 91/227 (40%), Gaps = 61/227 (26%)

Query: 215 DHVLTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARF 274
           D V  E ++L       +V L   ++D  + Y+ MEF+ GGD    +     +     R 
Sbjct: 229 DGVSRELEVLQKLNHPRIVSLKAFYEDEANYYMVMEFISGGDLMDFVAAHGAVGEEAGRE 288

Query: 275 YISEMFCAVNALHQLGYTHRDLKPENFLI--DSKGHIKLTDFGLA--SGTVSMERIESMK 330
              ++  A+  +H  G +HRDLKP+N LI  D    +K+TDFGLA   G  S+ +     
Sbjct: 289 ISRQILEAIQYIHSKGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSIMK----- 343

Query: 331 IRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEA------ 384
                                                 +  G+  Y+A EV+        
Sbjct: 344 --------------------------------------TFCGTLAYVAPEVIGGFTGATG 365

Query: 385 --------KNYDFTVDYWSLGCILFESLVGYTPFSGNSTNETYENLR 423
                     Y   VD WS+GC++F  L G+ PFSG++  + YE +R
Sbjct: 366 EEETEEERIEYSSLVDMWSMGCLVFVILTGHLPFSGSTQEQLYEQIR 412

>ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH]
           complement(333434..337711) [4278 bp, 1425 aa]
          Length = 1425

 Score = 80.5 bits (197), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 71/250 (28%), Positives = 109/250 (43%), Gaps = 63/250 (25%)

Query: 232 LVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGY 291
           ++ L   +++   LYL +E+V GG+    L+    L    A  Y  ++   V+  H    
Sbjct: 126 IMALYEVWENKSELYLVLEYVEGGELFDYLIARGKLPEQEAIHYFKQIVQGVSYCHNFNI 185

Query: 292 THRDLKPENFLIDSKGH-IKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMD 350
            HRDLKPEN L+D K   +K+ DFG+A+                    LE          
Sbjct: 186 CHRDLKPENLLLDKKNKTVKIADFGMAA--------------------LE---------- 215

Query: 351 DRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFT-VDYWSLGCILFESLVGYTP 409
                 N+L E       ++ GSP Y + E++  + Y  +  D WS G ILF  L G+ P
Sbjct: 216 ----TTNRLLE-------TSCGSPHYASPEIVMGQKYHGSPSDVWSCGIILFALLTGHLP 264

Query: 410 FSGNSTNETYENLRNWKHVLQRPKCDNGRYAF----SDRTWELITR-LIADPINRL---K 461
           F+        +N+R  K +L   K  +GRY      S    +LI++ L+ DP  R+   K
Sbjct: 265 FND-------DNVR--KLLL---KVQHGRYQMPSNVSKEAKDLISKILVVDPEKRITVDK 312

Query: 462 SFEHVKRMRY 471
             EH   ++Y
Sbjct: 313 ILEHPLLVKY 322

>Scas_675.2
          Length = 527

 Score = 79.3 bits (194), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 50/168 (29%), Positives = 80/168 (47%), Gaps = 39/168 (23%)

Query: 245 LYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQ-LGYTHRDLKPENFLI 303
           +++ ME   GGD    +     + +  A+FY  ++  A++ LH+  G  HRD+KPEN L+
Sbjct: 91  MWMIMEMADGGDLFDKIEPDVGVDSEVAQFYFQQLVRAISYLHEECGVAHRDIKPENILL 150

Query: 304 DSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEE 363
           D  G++KL DFGL+S                        ++R              ++  
Sbjct: 151 DKNGNLKLADFGLSS------------------------QYRR-------------KDGT 173

Query: 364 VRYAHSTVGSPDYMALEVLEAKN-YDFTVDYWSLGCILFESLVGYTPF 410
           +R +    GSP YMA E+L ++  Y  + D WS+G +LF  L G TP+
Sbjct: 174 LRISTDQRGSPPYMAPEILHSRGYYAHSTDIWSIGILLFVLLTGETPW 221

>YGL158W (RCK1) [1831] chr7 (207036..208574) Serine/threonine
           protein kinase with similarity to Cmk1p, Cmk2p, and
           Cmk3p [1539 bp, 512 aa]
          Length = 512

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 66/232 (28%), Positives = 105/232 (45%), Gaps = 31/232 (13%)

Query: 238 AFQDPQSLY-LAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDL 296
           AFQ+  + Y L  E V GG+    ++         AR  I+++  A+  +H +G  HRD+
Sbjct: 201 AFQESANYYYLVTELVTGGEIFDRIVQLTCFSEDLARHVITQVAIAIKHMHYMGIVHRDV 260

Query: 297 KPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMY 356
           KPEN L +      +  +GL  G +  E   ++ +    +  ++  +F          + 
Sbjct: 261 KPENLLFE-----PIPFYGL-DGDMQKEDEFTLGVGGGGIGLVKLMDFG---------LA 305

Query: 357 NKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGNSTN 416
            KLR      A +  G+ +Y+A EV  +K Y   VD WS+GC+LF  L GY PF      
Sbjct: 306 KKLRNNT---AKTPCGTIEYVASEVFTSKRYSMKVDMWSIGCVLFTLLCGYPPF------ 356

Query: 417 ETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITRLIADPINRLKSFEHVKR 468
             YE  +N K +L+  K   G Y F    W+ I+    + +  L   +  KR
Sbjct: 357 --YE--KNEKTLLK--KISRGDYEFLAPWWDNISSGAKNAVTHLLEVDPNKR 402

>Kwal_26.7788
          Length = 1267

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 67/223 (30%), Positives = 93/223 (41%), Gaps = 60/223 (26%)

Query: 245 LYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFLID 304
           L+L +E+V GG+    L++   L    A  Y  ++       H     HRDLKPEN L+D
Sbjct: 132 LFLVLEYVDGGELFDYLVSRGRLPEKEAIHYFRQIIEGTAYCHGFNICHRDLKPENLLLD 191

Query: 305 SKG-HIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEE 363
            K   IK+ DFG+A+   S                                  NKL E  
Sbjct: 192 KKNKRIKIADFGMAALQTS----------------------------------NKLLE-- 215

Query: 364 VRYAHSTVGSPDYMALEVLEAKNYD-FTVDYWSLGCILFESLVGYTPFSGNSTNETYENL 422
                ++ GSP Y + E++  KNY+    D WS G ILF  L G+ PF          N 
Sbjct: 216 -----TSCGSPHYASPEIVMGKNYNGGPSDVWSCGIILFALLTGHLPF----------ND 260

Query: 423 RNWKHVLQRPKCDNGRY----AFSDRTWELITR-LIADPINRL 460
            N K +L   K   G+Y    + S    +LI+R L+ DP  R+
Sbjct: 261 DNIKRLLL--KVQAGKYQMPQSVSSGAQDLISRILVVDPDKRI 301

>KLLA0F13552g complement(1252906..1256709)
           gi|33386566|emb|CAD87727.1 Kluyveromyces lactis protein
           kinase, start by similarity
          Length = 1267

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 76/283 (26%), Positives = 115/283 (40%), Gaps = 73/283 (25%)

Query: 232 LVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGY 291
           ++ L   +++   LYL +E+V GG+    L++   L    A  Y  ++  AV   H    
Sbjct: 136 VMGLYEVWENKSELYLVLEYVEGGELFDYLVSKGKLPESEAIHYFKQIVQAVAYCHGFNI 195

Query: 292 THRDLKPENFLIDSKGH-IKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMD 350
            HRDLKPEN L+D K   IK+ DFG+A+   S + +E                       
Sbjct: 196 CHRDLKPENLLLDKKKRSIKIADFGMAALETSDKLLE----------------------- 232

Query: 351 DRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFT-VDYWSLGCILFESLVGYTP 409
                             ++ GSP Y + E++  + Y  +  D WS G ILF  L G+ P
Sbjct: 233 ------------------TSCGSPHYASPEIVLGRKYHGSPSDVWSCGIILFALLTGHLP 274

Query: 410 FSGNSTNETYENLRNWKHVLQRPKCDNGRYA----FSDRTWELITR-LIADPINRLKSFE 464
           F          N  N K +L   K  +G+Y      S    +LI+R L+ DP NR  + +
Sbjct: 275 F----------NDDNVKKLLL--KVQSGKYQMPQWLSVEAKDLISRILVVDP-NRRITID 321

Query: 465 HV----------KRMRYFSEIDFNTLRTIHPPFIPQLDNEEDV 497
            +          ++ R  S  D N L     P I    +E D+
Sbjct: 322 QILQHELLTKYDQKSRSKSNSDLNLLN--RTPNIVSFSSERDI 362

>Kwal_14.2497
          Length = 418

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 84/176 (47%), Gaps = 39/176 (22%)

Query: 249 MEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALH-QLGYTHRDLKPENFLIDSKG 307
           ME   GGD    +     + +  ARFY  ++  A++ LH + G  HRD+KPEN L+D +G
Sbjct: 1   MELASGGDLFDKIEPDVGVDSEVARFYFKQLINAIDHLHNRCGVAHRDIKPENLLLDERG 60

Query: 308 HIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYA 367
           ++KL DFGLAS                        +F+ +  D  +R+ +  R       
Sbjct: 61  NLKLADFGLAS------------------------QFKRK--DGSKRIMSDTR------- 87

Query: 368 HSTVGSPDYMALEVLEAKNYDF-TVDYWSLGCILFESLVGYTPFSGNSTNETYENL 422
               GS  YMA E++ +K+Y   + D WS G ++F  L G TP+   S +  +++ 
Sbjct: 88  ----GSLPYMAPEIVYSKSYYADSTDIWSCGVLVFVLLTGETPWDSPSDDSRFDDF 139

>CAGL0M03729g complement(420316..422901) similar to sp|P48562
           Saccharomyces cerevisiae YNL298w CLA4, start by
           similarity
          Length = 861

 Score = 78.6 bits (192), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 53/202 (26%), Positives = 88/202 (43%), Gaps = 48/202 (23%)

Query: 217 VLTERDILTTTRSEWLVKLLYAF-QDPQSLYLAMEFVPGGDFRTLLLNTKF-------LQ 268
           ++ E  ++  +R E +V  L A+ +    L++ ME++ GG    ++ N+         L 
Sbjct: 626 IVNEIMVMNDSRHENIVNFLEAYLKTEDDLWVVMEYMEGGSLTDIIENSPTNGSAYSPLS 685

Query: 269 APHARFYISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIES 328
            P   + + E    +  LH     HRD+K +N L+D+K  +K+TDFG  +          
Sbjct: 686 EPQIAYIVRETCKGLKFLHDKNIIHRDIKSDNVLLDTKARVKITDFGFCA---------- 735

Query: 329 MKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYD 388
                                        KL ++  + A + VG+P +MA EV++ K YD
Sbjct: 736 -----------------------------KLTDQRSKRA-TMVGTPYWMAPEVVKQKEYD 765

Query: 389 FTVDYWSLGCILFESLVGYTPF 410
             VD WSLG +  E L G  P+
Sbjct: 766 AKVDVWSLGIMAIEMLEGEPPY 787

>Kwal_26.8751
          Length = 848

 Score = 78.6 bits (192), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 62/223 (27%), Positives = 93/223 (41%), Gaps = 49/223 (21%)

Query: 245 LYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFLID 304
           +++A+E+ PG +    LL  K +         S++  AV   H +   HRDLK EN L+D
Sbjct: 103 VWMALEYCPGKELYEYLLAKKHIPLEECSELFSQIVGAVYYAHSMKCVHRDLKLENILLD 162

Query: 305 SKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEV 364
            KGH KLTDFG      +   +E++                                   
Sbjct: 163 KKGHAKLTDFGFTRECATKGILETI----------------------------------- 187

Query: 365 RYAHSTVGSPDYMALEVLEAKNYD-FTVDYWSLGCILFESLVGYTPFSGNSTNETYENLR 423
                  G+  YMA E++E K Y+ + +D WSLG IL+  + G  PF     +E  E   
Sbjct: 188 ------CGTTVYMAPELIERKPYEGYKIDTWSLGIILYTMIHGTMPF-----DEVDEVKT 236

Query: 424 NWKHVLQRPKCDNGRYAFSDRTWELITRLIADPINRLKSFEHV 466
            +K V   P  DN     + +  ELI++L+    N+  S   V
Sbjct: 237 KYKIVHYNPTYDNDYIDSNGK--ELISQLLEKDPNQRPSLTQV 277

>YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protein
           kinase involved in septin organization and cell cycle
           control [3114 bp, 1037 aa]
          Length = 1037

 Score = 78.6 bits (192), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 63/238 (26%), Positives = 101/238 (42%), Gaps = 59/238 (24%)

Query: 232 LVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGY 291
           ++ L   ++   +LYL +E+   G+   LL++   L    A     ++   ++  H LG 
Sbjct: 89  VLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCHALGI 148

Query: 292 THRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDD 351
            HRDLKPEN L+DS  +IK+ DFG+A+     + +E                        
Sbjct: 149 VHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLE------------------------ 184

Query: 352 RRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYD-FTVDYWSLGCILFESLVGYTPF 410
                            ++ GSP Y A E++    Y+ F  D WS G ILF  L G  PF
Sbjct: 185 -----------------TSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPF 227

Query: 411 SGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRT------WELITR-LIADPINRLK 461
                +E   N+R+    +Q+     G++   + T       +LI + L+ DP  R+K
Sbjct: 228 -----DEENGNVRDLLLKVQK-----GQFEMPNDTEISRDAQDLIGKILVVDPRQRIK 275

>Kwal_55.21545
          Length = 865

 Score = 78.2 bits (191), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 74/167 (44%), Gaps = 42/167 (25%)

Query: 245 LYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFLID 304
           L++ ME+  GG  RTLL   K  +  +    + E+  A+  +H+ G  HRD+K  N LI 
Sbjct: 91  LWVIMEYCAGGSLRTLLRPGKIGEQ-YIGVIMRELLTALMHIHKDGVIHRDIKAANVLIT 149

Query: 305 SKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEV 364
           + GHIKL DFG+A+      ++   KIR Q +                            
Sbjct: 150 NDGHIKLCDFGVAA------QLSQTKIRRQTM---------------------------- 175

Query: 365 RYAHSTVGSPDYMALEV-LEAKNYDFTVDYWSLGCILFESLVGYTPF 410
                  G+P +MA EV +E   YD  VD WSLG   +E   G  P+
Sbjct: 176 ------AGTPYWMAPEVIMEGVYYDTKVDIWSLGITAYEIATGNPPY 216

>CAGL0M02519g complement(290723..292993) highly similar to tr|Q03002
           Saccharomyces cerevisiae YPL141c or sp|Q01919
           Saccharomyces cerevisiae YOR233w KIN4, hypothetical
           start
          Length = 756

 Score = 77.8 bits (190), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 57/204 (27%), Positives = 91/204 (44%), Gaps = 43/204 (21%)

Query: 232 LVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGY 291
           +VKL    Q+ + + + +E+  GG+F   +   + L+  HA    S++  AV+ +H  G 
Sbjct: 129 IVKLEEVLQNSKYIGIVLEYAAGGEFYKFIQRKRRLKENHACRLFSQLISAVHYIHSKGL 188

Query: 292 THRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDD 351
            HRDLK EN L+D++ ++ +TDFG  +                     EF   R+  M  
Sbjct: 189 VHRDLKLENLLLDNEENLIITDFGFVN---------------------EF--LRQNGM-- 223

Query: 352 RRRMYNKLREEEVRYAHSTVGSPDYMALE-VLEAKNYDF-TVDYWSLGCILFESLVGYTP 409
                            ++ GSP Y A E V+  + YD    D WS G ILF  L GY P
Sbjct: 224 ---------------MKTSCGSPCYAAPELVVSNRPYDARKADTWSCGIILFAMLAGYLP 268

Query: 410 FSGNSTNETYENL-RNWKHVLQRP 432
           +  +  N    ++ R + ++L  P
Sbjct: 269 WDDDPKNPDGHDISRLYNYILNTP 292

>KLLA0B13112g complement(1146006..1148198) similar to sp|P23561
           Saccharomyces cerevisiae YLR362w STE11 ser/thr protein
           kinase of the MEKK family, start by similarity
          Length = 730

 Score = 77.8 bits (190), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 50/196 (25%), Positives = 83/196 (42%), Gaps = 37/196 (18%)

Query: 215 DHVLTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARF 274
           D +  E +IL     E +V    + Q+  +L + +E+VPGG   ++L N      P  + 
Sbjct: 513 DALQHEMNILKELHHENIVTYYGSSQEGGNLNIFLEYVPGGSVSSMLNNYGPFDEPLVKN 572

Query: 275 YISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQ 334
           +  ++   +  LH+    HRD+K  N LID KG +K+TDFG++     + + ++ +  LQ
Sbjct: 573 FTRQILIGLAYLHKRNIIHRDIKGANILIDIKGGVKITDFGISKKLSPLNKQQNKRASLQ 632

Query: 335 EVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYW 394
                                                GS  +MA EV++        D W
Sbjct: 633 -------------------------------------GSVYWMAPEVVKQVVTTEKADIW 655

Query: 395 SLGCILFESLVGYTPF 410
           S+GC++ E   G  PF
Sbjct: 656 SVGCVIVEMFTGKHPF 671

>CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 893

 Score = 77.8 bits (190), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 77/181 (42%), Gaps = 42/181 (23%)

Query: 231 WLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLG 290
           ++ KL         +++A+E+ PG +    LL+   L         +++  AV+  H L 
Sbjct: 94  YITKLYEVIVTETKVWMALEYCPGKELYDHLLSKSRLPTLECAELFAQITGAVHYAHTLN 153

Query: 291 YTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMD 350
             HRDLK EN L+D  G+ KLTDFG    +++   +E++                     
Sbjct: 154 CVHRDLKLENVLLDKNGNAKLTDFGFTRESMTKAVLETV--------------------- 192

Query: 351 DRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYD-FTVDYWSLGCILFESLVGYTP 409
                                G+  YMA E+++ K YD F VD WSLG IL+  L G  P
Sbjct: 193 --------------------CGTTVYMAPEMIQHKPYDGFKVDIWSLGVILYTLLCGCLP 232

Query: 410 F 410
           F
Sbjct: 233 F 233

>KLLA0F01276g complement(120001..121560) similar to sp|P38147
           Saccharomyces cerevisiae YBR274w CHK1 regulats
           inhibitory Cdk phosphorylation of PDS1, start by
           similarity
          Length = 519

 Score = 75.9 bits (185), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 56/182 (30%), Positives = 81/182 (44%), Gaps = 42/182 (23%)

Query: 245 LYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQ-LGYTHRDLKPENFLI 303
           L++AME   GGD    +     + +  A+FY  ++  A++ LH   G  HRD+KPEN L+
Sbjct: 91  LWIAMELAEGGDLFDKIEPDIGVDSEVAQFYYKQLIKAISYLHDTCGVAHRDIKPENILL 150

Query: 304 DSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEE 363
           D  G++KL DFGLAS                                       K ++  
Sbjct: 151 DKDGNLKLADFGLAS-------------------------------------LFKRKDGS 173

Query: 364 VRYAHSTVGSPDYMALEVLEAKNY--DFTVDYWSLGCILFESLVGYTPFS-GNSTNETYE 420
            R +    GS  YMA E++    Y  D T D WS+G +LF  L G TP+   +  +ET+ 
Sbjct: 174 KRISRDQRGSLPYMAPEIIYCDGYYADMT-DIWSIGVLLFVLLTGETPWELPHEDDETFR 232

Query: 421 NL 422
           N 
Sbjct: 233 NF 234

>AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH]
           (1769897..1771219) [1323 bp, 440 aa]
          Length = 440

 Score = 75.1 bits (183), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 71/277 (25%), Positives = 114/277 (41%), Gaps = 58/277 (20%)

Query: 212 EGTDHVLTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNT--KFLQA 269
           E  D +  E   L+  RS ++     AF    S+++ ME+  GG    LL  T    +  
Sbjct: 58  EPIDLLAQEIFFLSELRSPYITNYKTAFLVDVSMWIVMEYCGGGSCAELLKYTPEHKVTE 117

Query: 270 PHARFYISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESM 329
               F +SE+   ++ LH     HRD+K  N L+   GH+KL DFG++            
Sbjct: 118 EQCAFIVSEVLIGLDYLHSQRKIHRDIKSANILLTDNGHVKLGDFGVSG----------- 166

Query: 330 KIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLE--AKNY 387
                            + M  R+R              + VG+P +MA EV++   + Y
Sbjct: 167 -----------------QMMVTRKR-------------DTFVGTPFWMAPEVIDRNKQGY 196

Query: 388 DFTVDYWSLGCILFESLVGYTPFSGNSTNETYENLRNWKHVLQR--PKCDNGRYAFSDRT 445
           +   D WSLG  + E L+G+ P       + Y+ ++    + +R  PK D     FS   
Sbjct: 197 NEMADIWSLGITVIELLMGHPPL------DKYDAMKALMAIPKRDPPKLDK---RFSSHA 247

Query: 446 WELITR-LIADPINRLKSFEHVKRMRYFSEIDFNTLR 481
            + + + LI DP  R  + E +K  R+   +    LR
Sbjct: 248 RDFVAQCLIKDPSQRPTAAELLKH-RFVKRVRLYNLR 283

>Kwal_55.20326
          Length = 750

 Score = 75.9 bits (185), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 49/196 (25%), Positives = 85/196 (43%), Gaps = 37/196 (18%)

Query: 215 DHVLTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARF 274
           D +  E  +L   + E +V    + Q+  +L + +E+VPGG   ++L +    + P  R 
Sbjct: 532 DALQHEMGLLKELQHENIVTYYGSSQEGGNLNIFLEYVPGGSVSSMLNSYGPFEEPLIRN 591

Query: 275 YISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQ 334
           +  ++   ++ LH+    HRD+K  N LID KG +K+TDFG++     + + ++ +  LQ
Sbjct: 592 FTRQILIGLSYLHRKDIIHRDIKGANILIDIKGCVKITDFGISKKLSPLNQQQNKRASLQ 651

Query: 335 EVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYW 394
                                                GS  +MA EV++        D W
Sbjct: 652 -------------------------------------GSVYWMAPEVVKQVVTTKKADIW 674

Query: 395 SLGCILFESLVGYTPF 410
           S+GC++ E   G  PF
Sbjct: 675 SVGCVIIEMFTGKHPF 690

>AEL185C [2321] [Homologous to ScYBR274W (CHK1) - SH]
           (291129..292676) [1548 bp, 515 aa]
          Length = 515

 Score = 74.7 bits (182), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 61/209 (29%), Positives = 94/209 (44%), Gaps = 43/209 (20%)

Query: 214 TDHVLTERDILTTTRSEW---LVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAP 270
           TD  LT R+++  TR      +V++L      + L++AME   GGD    +     + + 
Sbjct: 58  TDEDLT-REVVLQTRCAGHRHVVRVLDCNVSREYLWIAMELADGGDLFDKIEPDVGVDSE 116

Query: 271 HARFYISEMFCAVNALHQ-LGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESM 329
            ARFY  ++  A+  LH+  G  HRD+KPEN L+D  G++K+ DFGLA+     +    +
Sbjct: 117 VARFYYQQLVRALTHLHEACGVAHRDIKPENMLLDRAGNLKVADFGLATRFRRRDGTRRL 176

Query: 330 KIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDF 389
                                DRR                  G+  Y+A EV+  + Y  
Sbjct: 177 A-------------------RDRR------------------GTLPYLAPEVVGERAYHA 199

Query: 390 -TVDYWSLGCILFESLVGYTPFSGNSTNE 417
            T D WS G ++F  L G TP+S  S ++
Sbjct: 200 DTADIWSAGVLVFVLLTGETPWSEPSVDD 228

>YOR233W (KIN4) [5024] chr15 (775846..778248) Serine/threonine
           protein kinase related to Kin1p and Kin2p, catalytic
           domain is highly related to Snf1p [2403 bp, 800 aa]
          Length = 800

 Score = 75.1 bits (183), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 89/204 (43%), Gaps = 43/204 (21%)

Query: 232 LVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGY 291
           ++ L    Q+ + + + +EFV GG+F   +   + L+   A    +++   VN +H  G 
Sbjct: 112 IIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRKRRLKESSACRLFAQLISGVNYMHYKGL 171

Query: 292 THRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDD 351
            HRDLK EN L+D   ++ +TDFG  +                     EF E  E     
Sbjct: 172 VHRDLKLENLLLDKHENLVITDFGFVN---------------------EFFEDNE----- 205

Query: 352 RRRMYNKLREEEVRYAHSTVGSPDYMALE-VLEAKNYDF-TVDYWSLGCILFESLVGYTP 409
                            ++ GSP Y A E V+  K Y+    D WS G IL+  L GY P
Sbjct: 206 --------------LMKTSCGSPCYAAPELVVSTKAYEARKADVWSCGVILYAMLAGYLP 251

Query: 410 FSGNSTNETYENL-RNWKHVLQRP 432
           +  +  N T +++ R +K++ Q P
Sbjct: 252 WDDDHENPTGDDIARLYKYITQTP 275

>YOL113W (SKM1) [4709] chr15 (104325..106292) Serine/threonine
           protein kinase with similarity to Ste20p and Cla4p [1968
           bp, 655 aa]
          Length = 655

 Score = 74.7 bits (182), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 54/204 (26%), Positives = 88/204 (43%), Gaps = 50/204 (24%)

Query: 217 VLTERDILTTTRSEWLVKLLYAFQ-DPQSLYLAMEFVPGGDFRTLL-----LNTKFLQAP 270
           ++ E  ++  +R E +V  L A+  D + L++ ME++ GG    +L      NT    +P
Sbjct: 419 IMNELLVMNDSRQENIVNFLEAYIIDDEELWVIMEYMEGGCLTDILDAVARSNTGEHSSP 478

Query: 271 ----HARFYISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERI 326
                  + + E    +  LH     HRD+K +N L++S+G +K+TDFG           
Sbjct: 479 LNENQMAYIVKETCQGLKFLHNKKIIHRDIKSDNILLNSQGLVKITDFGFC--------- 529

Query: 327 ESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKN 386
                       +E  E R +                     + VG+P +MA E++  K 
Sbjct: 530 ------------VELTEKRSKRA-------------------TMVGTPYWMAPEIVNQKG 558

Query: 387 YDFTVDYWSLGCILFESLVGYTPF 410
           YD  VD WSLG +L E + G  P+
Sbjct: 559 YDEKVDVWSLGIMLIEMIEGEPPY 582

>YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase
            kinase kinase (MAPKKK) with strong similarity to Ssk2p,
            participates in the high-osmolarity signal transduction
            pathway [3996 bp, 1331 aa]
          Length = 1331

 Score = 75.1 bits (183), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 74/172 (43%), Gaps = 28/172 (16%)

Query: 249  MEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFLIDSKGH 308
            ME+  GG   +LL + +       + Y  E+   +  LHQ G  HRD+KPEN L+D  G 
Sbjct: 1112 MEYCEGGSLASLLDHGRIEDEMVTQVYTFELLEGLAYLHQSGVVHRDIKPENILLDFNGI 1171

Query: 309  IKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAH 368
            IK  DFG A   V          R + V+N    +F                  E +  +
Sbjct: 1172 IKYVDFGTARTVVGS--------RTRTVRNAAVQDF----------------GVETKSLN 1207

Query: 369  STVGSPDYMALEVLEAKNYDFTV---DYWSLGCILFESLVGYTPFSGNSTNE 417
              +G+P YMA E +        +   D W+LGC++ E   G  P+S N  NE
Sbjct: 1208 EMMGTPMYMAPETISGSAVKGKLGADDVWALGCVVLEMATGRRPWS-NLDNE 1258

>ABL011C [581] [Homologous to ScYLR362W (STE11) - SH]
           (378259..380364) [2106 bp, 701 aa]
          Length = 701

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 82/192 (42%), Gaps = 37/192 (19%)

Query: 219 TERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISE 278
           T+ ++L     E +V    + Q+  +L + +E+VPGG   ++L +    + P  + +  +
Sbjct: 486 TKMNLLKELHHENIVTYYGSSQEGGNLNIFLEYVPGGSVSSMLNSYGPFEEPLVKNFTRQ 545

Query: 279 MFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKN 338
               +  LH+    HRD+K  N LID KG +K+TDFG++     + + ++ +  LQ    
Sbjct: 546 TLVGLTYLHRKNIIHRDIKGANLLIDIKGSVKITDFGISKKLSPLNKKQNKRASLQ---- 601

Query: 339 LEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGC 398
                                            GS  +MA EV++        D WS+GC
Sbjct: 602 ---------------------------------GSVYWMAPEVVKQVVTTEKADIWSVGC 628

Query: 399 ILFESLVGYTPF 410
           ++ E   G  PF
Sbjct: 629 VVVEMFTGKHPF 640

>YLR362W (STE11) [3744] chr12 (849865..852018) MAP kinase kinase
           kinase (MAPKKK or MEKK), component of pheromone
           response, filamentous growth, high-osmolarity sensing,
           and STE vegetative growth pathways [2154 bp, 717 aa]
          Length = 717

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 49/197 (24%), Positives = 81/197 (41%), Gaps = 37/197 (18%)

Query: 214 TDHVLTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHAR 273
            D +  E ++L     E +V    A Q+  +L + +E+VPGG   ++L N    +     
Sbjct: 498 VDALQHEMNLLKELHHENIVTYYGASQEGGNLNIFLEYVPGGSVSSMLNNYGPFEESLIT 557

Query: 274 FYISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRL 333
            +  ++   V  LH+    HRD+K  N LID KG +K+TDFG++     + + ++ +  L
Sbjct: 558 NFTRQILIGVAYLHKKNIIHRDIKGANILIDIKGCVKITDFGISKKLSPLNKKQNKRASL 617

Query: 334 QEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDY 393
           Q                                     GS  +M+ EV++        D 
Sbjct: 618 Q-------------------------------------GSVFWMSPEVVKQTATTAKADI 640

Query: 394 WSLGCILFESLVGYTPF 410
           WS GC++ E   G  PF
Sbjct: 641 WSTGCVVIEMFTGKHPF 657

>Scas_477.5
          Length = 703

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 81/197 (41%), Gaps = 38/197 (19%)

Query: 214 TDHVLTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHAR 273
            D +  E ++L     E +V    + Q+  +L + +E+VPGG   ++L N    +     
Sbjct: 485 VDALQHEMNLLKELHHENIVTYYGSSQEGPNLNIFLEYVPGGSVSSMLNNYGPFEESLIV 544

Query: 274 FYISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRL 333
            +I ++   V  LH     HRD+K  N LID+KG +K+TDFG++                
Sbjct: 545 NFIRQVLIGVAYLHNKNIIHRDIKGANILIDTKGCVKITDFGISK--------------- 589

Query: 334 QEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDY 393
                    +    S  D+R               S  GS  +MA EV++        D 
Sbjct: 590 ---------KLSPLSKQDKRA--------------SLQGSVYWMAPEVVKQTATTEKADI 626

Query: 394 WSLGCILFESLVGYTPF 410
           WS GC++ E   G  PF
Sbjct: 627 WSTGCVVIEMFTGKHPF 643

>ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023)
           [2556 bp, 851 aa]
          Length = 851

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 76/181 (41%), Gaps = 42/181 (23%)

Query: 231 WLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLG 290
           ++ KL         +++A+E+ PG +    LL  + +     R   +++  AV   H L 
Sbjct: 89  FITKLYEVIVTETRVWMALEYCPGNELYDYLLLKQRIPLDETRRLFAQIVSAVFYAHSLQ 148

Query: 291 YTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMD 350
             HRDLK EN L+D  G+  LTDFG      +  ++E++                     
Sbjct: 149 CVHRDLKLENILLDKNGYAMLTDFGFTRECATKTQLETV--------------------- 187

Query: 351 DRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYD-FTVDYWSLGCILFESLVGYTP 409
                                G+  YMA E+++ + YD + VD WSLG IL+  L GY P
Sbjct: 188 --------------------CGTTVYMAPELIKREAYDGYKVDTWSLGIILYTMLHGYMP 227

Query: 410 F 410
           F
Sbjct: 228 F 228

>KLLA0C04191g 384198..386591 weakly similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15 protein kinase of
           the MAP kinase kinase kinase family, hypothetical start
          Length = 797

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 61/230 (26%), Positives = 94/230 (40%), Gaps = 48/230 (20%)

Query: 189 ARKKDTKEICAXXXXXXXXXXXXEGTDHVLTERDILTTTRSEWLVKLLYAFQDPQSLYLA 248
           A K+ T + CA            E  +H+L E D+L   R + +V+     Q    LY+ 
Sbjct: 27  AVKRGTNKPCAIKQIEFEDES--ELNEHML-EIDLLKNLRHQNIVEYRGFIQKAHELYII 83

Query: 249 MEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFLIDSKGH 308
           +E+   G  R +L +   L+      Y+++    +  LH+ G  HRD+K  N L+  +G 
Sbjct: 84  LEYCARGSLRDILKHGPLLEDDTVN-YVTQTLYGLQYLHEQGVIHRDIKAANLLLTEEGI 142

Query: 309 IKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAH 368
           +KL DFG+++      RI                                      R A 
Sbjct: 143 VKLADFGVST------RIN-------------------------------------RMAM 159

Query: 369 STVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGNSTNET 418
           +  GSP++MA EV+  +      D WSLG  + E L G  PF  N  NE+
Sbjct: 160 TYAGSPNWMAPEVMTGQGASTVSDIWSLGATVVELLTGNPPFH-NLVNES 208

>YGL179C (TOS3) [1812] chr7 complement(163413..165095)
           Serine/threonine protein kinase with similarity to Elm1p
           and Kin82p [1683 bp, 560 aa]
          Length = 560

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 57/216 (26%), Positives = 95/216 (43%), Gaps = 40/216 (18%)

Query: 220 ERDILTTTRSEWLVKLLYAFQDPQS--LYLAMEFVPGGDFRTLLLNTKFLQA-------- 269
           E +++     E +V+L     DP+S  +YL +E+   G  +    N   ++A        
Sbjct: 104 EIEVMKRCHHENVVELYEILNDPESTKVYLVLEYCSRGPVKWCPENKMEIKAVGPSILTF 163

Query: 270 PHARFYISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSME-RIES 328
             +R  + ++   +  LH  G THRD+KP N LI S G +K++DFG+A  T +    I+S
Sbjct: 164 QQSRKVVLDVVSGLEYLHSQGITHRDIKPSNLLISSNGTVKISDFGVAMSTATGSTNIQS 223

Query: 329 MKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYD 388
              +L + + L  P F             +L   E  Y+ S+                  
Sbjct: 224 SHEQLLKSRALGTPAF----------FAPELCSTEKEYSCSSA----------------- 256

Query: 389 FTVDYWSLGCILFESLVGYTPFSGNSTNETYENLRN 424
             +D WSLG  ++  L G  PF+ NS  E ++++ N
Sbjct: 257 --IDIWSLGVTIYCLLFGKLPFNANSGLELFDSIIN 290

>CAGL0B02739g complement(262590..264620) similar to sp|P23561
           Saccharomyces cerevisiae YLR362w STE11 ser/thr protein
           kinase of the MEKK family, hypothetical start
          Length = 676

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 48/196 (24%), Positives = 81/196 (41%), Gaps = 36/196 (18%)

Query: 215 DHVLTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARF 274
           D +  E  +L   + E +V    + Q+  +L + +E+VPGG   ++L N    + P    
Sbjct: 457 DALQHEMSLLKELQHENIVTYYGSSQEGGNLNIFLEYVPGGSVSSMLSNYGPFEEPLIVN 516

Query: 275 YISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQ 334
           +  ++   V  LH+    HRD+K  N LID KG +K+TDFG++                 
Sbjct: 517 FTRQILIGVAYLHRKNIIHRDIKGANILIDIKGCVKITDFGISK---------------- 560

Query: 335 EVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYW 394
                +     + + D R  +                GS  +M+ EV++        D W
Sbjct: 561 -----KLSPLNQENQDKRTSLQ---------------GSVYWMSPEVVKQTATTSKADIW 600

Query: 395 SLGCILFESLVGYTPF 410
           S GC++ E   G  P+
Sbjct: 601 STGCVVIEMFTGKHPY 616

>CAGL0M08910g complement(887703..889541) highly similar to sp|Q00372
           Saccharomyces cerevisiae YDR477w carbon catabolite
           derepressing ser/thr protein kinase, hypothetical start
          Length = 612

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 66/249 (26%), Positives = 102/249 (40%), Gaps = 54/249 (21%)

Query: 220 ERDI--LTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYIS 277
           ER+I  L   R   ++KL    +    + + +E+  G +    ++    +    AR +  
Sbjct: 85  EREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRNKMSEQEARRFFQ 143

Query: 278 EMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVK 337
           ++  AV   H+    HRDLKPEN L+D   ++K+ DFGL++                   
Sbjct: 144 QIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSN------------------- 184

Query: 338 NLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFT-VDYWSL 396
                      M D              +  ++ GSP+Y A EV+  K Y    VD WS 
Sbjct: 185 ----------IMTDG------------NFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSC 222

Query: 397 GCILFESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITR-LIAD 455
           G IL+  L    PF   S    ++N+ N  + L  PK        S    +LI R LI +
Sbjct: 223 GVILYVMLCRRLPFDDESIPVLFKNISNGVYTL--PKF------LSPGASDLIKRMLIVN 274

Query: 456 PINRLKSFE 464
           P+NR+   E
Sbjct: 275 PLNRISIHE 283

>Scas_618.15
          Length = 620

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 52/230 (22%), Positives = 90/230 (39%), Gaps = 34/230 (14%)

Query: 246 YLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFLIDS 305
           Y+  E++ GG+    ++   +      R  I ++  AV  LH +G  HRD+KPEN L + 
Sbjct: 253 YIVQEYLHGGEIYDQIVRLTYFSEDLTRHVIRQLAHAVKHLHSMGIIHRDIKPENLLFEP 312

Query: 306 KGHIKLTDFGLASGTVSMERIESMKIR-------LQEVKNLEFPEFRERSMDDRRRMYNK 358
             HI  T   L        +++    R       +  VK  +F   ++ S +        
Sbjct: 313 IQHIPSTHVKLRKTDNPFTKVDEGMFRPAIGGGGIGAVKLTDFGLSKQLSTET------- 365

Query: 359 LREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGNSTNET 418
                    ++  G+  Y A E++    YD  +D W +GC+L+  L G+ PF  +     
Sbjct: 366 --------TNTPCGTISYAAPELIRNHQYDNKIDLWGIGCVLYTLLCGFPPFYADQHKSV 417

Query: 419 YENLRNWKHVLQRPKCDNGRYAFSDRTWELITRLIADPINRLKSFEHVKR 468
              +R            +G Y F    W+ I+    + +  L   +  KR
Sbjct: 418 TRKIR------------HGEYHFLSPWWDEISSGAKNCVKHLLEVDVSKR 455

>CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces
           cerevisiae YDL101c DUN1 protein kinase, start by
           similarity
          Length = 506

 Score = 72.0 bits (175), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 70/297 (23%), Positives = 105/297 (35%), Gaps = 71/297 (23%)

Query: 189 ARKKDTKEICAXXXXXXXXXXXXEGTDHVLTERDILTTTRSEWLVKLLYAFQDPQSL--- 245
           A+ K T E  A            +       E  IL       +V LL +F +P S    
Sbjct: 210 AKNKTTGETVAVKIFHPQQNDDQKKNKQFREETTILMKIHHPNIVNLLDSFVEPISKTQI 269

Query: 246 --YLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFLI 303
             YL +E +  G+    ++    L    ++    ++   +  LH     HRD+KPEN L+
Sbjct: 270 QKYLVLEKIDDGELFDRIVKKTSLPQEESKAIFKQILTGLKYLHSQNIIHRDIKPENILL 329

Query: 304 DSKG-------------------HIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEF 344
           + +                     +K+ DFGLA  T                        
Sbjct: 330 NIRRRQSPDERQLGPWDEDEIDIQVKIADFGLAKFT------------------------ 365

Query: 345 RERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESL 404
                             E+++ ++  G+P Y+A EVL  K Y   VD WS G IL+  L
Sbjct: 366 -----------------GEMQFTNTLCGTPSYVAPEVLVKKGYTSKVDLWSAGVILYVCL 408

Query: 405 VGYTPFSGN-STNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITRLIA-DPINR 459
            G+ PFS         E + + K+    P  D       D    LI+ L+  DP NR
Sbjct: 409 CGFPPFSDQLGPPSLKEQIMSAKYAFYSPYWDE----IDDAALHLISNLLVLDPENR 461

>AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..90211)
           [1419 bp, 472 aa]
          Length = 472

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 65/273 (23%), Positives = 99/273 (36%), Gaps = 76/273 (27%)

Query: 220 ERDILTTTRSEWLVKLLYAFQDPQS-----LYLAMEFVPGGDFRTLLLNTKFLQAPHARF 274
           E  IL     E +VKLL  F +P S      YL +E +  G+    ++    L     R 
Sbjct: 203 ETKILMGLNHENIVKLLERFVEPLSKSQVQTYLVLEKIQDGELFDKIVRKTKLHQDETRA 262

Query: 275 YISEMFCAVNALHQLGYTHRDLKPENFLIDSKGH-------------------IKLTDFG 315
              ++   +  LH     HRD+KPEN L+  +                     +K+ DFG
Sbjct: 263 LFKQILAGLKYLHDRNIIHRDIKPENILLSIRRRTSPDQVQLGPWDEDELDITVKIADFG 322

Query: 316 LASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPD 375
           LA  T                                          E+++  +  G+P 
Sbjct: 323 LAKFT-----------------------------------------GEMQFTTTLCGTPS 341

Query: 376 YMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCD 435
           Y+A EVL    Y   VD WS G +L+  L G+ PFS      + +     + +LQ     
Sbjct: 342 YVAAEVLTKTGYTSKVDLWSAGVLLYVCLCGFPPFSDQLAPPSMK-----EQILQ----- 391

Query: 436 NGRYAFSDRTWELITRLIADPINRLKSFEHVKR 468
            G++AF    W+ I   +   I+ L   +  KR
Sbjct: 392 -GKFAFYSPYWDEIDDSVLHLISNLLVVDPAKR 423

>Scas_660.28
          Length = 623

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 66/257 (25%), Positives = 106/257 (41%), Gaps = 55/257 (21%)

Query: 220 ERDI--LTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYIS 277
           ER+I  L   R   ++KL    +    + + ME+  G +    ++    +    AR +  
Sbjct: 92  EREISYLRLLRHPHIIKLYDVIKSKDEIIMVMEYA-GNELFDYIVQRDKMSEDEARRFFQ 150

Query: 278 EMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVK 337
           ++  AV   H+    HRDLKPEN L+D   ++K+ DFGL++                   
Sbjct: 151 QIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSN------------------- 191

Query: 338 NLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFT-VDYWSL 396
                      M D              +  ++ GSP+Y A EV+  K Y    VD WS 
Sbjct: 192 ----------IMTDG------------NFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSC 229

Query: 397 GCILFESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITR-LIAD 455
           G IL+  L    PF   S    ++N+ N  + +  PK        S     LI + LI +
Sbjct: 230 GVILYVMLCRRLPFDDESIPVLFKNINNGVYTI--PKF------LSQGASTLIKKMLIVN 281

Query: 456 PINRLKSFEHVKRMRYF 472
           P+NR+ S + + +  +F
Sbjct: 282 PLNRI-SIQEIMQDEWF 297

>CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces
           cerevisiae YHR102w NRK1 ser/thr protein kinase, start by
           similarity
          Length = 1072

 Score = 72.4 bits (176), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 48/168 (28%), Positives = 72/168 (42%), Gaps = 42/168 (25%)

Query: 244 SLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFLI 303
           SL++ ME+  GG  R+LL   K  +  +    + E+  A+  +H+    HRD+K  N LI
Sbjct: 87  SLWIIMEYCAGGSLRSLLRPGKIDEK-YIGVIMRELLVALKVIHKDNVIHRDIKAANVLI 145

Query: 304 DSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEE 363
            ++G +KL DFG+A+                    L     R ++M              
Sbjct: 146 TNEGQVKLCDFGVAA-------------------QLNQTSLRRQTM-------------- 172

Query: 364 VRYAHSTVGSPDYMALEV-LEAKNYDFTVDYWSLGCILFESLVGYTPF 410
                   G+P +MA EV +E   YD  VD WSLG   +E   G  P+
Sbjct: 173 -------AGTPYWMAPEVIMEGVYYDTKVDIWSLGITAYEIATGNPPY 213

>YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kinase
           required for induction of Rnr3p and DNA repair genes
           after DNA damage [1542 bp, 513 aa]
          Length = 513

 Score = 71.2 bits (173), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 60/254 (23%), Positives = 97/254 (38%), Gaps = 76/254 (29%)

Query: 220 ERDILTTTRSEWLVKLLYAFQDPQSL-----YLAMEFVPGGDFRTLLLNTKFLQAPHARF 274
           E +IL   +   +V LL +F +P S      YL +E +  G+    ++    L+   ++ 
Sbjct: 248 ETNILMRVQHPNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFERIVRKTCLRQDESKA 307

Query: 275 YISEMFCAVNALHQLGYTHRDLKPENFLIDSKG-------------------HIKLTDFG 315
              ++   +  LH+    HRD+KPEN L++                       +K+ DFG
Sbjct: 308 LFKQLLTGLKYLHEQNIIHRDIKPENILLNITRRENPSQVQLGPWDEDEIDIQVKIADFG 367

Query: 316 LASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPD 375
           LA  T                                          E+++ ++  G+P 
Sbjct: 368 LAKFT-----------------------------------------GEMQFTNTLCGTPS 386

Query: 376 YMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCD 435
           Y+A EVL  K Y   VD WS G IL+  L G+ PFS      + +     + +LQ     
Sbjct: 387 YVAPEVLTKKGYTSKVDLWSAGVILYVCLCGFPPFSDQLGPPSLK-----EQILQ----- 436

Query: 436 NGRYAFSDRTWELI 449
             +YAF    W+ I
Sbjct: 437 -AKYAFYSPYWDKI 449

>YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine
           protein kinase essential for derepression of
           glucose-repressed genes, acts in concert with Snf4p,
           involved in aging [1902 bp, 633 aa]
          Length = 633

 Score = 71.6 bits (174), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 66/249 (26%), Positives = 101/249 (40%), Gaps = 54/249 (21%)

Query: 220 ERDI--LTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYIS 277
           ER+I  L   R   ++KL    +    + + +E+  G +    ++    +    AR +  
Sbjct: 101 EREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEQEARRFFQ 159

Query: 278 EMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVK 337
           ++  AV   H+    HRDLKPEN L+D   ++K+ DFGL++                   
Sbjct: 160 QIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSN------------------- 200

Query: 338 NLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFT-VDYWSL 396
                      M D              +  ++ GSP+Y A EV+  K Y    VD WS 
Sbjct: 201 ----------IMTDG------------NFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSC 238

Query: 397 GCILFESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITR-LIAD 455
           G IL+  L    PF   S    ++N+ N  + L  PK        S     LI R LI +
Sbjct: 239 GVILYVMLCRRLPFDDESIPVLFKNISNGVYTL--PKF------LSPGAAGLIKRMLIVN 290

Query: 456 PINRLKSFE 464
           P+NR+   E
Sbjct: 291 PLNRISIHE 299

>CAGL0C05005g complement(467626..470856) similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15, hypothetical
           start
          Length = 1076

 Score = 72.0 bits (175), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 48/194 (24%), Positives = 81/194 (41%), Gaps = 43/194 (22%)

Query: 217 VLTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYI 276
           +++E D+L       +VK     Q   +LY+ +E+   G  + L+   + +    A+ Y+
Sbjct: 64  IMSEIDLLKNLNHINIVKYHGFIQKQHNLYIILEYCAKGSLKNLISRNRPMSEHEAKPYV 123

Query: 277 SEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEV 336
            +    +N LH+ G  HRD+K  N L+DS+  +KL DFG+++                +V
Sbjct: 124 RQTLNGLNYLHEQGVIHRDIKAANILLDSENVVKLADFGVST----------------KV 167

Query: 337 KNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSL 396
            N                            A +  GS ++MA E++  +      D WSL
Sbjct: 168 NNT---------------------------AMTLAGSLNWMAPEIIGNRGASTLSDIWSL 200

Query: 397 GCILFESLVGYTPF 410
           G  + E L G  PF
Sbjct: 201 GATVVELLTGNPPF 214

>YNL298W (CLA4) [4314] chr14 (68913..71441) Serine/threonine protein
           kinase required for cytokinesis [2529 bp, 842 aa]
          Length = 842

 Score = 71.6 bits (174), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 86/202 (42%), Gaps = 48/202 (23%)

Query: 217 VLTERDILTTTRSEWLVKLLYAF-QDPQSLYLAMEFVPGGDFRTLLLNTKF-------LQ 268
           ++ E  ++  +R + +V  L A+ +    L++ MEF+ GG    ++ N+         L 
Sbjct: 607 IVNEILVMKDSRHKNIVNFLEAYLRTDDDLWVVMEFMEGGSLTDIIENSPTNDNSHSPLT 666

Query: 269 APHARFYISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIES 328
            P   + + E    +  LH     HRD+K +N L+D++  +K+TDFG             
Sbjct: 667 EPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTRARVKITDFG------------- 713

Query: 329 MKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYD 388
                          F  R  D R +              + VG+P +MA EV++ + YD
Sbjct: 714 ---------------FCARLTDKRSKRA------------TMVGTPYWMAPEVVKQREYD 746

Query: 389 FTVDYWSLGCILFESLVGYTPF 410
             +D WSLG +  E L G  P+
Sbjct: 747 EKIDVWSLGIMTIEMLEGEPPY 768

>KLLA0F12188g 1122745..1124385 similar to sp|P38623 Saccharomyces
           cerevisiae YLR248w RCK2 Ca/calmodulin-dependent ser/thr
           protein kinase, start by similarity
          Length = 546

 Score = 71.2 bits (173), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 61/255 (23%), Positives = 102/255 (40%), Gaps = 22/255 (8%)

Query: 214 TDHVLTERDILTTTRSEWLVKLLYAFQDPQSLY-LAMEFVPGGDFRTLLLNTKFLQAPHA 272
            + VL E  I     S   +     FQ+ +  Y +  E + GG+    ++   +     +
Sbjct: 186 AEQVLKEIAIHKIVSSGENIVSFIDFQESEKYYYIIQELLAGGEIFGEIVKYTYFSEDLS 245

Query: 273 RFYISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIR 332
           R  I ++  AV  +HQLG  HRD+KPEN L +    I      L S      +++    R
Sbjct: 246 RHVIRQLANAVKYMHQLGIVHRDIKPENLLFEPIDFIPNPKPKLRSSDDPSTKLDEGVFR 305

Query: 333 LQEVKN----LEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYD 388
                     ++  +F          +  ++ +   +    TVG   Y A EV++ + Y 
Sbjct: 306 PGIGGGGIGVVKLADFG---------LSKQIYQTNTKTPCGTVG---YTAPEVVKDERYS 353

Query: 389 FTVDYWSLGCILFESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWEL 448
             VD W +GC+L+  L G+ PF     +   E +   ++   RP  D      SD     
Sbjct: 354 MQVDMWGVGCVLYTVLCGFPPFFDEKIDVLTEKISRGEYTFLRPWWDQ----ISDGAKNC 409

Query: 449 ITRLI-ADPINRLKS 462
           + +L+  DP  R  S
Sbjct: 410 VRKLLEVDPAKRYTS 424

>AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C
            (SSK2) - SH] (1120017..1124468) [4452 bp, 1483 aa]
          Length = 1483

 Score = 72.0 bits (175), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 46/165 (27%), Positives = 67/165 (40%), Gaps = 33/165 (20%)

Query: 249  MEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFLIDSKGH 308
            ME+  GG   +LL + +       + Y  +M   +  LH+ G  HRD+KPEN L+D  G 
Sbjct: 1269 MEYCEGGSLASLLAHGRIEDEMVTQVYSLQMLEGLAYLHESGVDHRDIKPENILLDFNGI 1328

Query: 309  IKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAH 368
            IK  DFG A    S                                   KL  E+     
Sbjct: 1329 IKYVDFGAAKVLAS-------------------------------NGSKKLNLEQHMEGE 1357

Query: 369  STVGSPDYMALEVLEAKNYD--FTVDYWSLGCILFESLVGYTPFS 411
              +G+P YM+ E +    Y    + D WSLGC++ E + G  P++
Sbjct: 1358 KMIGTPMYMSPEAISGTGYGKFGSDDIWSLGCVILEMVTGRRPWA 1402

>Kwal_47.18233
          Length = 598

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 69/249 (27%), Positives = 103/249 (41%), Gaps = 54/249 (21%)

Query: 220 ERDI--LTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYIS 277
           ER+I  L   R   ++KL    +    + + +E+  G +    ++    +    AR +  
Sbjct: 77  EREISYLRLLRHPHIIKLYDVVKSKDEIVMVIEYA-GNELFDYIVQRDKMSENEARRFFQ 135

Query: 278 EMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVK 337
           ++  AV   H+    HRDLKPEN L+D   ++K+ DFGL++                   
Sbjct: 136 QIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSN------------------- 176

Query: 338 NLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFT-VDYWSL 396
                      M D     N LR        ++ GSP+Y A EV+  K Y    VD WS 
Sbjct: 177 ----------IMTDG----NFLR--------TSCGSPNYAAPEVISGKLYAGPEVDVWSS 214

Query: 397 GCILFESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITR-LIAD 455
           G IL+  L    PF   S    ++N+ N  + L  PK        S     LI R LI +
Sbjct: 215 GVILYVMLCRRLPFDDESIPVLFKNISNGIYTL--PKF------LSPGAANLIKRMLIVN 266

Query: 456 PINRLKSFE 464
           P+NR+   E
Sbjct: 267 PLNRITIHE 275

>AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH]
           (1044971..1047679) [2709 bp, 902 aa]
          Length = 902

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 54/197 (27%), Positives = 79/197 (40%), Gaps = 45/197 (22%)

Query: 222 DILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFC 281
           D+L   + E +VK     Q    LY+ +E+   G  R L+   + L    A+ Y+ +   
Sbjct: 66  DLLKNLKHENIVKYHGFIQSSHELYILLEYCIRGSLRDLI-KKEALSEAKAKTYVRQTLR 124

Query: 282 AVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEF 341
            +  LH  G  HRD+K  N L+   G +KL DFG+++      R+ +M            
Sbjct: 125 GLQYLHDQGVIHRDIKAANLLLTENGVVKLADFGVST------RVNNM------------ 166

Query: 342 PEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILF 401
                                    A +  GSP++MA EV+  K      D WSLG  + 
Sbjct: 167 -------------------------AMTYAGSPNWMAPEVMLGKGASTVSDIWSLGATVV 201

Query: 402 ESLVGYTPFSGNSTNET 418
           E L G  PF  N  NE 
Sbjct: 202 ELLTGNPPFY-NLVNEA 217

>ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..27572)
           [1098 bp, 365 aa]
          Length = 365

 Score = 69.7 bits (169), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 74/176 (42%), Gaps = 34/176 (19%)

Query: 238 AFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDLK 297
           ++QD +++YL  E +     R +     FL   H +++  ++  A+ +LH     HRDLK
Sbjct: 83  SYQDFEAVYLVQELMETDLQRIISQPNSFLSDDHIQYFTYQILRALKSLHSAQVIHRDLK 142

Query: 298 PENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYN 357
           P N L++S   +KL DFGL+    S +R                                
Sbjct: 143 PSNLLLNSSCDLKLCDFGLSRCLASSDRS------------------------------- 171

Query: 358 KLREEEVRYAHSTVGSPDYMALEV-LEAKNYDFTVDYWSLGCILFESLVGYTPFSG 412
             RE  V +    V +  Y A E+ L  + Y   +D WS GCIL E + G   F G
Sbjct: 172 --RENMVGFMTEYVATRWYRAPEIMLSFQEYTTAMDIWSCGCILAEMISGKPLFPG 225

>Scas_648.17
          Length = 340

 Score = 69.7 bits (169), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 60/204 (29%), Positives = 88/204 (43%), Gaps = 47/204 (23%)

Query: 217 VLTERDILTT-TRSEWLVKLLYAFQDPQSLYLAMEF--VPGGDFRTLLLNTKFLQAPHAR 273
           +  E  ILT  T    +++LL   QDP S   A+ F  V   DFR L         P  +
Sbjct: 89  IYRELKILTNLTGGPNVIELLDIVQDPGSKIPALIFEEVKNMDFRQLYPT---FTLPDIQ 145

Query: 274 FYISEMFCAVNALHQLGYTHRDLKPENFLIDSKGH-IKLTDFGLASGTVSMERIESMKIR 332
           FY +++  A+N  H +G  HRD+KP+N +ID K   ++L D+GLA               
Sbjct: 146 FYFTQLLIALNYCHSMGIMHRDVKPQNVMIDPKERKLRLIDWGLA--------------- 190

Query: 333 LQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVD 392
                     EF    +D     YN      VR A      P+ +    +    YD+++D
Sbjct: 191 ----------EFYHPGVD-----YN------VRVASRYHKGPELL----VNLNQYDYSLD 225

Query: 393 YWSLGCILFESLVGYTPFSGNSTN 416
            WS+GC+L   +    PF   S+N
Sbjct: 226 LWSVGCMLAAIVFKREPFFKGSSN 249

>CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces
           cerevisiae YOR231w MKK1 ser/thr protein kinase or
           sp|P32491 Saccharomyces cerevisiae YPL140c MKK2, start
           by similarity
          Length = 467

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 53/189 (28%), Positives = 81/189 (42%), Gaps = 48/189 (25%)

Query: 228 RSEWLVKLLYAFQDPQ--SLYLAMEFVPGGDFRTL---LLNTKFLQAPHARFYISEMFC- 281
           +SE++V+    F D Q  S+Y+AME++ G     +   LL+     +      ISE    
Sbjct: 235 KSEYIVRYFGMFTDEQNSSIYIAMEYMGGKSLEAIYKELLSRGGRISEKVLGKISEAVLR 294

Query: 282 AVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEF 341
            ++ LH+    HRD+KP+N L++  G +KL DFG     VS E + S+            
Sbjct: 295 GLSYLHEKKVIHRDIKPQNILLNEDGQVKLCDFG-----VSGEAVNSL------------ 337

Query: 342 PEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILF 401
                                    A +  G+  YMA E ++ + Y  T D WSLG  + 
Sbjct: 338 -------------------------ATTFTGTSYYMAPERIQGQPYSVTCDVWSLGLTIL 372

Query: 402 ESLVGYTPF 410
           E   G+ PF
Sbjct: 373 EVAQGHFPF 381

>KLLA0E01584g 149713..150960 highly similar to sp|P39009
           Saccharomyces cerevisiae YDL101c DUN1 protein kinase,
           start by similarity
          Length = 415

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 69/298 (23%), Positives = 106/298 (35%), Gaps = 71/298 (23%)

Query: 189 ARKKDTKEICAXXXXXXXXXXXXEGTDHVLTERDILTTTRSEWLVKLLYAFQDPQS---- 244
           AR K+T E  A            + T     E  IL + +   +VKL+  F +P S    
Sbjct: 118 ARNKETGETVAVKIFHPQQNDDDKRTKKFTEETKILLSIQHPNIVKLIDRFVEPVSKTQI 177

Query: 245 -LYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFLI 303
             YL +E +  G+    ++    L+    +    ++   +  LH     HRD+KPEN L+
Sbjct: 178 QTYLVLEKINDGELFERIVRKNNLREDETKALFRQLLNGLKYLHSRNIIHRDIKPENILL 237

Query: 304 DSKG-------------------HIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEF 344
                                   +K+ DFGLA  T                        
Sbjct: 238 SISKRRSPEEIALGPWDDDELDIQVKIADFGLAKFT------------------------ 273

Query: 345 RERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESL 404
                             E+++ ++  G+P Y+A EVL    Y   VD WS G +L+  L
Sbjct: 274 -----------------GEMKFTNTLCGTPSYVAPEVLVKTGYTSRVDMWSAGVLLYVCL 316

Query: 405 VGYTPFSGN-STNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITR-LIADPINRL 460
            G+ PFS   +     E +   K     P  DN      D    LI+  L+ +P +R 
Sbjct: 317 CGFPPFSEQLAPPSMKEQILQGKFAFYSPYWDN----IDDSVLHLISNLLVVNPASRF 370

>YLR096W (KIN2) [3511] chr12 (332591..336034) Serine/threonine
           protein kinase, related to Kin1p and S. pombe KIN1 [3444
           bp, 1147 aa]
          Length = 1147

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 58/217 (26%), Positives = 92/217 (42%), Gaps = 51/217 (23%)

Query: 245 LYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFLID 304
            Y+  E+V GG     ++    L+  HAR +   +  A+  LH     HRDLK EN +I 
Sbjct: 198 FYMLFEYVSGGQLLDYIIQHGSLKEHHARKFARGIASALQYLHANNIVHRDLKIENIMIS 257

Query: 305 SKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEV 364
           S G IK+ DFGL++                               D R+++         
Sbjct: 258 SSGEIKIIDFGLSN-----------------------------IFDYRKQL--------- 279

Query: 365 RYAHSTVGSPDYMALEVLEAKNYDFT-VDYWSLGCILFESLVGYTPFSGNSTNETYENLR 423
              H+  GS  + A E+L+A+ Y    VD WS G +L+  + G  PF   +++  +E ++
Sbjct: 280 ---HTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSILHEKIK 336

Query: 424 NWKHVLQRPKCDNGRYAFSDRTWELITRLI-ADPINR 459
                  + K D   +  S     L+TR+I  DP+ R
Sbjct: 337 -------KGKVDYPSH-LSIEVISLLTRMIVVDPLRR 365

>YNR031C (SSK2) [4613] chr14 complement(680693..685432) MAP kinase
            kinase kinase (MAPKKK) involved in the high-osmolarity
            signal transduction pathway [4740 bp, 1579 aa]
          Length = 1579

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 78/173 (45%), Gaps = 25/173 (14%)

Query: 249  MEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFLIDSKGH 308
            ME+  GG    LL + +       + Y  ++   +  LH+ G  HRD+KPEN L+D  G 
Sbjct: 1344 MEYCEGGSLAALLEHGRIEDEMVTQVYTLQLLEGLAYLHESGIVHRDVKPENILLDFNGV 1403

Query: 309  IKLTDFGLA-----SGT--VSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLRE 361
            IK  DFG A     +GT   SM +IE+     ++V ++           D + + N    
Sbjct: 1404 IKYVDFGAAKKIANNGTRLASMNKIENADGEHEDVTHVS----------DSKAVKNNENA 1453

Query: 362  EEVRYAHSTVGSPDYMALEVLEAKNYDFTV---DYWSLGCILFESLVGYTPFS 411
                     +G+P YMA E +        +   D WSLGC++ E + G  P++
Sbjct: 1454 -----LLDMMGTPMYMAPESITGSTTKGKLGADDVWSLGCVVLEMITGRRPWA 1501

>Kwal_27.9763
          Length = 868

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 81/201 (40%), Gaps = 45/201 (22%)

Query: 218 LTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYIS 277
           + E D+L   + E +VK     Q    L++ +E+   G  R L+     ++    + YI 
Sbjct: 66  MLEIDLLKNLKHENIVKYHGFIQKSHQLFILLEYCSQGSLRDLIKRGP-VEEQQCKTYIR 124

Query: 278 EMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVK 337
           +    +  LH  G  HRD+K  N L+D++  +KL DFG+++                 V 
Sbjct: 125 QTLHGLKYLHDQGVIHRDIKAANLLLDAQNVVKLADFGVST----------------RVN 168

Query: 338 NLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLG 397
           NL                           A +  GSP++MA EV+  +      D WSLG
Sbjct: 169 NL---------------------------AMTYAGSPNWMAPEVMMGQGASTVSDIWSLG 201

Query: 398 CILFESLVGYTPFSGNSTNET 418
             + E L G  PF  N  NE 
Sbjct: 202 ATVVEILTGNPPFH-NLVNEA 221

>Scas_720.94
          Length = 1683

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 48/167 (28%), Positives = 71/167 (42%), Gaps = 18/167 (10%)

Query: 249  MEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFLIDSKGH 308
            ME+  GG   +LL + +       + Y  E+   +  LHQ G  HRD+KPEN L+D  G 
Sbjct: 1439 MEYCEGGSMASLLEHGRIEDEMVTQVYTLELLEGLAYLHQAGVVHRDIKPENILLDFNGI 1498

Query: 309  IKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAH 368
            IK  DFG A       +I     ++  + +            D      K  E      H
Sbjct: 1499 IKYVDFGAA------RKIAKNGTKVTNINS---------KSKDDDEPDEKDTEGGANSVH 1543

Query: 369  STVGSPDYMALEVLEA---KNYDFTVDYWSLGCILFESLVGYTPFSG 412
              +G+P YMA E +     K    + D WS GC++ E + G  P++ 
Sbjct: 1544 DMLGTPMYMAPESITGYKNKTKFGSDDIWSFGCVVLEMITGRRPWAN 1590

>KLLA0E21780g complement(1936438..1939488) similar to sp|P38692
           Saccharomyces cerevisiae YHR102w NRK1 ser/thr protein
           kinase that interacts with CDC31P, start by similarity
          Length = 1016

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 48/167 (28%), Positives = 72/167 (43%), Gaps = 42/167 (25%)

Query: 245 LYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFLID 304
           L++ ME+  GG  RTLL     ++  +    + E+  A+ ++H+    HRD+K  N LI 
Sbjct: 88  LWVIMEYCAGGSLRTLL-RPGIIEEKYIGVIMREILVALISIHRDNVIHRDIKAANILIA 146

Query: 305 SKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEV 364
           + G +KL DFG+A+                            +SM  R+ M         
Sbjct: 147 NNGSVKLCDFGVAAQL-------------------------SQSMLKRQTM--------- 172

Query: 365 RYAHSTVGSPDYMALEV-LEAKNYDFTVDYWSLGCILFESLVGYTPF 410
                  G+P +MA EV +E   YD  VD WSLG   +E   G  P+
Sbjct: 173 ------AGTPYWMAPEVIMEGVYYDTKVDIWSLGITAYEIATGNPPY 213

>Kwal_55.21709
          Length = 340

 Score = 68.9 bits (167), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 77/275 (28%), Positives = 114/275 (41%), Gaps = 68/275 (24%)

Query: 220 ERDILTT-TRSEWLVKLLYAFQDPQSLYLAMEF--VPGGDFRTLLLNTKFLQAPHARFYI 276
           E  ILT  T    ++ LL   QD  S   A+ F  V   DFRTL L       P  ++Y 
Sbjct: 92  ELKILTNLTGGPNVIALLDIVQDSGSKIPALIFEEVKNVDFRTLYLK---FTLPDIQYYF 148

Query: 277 SEMFCAVNALHQLGYTHRDLKPENFLIDS-KGHIKLTDFGLASGTVSMERIESMKIRLQE 335
           S++  A++  H +G  HRD+KP+N +ID  +  ++L D+GLA                  
Sbjct: 149 SQLLIALDYCHSMGIMHRDVKPQNVMIDPVERKLRLIDWGLA------------------ 190

Query: 336 VKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWS 395
                  EF    +D     YN      VR A      P+ +    +    YD+++D WS
Sbjct: 191 -------EFYHPGVD-----YN------VRVASRYHKGPELL----VNLNQYDYSLDLWS 228

Query: 396 LGCILFESLVGYTPFSGNSTNE-----------TYENLRNW-KHVLQRPK-CDNGRYAFS 442
           +GC+L   +    PF   STN            T E L    K+ L+ P+  DN    F 
Sbjct: 229 VGCMLAAIVFKKEPFFKGSTNPDQLVKIARVLGTTELLAYLNKYGLKLPREYDNIMKDFP 288

Query: 443 DRTWE--------LITRLIADPINRLKSFEHVKRM 469
            +TW         L+   + D I  L  ++H +R+
Sbjct: 289 RKTWSEFTTPDTPLVVPEVVDLIENLLRYDHQERL 323

>YLR248W (RCK2) [3644] chr12 (634254..636086)
           Calcium/calmodulin-dependent serine/threonine protein
           kinase (CaM kinase) [1833 bp, 610 aa]
          Length = 610

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 54/240 (22%), Positives = 97/240 (40%), Gaps = 39/240 (16%)

Query: 239 FQDPQSLY-LAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDLK 297
           FQ+  S Y +  E + GG+    ++   +     +R  I ++  AV  +H LG  HRD+K
Sbjct: 256 FQETDSYYYIIQELLTGGEIFGEIVRLTYFSEDLSRHVIKQLALAVKHMHSLGVVHRDIK 315

Query: 298 PENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLE-------FPEFRERSMD 350
           PEN L +                  +E   S+K +L++  + +       F         
Sbjct: 316 PENLLFEP-----------------IEFTRSIKPKLRKSDDPQTKADEGIFTPGVGGGGI 358

Query: 351 DRRRMYNKLREEEV--RYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYT 408
              ++ +    +++  +   +  G+  Y A EV++ ++Y   VD W +GC+L+  L G+ 
Sbjct: 359 GIVKLADFGLSKQIFSKNTKTPCGTVGYTAPEVVKDEHYSMKVDMWGIGCVLYTMLCGFP 418

Query: 409 PFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITRLIADPINRLKSFEHVKR 468
           PF     +   E            K   G Y F    W+ I+    + + +L   E  KR
Sbjct: 419 PFYDEKIDTLTE------------KISRGEYTFLKPWWDEISAGAKNAVAKLLELEPSKR 466

>Kwal_23.5290
          Length = 819

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 50/202 (24%), Positives = 88/202 (43%), Gaps = 48/202 (23%)

Query: 217 VLTERDILTTTRSEWLVKLLYAF-QDPQSLYLAMEFVPGGDFRTLLLNTKF-------LQ 268
           ++ E  ++  ++ + +V  L A+ +    L++ ME++ GG    L+ N+         L 
Sbjct: 584 IVNEILVMKDSQHKNIVNFLEAYLKTEDDLWVVMEYMEGGSLTDLIENSPANGSSHSPLT 643

Query: 269 APHARFYISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIES 328
            P   + + E    +  LH     HRD+K +N L+D++  +K+TDFG  +          
Sbjct: 644 EPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDNRARVKITDFGFCA---------- 693

Query: 329 MKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYD 388
                                        KL ++  + A + VG+P +MA EV++ + YD
Sbjct: 694 -----------------------------KLTDKRSKRA-TMVGTPYWMAPEVVKQREYD 723

Query: 389 FTVDYWSLGCILFESLVGYTPF 410
             VD WSLG +  E L G  P+
Sbjct: 724 EKVDVWSLGIMTIEMLEGEPPY 745

>AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH]
           complement(198401..200227) [1827 bp, 608 aa]
          Length = 608

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 66/249 (26%), Positives = 100/249 (40%), Gaps = 54/249 (21%)

Query: 220 ERDI--LTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYIS 277
           ER+I  L   R   ++KL    +    + + +E+  G +    ++    +    AR +  
Sbjct: 85  EREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSENEARRFFQ 143

Query: 278 EMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVK 337
           ++  AV   H+    HRDLKPEN L+D   ++K+ DFGL++                   
Sbjct: 144 QIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSN------------------- 184

Query: 338 NLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFT-VDYWSL 396
                      M D              +  ++ GSP+Y A EV+  K Y    VD WS 
Sbjct: 185 ----------IMTDG------------NFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSS 222

Query: 397 GCILFESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITR-LIAD 455
           G IL+  L    PF   S    ++N+ N   V   PK        S     LI R LI +
Sbjct: 223 GVILYVMLCRRLPFDDESIPVLFKNISN--GVYSIPKF------LSQGAANLIKRMLIVN 274

Query: 456 PINRLKSFE 464
           P+NR+   E
Sbjct: 275 PLNRITIHE 283

>YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine
           protein kinase involved in regulation of cell wall beta
           1,6-glucan levels, interacts with Cdc31p [3243 bp, 1080
           aa]
          Length = 1080

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 47/168 (27%), Positives = 73/168 (43%), Gaps = 42/168 (25%)

Query: 244 SLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFLI 303
           SL++ ME   GG  R+LL   K  +  +    + E+  A+  +H+    HRD+K  N LI
Sbjct: 94  SLWIIMEHCAGGSLRSLLRPGKIDEK-YIGVIMRELLVALKCIHKDNVIHRDIKAANVLI 152

Query: 304 DSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEE 363
            ++G++KL DFG+A+      ++    +R Q +                           
Sbjct: 153 TNEGNVKLCDFGVAA------QVNQTSLRRQTM--------------------------- 179

Query: 364 VRYAHSTVGSPDYMALEV-LEAKNYDFTVDYWSLGCILFESLVGYTPF 410
                   G+P +MA EV +E   YD  VD WSLG   +E   G  P+
Sbjct: 180 -------AGTPYWMAPEVIMEGVYYDTKVDIWSLGITTYEIATGNPPY 220

>Scas_580.6
          Length = 1015

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 48/168 (28%), Positives = 72/168 (42%), Gaps = 42/168 (25%)

Query: 244 SLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFLI 303
           SL++ ME+  GG  R+LL   K  +  +    + E+  A+  +H+    HRD+K  N LI
Sbjct: 108 SLWIIMEYCAGGSLRSLLRPGKIDEK-YIGVIMRELLVALKYIHKDNVIHRDIKAANVLI 166

Query: 304 DSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEE 363
            ++G +KL DFG+A+                    L     R ++M              
Sbjct: 167 TNEGSVKLCDFGVAA-------------------QLNQSTLRRQTM-------------- 193

Query: 364 VRYAHSTVGSPDYMALEV-LEAKNYDFTVDYWSLGCILFESLVGYTPF 410
                   G+P +MA EV +E   YD  VD WSLG   +E   G  P+
Sbjct: 194 -------AGTPYWMAPEVIMEGVYYDTKVDIWSLGITAYEIATGNPPY 234

>KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces
           cerevisiae YOL016c CMK2 Ca2+/calmodulin-dependent
           ser/thr protein kinase, type II, start by similarity
          Length = 427

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 59/223 (26%), Positives = 90/223 (40%), Gaps = 47/223 (21%)

Query: 220 ERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGD-FRTLLLNTKFLQAPHARFYISE 278
           E  IL       +V+    F+  +  Y+  +   GG+ F  +L   KF +   A F + +
Sbjct: 95  ELSILQQLNHPNIVRFKDWFESKEKFYIVTQLATGGELFDRILEKGKFCEV-DAVFIVKQ 153

Query: 279 MFCAVNALHQLGYTHRDLKPENFLIDSKGH---IKLTDFGLASGTVSMERIESMKIRLQE 335
           +   V  LHQ    HRDLKPEN L  +K     + + DFG+A                +E
Sbjct: 154 ILQGVQYLHQRNIVHRDLKPENILYLNKSDDSPLVIGDFGIA----------------KE 197

Query: 336 VKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWS 395
           +K            DD   +            H   GS  Y+A EVL +  +    D WS
Sbjct: 198 LK------------DDNELI------------HKAAGSMGYVAPEVLTSSGHGKPCDIWS 233

Query: 396 LGCILFESLVGYTPFSGNSTNETYENLRNWKH--VLQRPKCDN 436
           +G I +  L GY+PF   S +   E   + ++  V  +P  +N
Sbjct: 234 IGVITYTLLCGYSPFLAESADGFIEECTSGQYPVVFHKPYWNN 276

>Scas_700.34
          Length = 864

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 56/210 (26%), Positives = 91/210 (43%), Gaps = 55/210 (26%)

Query: 232 LVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFL-QAPHARFYISEMFCAVNALHQLG 290
           +VKL    Q+ + + + +E+  GG+F   +   K L + P  R + +++   V+ +H  G
Sbjct: 119 IVKLEEVLQNSKYIGIVLEYASGGEFYKYIQRKKRLKEGPACRLF-AQLINGVHYIHSKG 177

Query: 291 YTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMD 350
             HRDLK EN L+D   ++ +TDFG  S                     EF         
Sbjct: 178 LVHRDLKLENLLLDKHENLIITDFGFVS---------------------EF--------- 207

Query: 351 DRRRMYNKLREEEVRYAH-----STVGSPDYMALE-VLEAKNYDF-TVDYWSLGCILFES 403
                          Y+H     ++ GSP Y A E V+  K Y+    D WS G IL+  
Sbjct: 208 ---------------YSHGELMKTSCGSPCYAAPELVVSTKPYEAKKADIWSCGVILYAM 252

Query: 404 LVGYTPFSGNSTNETYENL-RNWKHVLQRP 432
           L GY P+  ++ N   +++ R + ++ Q P
Sbjct: 253 LAGYLPWDDDAGNPDGDDISRLYHYITQTP 282

>KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces
           cerevisiae YNL298w CLA4 ser/thr protein kinase, start by
           similarity
          Length = 879

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 87/202 (43%), Gaps = 48/202 (23%)

Query: 217 VLTERDILTTTRSEWLVKLLYAF-QDPQSLYLAMEFVPGGDFRTLLLNTKF-------LQ 268
           ++ E  ++  ++   +V  L A+ +    L++ ME++ GG    ++ N+         L 
Sbjct: 644 IVNEILVMKDSKHNNIVNFLEAYLKTEDDLWVVMEYMEGGSLTDIIENSPTGSSGQSPLT 703

Query: 269 APHARFYISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIES 328
            P   + + E    +  LH     HRD+K +N L+D++G +K+TDFG  +          
Sbjct: 704 EPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTRGRVKITDFGFCA---------- 753

Query: 329 MKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYD 388
                                        KL ++  + A + VG+P +MA EV++ + YD
Sbjct: 754 -----------------------------KLTDKRSKRA-TMVGTPYWMAPEVVKQREYD 783

Query: 389 FTVDYWSLGCILFESLVGYTPF 410
             VD WSLG +  E L    P+
Sbjct: 784 EKVDVWSLGIMTIEMLESEPPY 805

>KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces
            cerevisiae YNR031c SSK2 MAP kinase kinase kinase of the
            high osmolarity signal transduction pathway, start by
            similarity
          Length = 1551

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 70/272 (25%), Positives = 104/272 (38%), Gaps = 70/272 (25%)

Query: 249  MEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFLIDSKGH 308
            MEF  G    +LL + +       + Y  ++   +  LHQ G  HRD+KPEN L+D  G 
Sbjct: 1337 MEFCEGSSLASLLEHGRIEDEMVTQVYTLQLLEGLACLHQSGVVHRDIKPENILLDRNGV 1396

Query: 309  IKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAH 368
            IK  DFG A     + +  S +I                S+D   +              
Sbjct: 1397 IKYVDFGAAK---LIAKNGSKRI----------------SLDANNKSTG---------GK 1428

Query: 369  STVGSPDYMALEVLEAKNYD--FTVDYWSLGCILFESLVGYTPFSGNSTNETYENLRN-W 425
              +G+P YMA E +  + +    + D WSLGC++ E + G  P++         NL N W
Sbjct: 1429 DMIGTPMYMAPETVTGQGHGKFGSDDIWSLGCVVLEMVTGRRPWA---------NLDNEW 1479

Query: 426  K--------HVLQRPKCDNGRYAFSDRTWELITR-LIADPINRLKSFEHVKRMRYFSEID 476
                     H+ Q P     +   S    + I+R LI D   R  + E            
Sbjct: 1480 AIMYHVAAGHLPQFPT----KSEISSAGRKFISRCLIQDANKRATAME------------ 1523

Query: 477  FNTLRTIHPPFIPQLDNEEDVGYFDDFTNEEH 508
                  +  P+I Q+ N    G  + F NE H
Sbjct: 1524 -----LLLDPWISQIRNIAFGGNAESFNNETH 1550

>Scas_598.6
          Length = 790

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 50/202 (24%), Positives = 86/202 (42%), Gaps = 48/202 (23%)

Query: 217 VLTERDILTTTRSEWLVKLLYAF-QDPQSLYLAMEFVPGGDFRTLLLNTKF-------LQ 268
           ++ E  ++  +R + +V  L A+ +    L++ MEF+ GG    ++ N+         L 
Sbjct: 555 IVNEILVMKDSRHKNIVNFLEAYLKTEDDLWVVMEFMEGGSLTDIIENSPATGSSSSPLT 614

Query: 269 APHARFYISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIES 328
            P   + + E    +  LH     HRD+K +N L+D+   +K+TDFG  +          
Sbjct: 615 EPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDNNARVKITDFGFCA---------- 664

Query: 329 MKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYD 388
                                        KL ++  + A + VG+P +MA EV++ + YD
Sbjct: 665 -----------------------------KLTDQRSKRA-TMVGTPYWMAPEVVKQREYD 694

Query: 389 FTVDYWSLGCILFESLVGYTPF 410
             VD WSLG +  E L    P+
Sbjct: 695 EKVDVWSLGIMTIEMLESEPPY 716

>CAGL0K02673g complement(240509..243256) similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20
           Serine/threonine-protein kinase, hypothetical start
          Length = 915

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 81/194 (41%), Gaps = 41/194 (21%)

Query: 217 VLTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYI 276
           +L E  ++  ++   +V  + ++     L++ ME++ GG    ++ +   L         
Sbjct: 662 ILNEILVMRESKHSNIVNFIDSYLAKGDLWIVMEYMEGGSLTDVVTHC-LLSEGQIGAVC 720

Query: 277 SEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEV 336
            E    +  LH  G  HRD+K +N L+  KG+IKLTDFG  +                  
Sbjct: 721 RETLKGLQFLHSKGVLHRDIKSDNILLSLKGNIKLTDFGFCA------------------ 762

Query: 337 KNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSL 396
                                ++ E  ++   + VG+P +MA EV+  K Y   VD WSL
Sbjct: 763 ---------------------QINENNLKRT-TMVGTPYWMAPEVVSRKEYGPKVDIWSL 800

Query: 397 GCILFESLVGYTPF 410
           G ++ E + G  P+
Sbjct: 801 GIMIIEMIEGEPPY 814

>Kwal_0.155
          Length = 587

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 61/254 (24%), Positives = 101/254 (39%), Gaps = 28/254 (11%)

Query: 215 DHVLTERDILTTTRSEWLVKLLYAFQDPQSLY-LAMEFVPGGDFRTLLLNTKFLQAPHAR 273
           + VL E  I  T  +   V     FQ+  + Y +  E + GG+    ++   +     +R
Sbjct: 217 EQVLKEVAIHRTVSASENVVSFVDFQESHNYYFIVQELLAGGEIFGEIVRLTYFSEDLSR 276

Query: 274 FYISEMFCAVNALHQLGYTHRDLKPENFLIDSKGH-------IKLTDFGLASGTVSMERI 326
             I ++  AV  +H +G  HRD+KPEN L +   +       ++ +D   A     + R 
Sbjct: 277 HVIRQLALAVKHMHAMGIVHRDIKPENLLFEHVDYEPSPSPVLRKSDDPKAKQDEGIFRP 336

Query: 327 ESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKN 386
                 +  VK  +F             +  ++     +    TVG   Y A EV++ + 
Sbjct: 337 GIGGGGIGTVKLADF------------GLSKQIYSTNTKTPCGTVG---YTAPEVVKDER 381

Query: 387 YDFTVDYWSLGCILFESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTW 446
           Y   VD W +GC+L+  L G+ PF     +   E +   +    RP  D      SD   
Sbjct: 382 YSMQVDMWGIGCVLYTVLCGFPPFYDEKIDVLTEKISRGEFTFLRPWWDE----ISDGAK 437

Query: 447 ELITRLI-ADPINR 459
             + RL+  DP  R
Sbjct: 438 NAVRRLLEVDPSKR 451

>Kwal_33.14167
          Length = 838

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 54/196 (27%), Positives = 76/196 (38%), Gaps = 55/196 (28%)

Query: 232 LVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKF-LQAPHARFYISEMFCAVNALHQLG 290
           +VKL+    D   LY+ ME       +TL   +   L     R++  EM   V  +H  G
Sbjct: 575 VVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDAG 634

Query: 291 YTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMD 350
             H DLKP NF+   KG +K+ DFG+A                                 
Sbjct: 635 IVHSDLKPANFVF-VKGILKIIDFGIA--------------------------------- 660

Query: 351 DRRRMYNKLREEEVR-YAHSTVGSPDYMALEVLEAKNYDFT-------------VDYWSL 396
                 N + E  V  Y  + +G+P+YMA E L A NY                 D WS 
Sbjct: 661 ------NAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSC 714

Query: 397 GCILFESLVGYTPFSG 412
           GCI+++ + G  P+ G
Sbjct: 715 GCIIYQMIYGRPPYGG 730

>AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C
           (CMK1) - SH] complement(358947..360308) [1362 bp, 453
           aa]
          Length = 453

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 50/188 (26%), Positives = 72/188 (38%), Gaps = 45/188 (23%)

Query: 232 LVKLLYAFQDPQSLYLAMEFVPGGD-FRTLLLNTKFLQAPHARFYISEMFCAVNALHQLG 290
           +VK    F+  +  Y+  +   GG+ F  +L   KF +    +  + +M  AV  +H   
Sbjct: 115 IVKFKDWFESREKFYIVTQLATGGELFDRILKKGKFTETDAVKIVV-QMLTAVEYMHSQN 173

Query: 291 YTHRDLKPENFLI---DSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRER 347
             HRDLKPEN L      +  + ++DFG+A                              
Sbjct: 174 VVHRDLKPENVLYLDPSDESQLVISDFGIA------------------------------ 203

Query: 348 SMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGY 407
                     K    E +  H   GS  Y+A EVL    +    D WSLG I +  L GY
Sbjct: 204 ----------KQLSSESQLIHRAAGSMGYVAPEVLTTSGHGKPCDIWSLGVITYTLLCGY 253

Query: 408 TPFSGNST 415
           +PF   ST
Sbjct: 254 SPFIAEST 261

>Scas_640.14*
          Length = 728

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 58/245 (23%), Positives = 102/245 (41%), Gaps = 44/245 (17%)

Query: 232 LVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGY 291
           +V+L    Q+ + + + +E+  GG+F   +   + L+   A    +++   V+ +H  G 
Sbjct: 108 IVRLEEVLQNSKYIGIVLEYASGGEFYKYVQRKRRLKEATACRLFAQLISGVSYMHSKGI 167

Query: 292 THRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDD 351
            HRDLK EN L+D   ++ +TDFG  +                     EF         D
Sbjct: 168 VHRDLKLENLLLDKHENLIITDFGFVN---------------------EF-------YAD 199

Query: 352 RRRMYNKLREEEVRYAHSTVGSPDYMALE-VLEAKNYDF-TVDYWSLGCILFESLVGYTP 409
              M             ++ GSP Y A E V+  + Y     D WS G IL+  L GY P
Sbjct: 200 NELM------------KTSCGSPCYAAPELVITTEPYKARKADIWSCGIILYGMLAGYLP 247

Query: 410 FSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITR-LIADPINRLKSFEHVKR 468
           +  +  N   E++    H + +      R  ++      +   L+++P+ R+ S  H+K+
Sbjct: 248 WDDDKQNPNGEDIVRLYHYITKTPLKFPRIHYTTFLGICLRHILVSNPVRRMSS-RHIKK 306

Query: 469 MRYFS 473
             + S
Sbjct: 307 HEWLS 311

>Kwal_23.6325
          Length = 1542

 Score = 69.3 bits (168), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 48/166 (28%), Positives = 70/166 (42%), Gaps = 30/166 (18%)

Query: 247  LAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFLIDSK 306
            L ME+  GG    LL + +       + Y  +M   +  LHQ    HRD+KPEN L+D  
Sbjct: 1325 LFMEYCEGGSLAQLLEHGRIEDEMVTQIYALQMLEGLAYLHQSSVVHRDIKPENILLDFN 1384

Query: 307  GHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRY 366
            G IK  DFG A    +                            +  +  N   E +   
Sbjct: 1385 GVIKYVDFGAARSLAA----------------------------NGTKAPNVGAEGKADG 1416

Query: 367  AHSTVGSPDYMALE-VLEAKNYDF-TVDYWSLGCILFESLVGYTPF 410
             +S +G+P YM+ E +  AK   F + D WSLGC++ E + G  P+
Sbjct: 1417 VNSMMGTPMYMSPESITGAKKGKFGSGDIWSLGCVILEMVTGRRPW 1462

>KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235.1
           Kluyveromyces lactis putative kinase, start by
           similarity
          Length = 602

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 62/249 (24%), Positives = 100/249 (40%), Gaps = 54/249 (21%)

Query: 220 ERDI--LTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYIS 277
           ER+I  L   R   ++KL    +    + + +E+  G +    ++    +    AR +  
Sbjct: 81  EREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMPEQEARRFFQ 139

Query: 278 EMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVK 337
           ++  AV+  H+    HRDLKPEN L+D   ++K+ DFGL++                   
Sbjct: 140 QIISAVDYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSN------------------- 180

Query: 338 NLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFT-VDYWSL 396
                      M D              +  ++ GSP+Y A EV+  K Y    VD WS 
Sbjct: 181 ----------IMTDG------------NFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSS 218

Query: 397 GCILFESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITR-LIAD 455
           G IL+  L    PF   S    ++N+ N  + +            S     LI + LI +
Sbjct: 219 GVILYVMLCRRLPFDDESIPVLFKNISNGVYTIPN--------FLSQGAASLIKKMLIVN 270

Query: 456 PINRLKSFE 464
           P+NR+   E
Sbjct: 271 PVNRITVHE 279

>KLLA0E11979g complement(1060048..1061892) some similarities with
           sp|P25333 Saccharomyces cerevisiae YCR008w SAT4
           serine/threonine-specific protein kinase, hypothetical
           start
          Length = 614

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 77/190 (40%), Gaps = 38/190 (20%)

Query: 219 TERDILTTTRSEWLVKLLYAFQDPQSLYL-AMEFVPGGDFRTLLLNTKFLQAPHARFYIS 277
           +E  I ++ +   +++ L  FQD +  Y   ME+  GGD  TL++    L+   A  ++ 
Sbjct: 383 SEFCISSSLKHTNIIETLDLFQDAKGDYCEVMEYCSGGDLFTLIIAAGKLEYQEADCFLK 442

Query: 278 EMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVK 337
           ++   V  +H +G  HRDLKPEN L+   G +K+TDFG                      
Sbjct: 443 QLITGVVYMHNMGVCHRDLKPENLLLTHDGTLKITDFG---------------------- 480

Query: 338 NLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYD-FTVDYWSL 396
                             +    E+E+  +    GS  Y+A E    + +D   VD W+ 
Sbjct: 481 --------------NSECFRMAWEKEIHLSGGVCGSGPYIAPEEYTQEEFDPRAVDIWAC 526

Query: 397 GCILFESLVG 406
           G I      G
Sbjct: 527 GVIYMAMRTG 536

>KLLA0A02497g 218592..219680 highly similar to sp|P14681
           Saccharomyces cerevisiae YGR040w KSS1 ser/thr protein
           kinase of the MAP kinase family, start by similarity
          Length = 362

 Score = 67.8 bits (164), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 68/284 (23%), Positives = 115/284 (40%), Gaps = 62/284 (21%)

Query: 243 QSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFL 302
           +++YL  E +   D + ++ N + L   H ++++ ++  A+ +LH     HRDLKP N L
Sbjct: 88  EAVYLVQELM-ETDLQKII-NQQNLSEDHIQYFVYQILRALKSLHSAQVIHRDLKPSNLL 145

Query: 303 IDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREE 362
           ++S   +K+ DFGLA    S ++                                  RE 
Sbjct: 146 LNSNCDLKVCDFGLARCLASSDQS---------------------------------REN 172

Query: 363 EVRYAHSTVGSPDYMALEV-LEAKNYDFTVDYWSLGCILFESLVGYTPFSGNSTNETYEN 421
            V +    V +  Y A E+ L  + Y   +D WS GCIL E ++G   F G    + +  
Sbjct: 173 MVGFMTEYVATRWYRAPEIMLSFQEYTTAMDIWSCGCILAEMIMGKPLFPG---KDYHHQ 229

Query: 422 LRNWKHVLQRPKCDNGRYAFSDRTWELITR-------------------LIADPINRLKS 462
           L     VL  P  ++     S R  E I++                   L  D ++++ +
Sbjct: 230 LWIILEVLGSPTLEDFEQIKSKRAKEYISQLPMKKGIPWANVLNKEVNPLAIDLLSKMLT 289

Query: 463 FEHVKRMRYFSEIDFNTLRTIH----PPFIPQLDNEEDVGYFDD 502
           F   KR+     ++   L T H     P  PQL+ E++    D+
Sbjct: 290 FNPDKRISAVEALEHPYLATYHDPDDEPDYPQLNLEDNFWKIDN 333

>Scas_613.5
          Length = 517

 Score = 68.6 bits (166), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 62/260 (23%), Positives = 95/260 (36%), Gaps = 70/260 (26%)

Query: 220 ERDILTTTRSEWLVKLLYAFQDPQSL-----YLAMEFVPGGDFRTLLLNTKFLQAPHARF 274
           E +IL       +V LL  F +P S      YL ++ +  G+    ++    L+    + 
Sbjct: 252 ETNILMRIHHPNIVNLLDFFIEPVSKSQIQKYLVLDKIDDGELFERIVKKTCLRQDETKA 311

Query: 275 YISEMFCAVNALHQLGYTHRDLKPENFLIDSKG-------------------HIKLTDFG 315
             +++   +  LHQ    HRD+KPEN L++                       +K+ DFG
Sbjct: 312 IFNQILMGLKHLHQQNIIHRDIKPENILLNITRRTNPEQKQLGPWDEDEIDIQVKIADFG 371

Query: 316 LASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPD 375
           LA  T                                          E+++ ++  G+P 
Sbjct: 372 LAKFT-----------------------------------------GEMQFTNTLCGTPS 390

Query: 376 YMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGNSTNETY-ENLRNWKHVLQRPKC 434
           Y+A EVL  K Y   VD WS G IL+  L G+ PFS      +  E +   K     P  
Sbjct: 391 YVAPEVLTKKGYTSKVDMWSAGVILYVCLCGFPPFSEQLGPPSLKEQILQAKFAFYTPYW 450

Query: 435 DNGRYAFSDRTWELITRLIA 454
           DN      D    LI+ L+ 
Sbjct: 451 DN----IDDNVLHLISHLLV 466

>AAL029W [158] [Homologous to ScYLR248W (RCK2) - SH; ScYGL158W
           (RCK1) - SH] complement(289989..291593) [1605 bp, 534
           aa]
          Length = 534

 Score = 68.6 bits (166), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 69/283 (24%), Positives = 113/283 (39%), Gaps = 35/283 (12%)

Query: 215 DHVLTERDILTTTRSEWLVKLLYAFQDPQSLY-LAMEFVPGGDFRTLLLNTKFLQAPHAR 273
           + VL E  I     S   +     FQ+ +S Y +  E + GG+    ++   +     +R
Sbjct: 162 EQVLKEITIHKAVSSGENIVTFIDFQETESYYFIVQELLAGGEIFGEIVRLTYFSEDLSR 221

Query: 274 FYISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRL 333
             I ++  AV  +H LG  HRD+KPEN L          DF + S    + + +  K + 
Sbjct: 222 HVIRQLALAVKHMHSLGIVHRDIKPENLLFSP------IDF-IPSKRQQLRQSDDPKTKQ 274

Query: 334 QEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHST---VGSPDYMALEVLEAKNYDFT 390
            E   L  P      +   +     L ++   YA +T    G+  Y A EV++ + Y   
Sbjct: 275 DE--GLFRPGIGGGGIGVIKLADFGLSKQ--IYATNTTTPCGTVGYTAPEVVKDERYSMK 330

Query: 391 VDYWSLGCILFESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELIT 450
           VD W +GC+L+  L G+ PF     +   E +              G+Y F    W+ I+
Sbjct: 331 VDMWGIGCVLYTVLCGFPPFYDEKIDVLTELI------------SKGQYTFLRPWWDEIS 378

Query: 451 RLIADPINRLKSFEHVKRM--------RYFSEIDFNTLRTIHP 485
               + + RL   +  KR          + +  D N LR + P
Sbjct: 379 PGAKNAVRRLLEVDPDKRYDIDEFLADPWLNSYDCNVLRPLVP 421

>YOR351C (MEK1) [5128] chr15 complement(995013..996506)
           Serine/threonine protein kinase required for meiotic
           recombination [1494 bp, 497 aa]
          Length = 497

 Score = 68.2 bits (165), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 66/281 (23%), Positives = 111/281 (39%), Gaps = 87/281 (30%)

Query: 232 LVKLLYAFQDPQS-LYLAMEFVPGGDFRTLLLNTKFLQA---PHARFYISEMFCAVNALH 287
           ++K+ + F D  + LY+  + +PGGD  + L     L +     +   + ++  A+N LH
Sbjct: 223 IIKVYHTFCDRNNHLYIFQDLIPGGDLFSYLAKGDCLTSMSETESLLIVFQILQALNYLH 282

Query: 288 QLGYTHRDLKPENFLI---DSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEF 344
                HRDLK +N L+   +    I L DFG+A    S                      
Sbjct: 283 DQDIVHRDLKLDNILLCTPEPCTRIVLADFGIAKDLNS---------------------- 320

Query: 345 RERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEV-----------------LEAKNY 387
                 ++ RM            H+ VG+P+Y A EV                 LE + Y
Sbjct: 321 ------NKERM------------HTVVGTPEYCAPEVGFRANRKAYQSFSRAATLEQRGY 362

Query: 388 DFTVDYWSLGCILFESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWE 447
           D   D WSLG I    L G +PF G+ +  +         ++Q  K   G+  F  + W+
Sbjct: 363 DSKCDLWSLGVITHIMLTGISPFYGDGSERS---------IIQNAKI--GKLNFKLKQWD 411

Query: 448 LIT---------RLIADPINRLKS---FEHVKRMRYFSEID 476
           +++          L  D + RL S    +H+   ++ S+++
Sbjct: 412 IVSDNAKSFVKDLLQTDVVKRLNSKQGLKHIWIAKHLSQLE 452

>CAGL0B03509g complement(349638..351431) similar to sp|P38623
           Saccharomyces cerevisiae YLR248w RCK2
           Ca/calmodulin-dependent or sp|P38622 Saccharomyces
           cerevisiae YGL158w RCK1, start by similarity
          Length = 597

 Score = 68.6 bits (166), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 56/227 (24%), Positives = 95/227 (41%), Gaps = 28/227 (12%)

Query: 246 YLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFLIDS 305
           YL  E + GG+    ++   +L    +R  I ++  AV  +H LG  HRD+KPEN L  S
Sbjct: 257 YLIQELLDGGEIFNEIVRLTYLSEDLSRHVIKQVALAVRHMHSLGIVHRDIKPENLLFKS 316

Query: 306 KGHI--KLTDFGLA--SGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLRE 361
             +I  K   F  +    T + E +    I    +  ++  +F          +  ++ +
Sbjct: 317 IEYIPSKKRTFRKSDDPATKADEGVFIPTIGGGGIGIVKLADF---------GLSKQIFQ 367

Query: 362 EEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGNSTNETYEN 421
           +  +    T+G   Y A EV++ + Y   VD W +GC+L+  L G+ PF     +   E 
Sbjct: 368 KNTKTPCGTIG---YTAPEVVKDEKYSMQVDMWGIGCVLYTMLCGFPPFYDEKIDVLTE- 423

Query: 422 LRNWKHVLQRPKCDNGRYAFSDRTWELITRLIADPINRLKSFEHVKR 468
                      K   G Y F +  W+ I+      + +L   +  KR
Sbjct: 424 -----------KISRGEYTFLEPWWDEISPGAKHCVKKLLEVDPRKR 459

>KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces
           cerevisiae YDR523c SPS1 ser/thr protein kinase,
           hypothetical start
          Length = 483

 Score = 68.2 bits (165), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 52/200 (26%), Positives = 79/200 (39%), Gaps = 35/200 (17%)

Query: 212 EGTDHVLTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPH 271
           E  D +L E   L+T    ++      F    +LY+ ME+   G    LL     L    
Sbjct: 56  EPIDLLLKEIYFLSTLHCPYITHYYGTFTGDCNLYIVMEYCSNGSLLNLLRYYSRLTEQT 115

Query: 272 ARFYISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKI 331
             F I ++  A+  LH+    HRDLK  N L++  G ++L D G+               
Sbjct: 116 TCFIILQVCHALEYLHEKRLIHRDLKAANILLNDDGEVRLADLGVTG------------- 162

Query: 332 RLQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTV 391
                  L+F   R                   +  ++ VG+P +MA E+++ ++YD   
Sbjct: 163 ------QLKFNSTRHGG----------------KNLNTFVGTPFWMAPEIIKNQSYDGKC 200

Query: 392 DYWSLGCILFESLVGYTPFS 411
           D WSLG    E L G  P S
Sbjct: 201 DIWSLGITTLELLNGKPPMS 220

>KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2 ser/thr protein kinase, start by
           similarity
          Length = 1104

 Score = 68.6 bits (166), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 55/217 (25%), Positives = 94/217 (43%), Gaps = 51/217 (23%)

Query: 245 LYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFLID 304
            Y+  E+V GG     ++    L+  HAR ++  +  A+  LH     HRDLK EN +I 
Sbjct: 197 FYMLFEYVSGGQLLDYIIQHGSLRERHARKFVRGIASALQYLHLNNIVHRDLKIENIMIS 256

Query: 305 SKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEV 364
           + G IK+ DFGL+                    NL          D+++++         
Sbjct: 257 TSGEIKIIDFGLS--------------------NL---------YDNKKQL--------- 278

Query: 365 RYAHSTVGSPDYMALEVLEAKNY-DFTVDYWSLGCILFESLVGYTPFSGNSTNETYENLR 423
              H+  GS  + A E+L+A  Y    VD WS G +++  + G  PF   + +  +E ++
Sbjct: 279 ---HTFCGSLYFAAPELLKANPYIGPEVDIWSFGVVIYVLVCGKVPFDDENASVLHEKIK 335

Query: 424 NWKHVLQRPKCDNGRYAFSDRTWELITR-LIADPINR 459
             K  ++ P+        S     L+++ L+ DP+ R
Sbjct: 336 KGK--VEYPQ------HLSIECISLLSKMLVVDPLKR 364

>CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2 ser/thr protein kinase,
           hypothetical start
          Length = 1192

 Score = 68.6 bits (166), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 77/183 (42%), Gaps = 42/183 (22%)

Query: 245 LYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFLID 304
            Y+  E+V GG     ++    L+  HAR +   +  A+  LH     HRDLK EN +I 
Sbjct: 207 FYMLFEYVAGGQLLDYIIQHGSLREHHARKFARGVASALQYLHANNIVHRDLKIENIMIS 266

Query: 305 SKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEV 364
           + G IK+ DFGL++                               D R+++         
Sbjct: 267 NSGEIKIIDFGLSN-----------------------------VYDTRKQL--------- 288

Query: 365 RYAHSTVGSPDYMALEVLEAKNYDFT-VDYWSLGCILFESLVGYTPFSGNSTNETYENLR 423
              H+  GS  + A E+L+A  Y    VD WS G +L+  + G  PF   +++  +E ++
Sbjct: 289 ---HTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSVLHEKIK 345

Query: 424 NWK 426
             K
Sbjct: 346 RGK 348

>AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W
           (SKM1) - SH] complement(246871..249252) [2382 bp, 793
           aa]
          Length = 793

 Score = 68.2 bits (165), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 88/202 (43%), Gaps = 48/202 (23%)

Query: 217 VLTERDILTTTRSEWLVKLLYAF-QDPQSLYLAMEFVPGGDFRTLLLNT-------KFLQ 268
           ++ E  ++  ++ + +V  L A+ +    L++ ME++ GG    ++ N+         + 
Sbjct: 558 IVNEILVMKDSQHKNIVNFLEAYLKTEDDLWVVMEYMEGGSLTDVIENSIGSDASESPMT 617

Query: 269 APHARFYISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIES 328
            P   + + E    +  LH     HRD+K +N L+D+ G +K+TDFG  +          
Sbjct: 618 EPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTHGRVKITDFGFCA---------- 667

Query: 329 MKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYD 388
                                        KL ++  + A + VG+P +MA EV++ + YD
Sbjct: 668 -----------------------------KLTDKRSKRA-TMVGTPYWMAPEVVKQREYD 697

Query: 389 FTVDYWSLGCILFESLVGYTPF 410
             VD WSLG +  E L G  P+
Sbjct: 698 EKVDVWSLGIMTIEMLEGEPPY 719

>Kwal_33.13222
          Length = 148

 Score = 63.2 bits (152), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 30/87 (34%), Positives = 51/87 (58%)

Query: 232 LVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGY 291
           +++L   ++   +LY+ +E+V  G+   LL+    L    A  +  ++   ++  H LG 
Sbjct: 9   VLRLYDVWETNSNLYMVLEYVEKGELFNLLVERGPLPENEAVRFFRQIIIGISYCHALGI 68

Query: 292 THRDLKPENFLIDSKGHIKLTDFGLAS 318
            HRDLKPEN L+D K +IK+ DFG+A+
Sbjct: 69  VHRDLKPENLLLDHKFNIKIADFGMAA 95

>ACL054W [995] [Homologous to ScYGL180W (APG1) - SH]
           complement(269703..272621) [2919 bp, 972 aa]
          Length = 972

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 71/281 (25%), Positives = 110/281 (39%), Gaps = 66/281 (23%)

Query: 220 ERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDF-------RTL-----LLNTKFL 267
           E  IL   +   +V LL   +     YL ME+   GD        R+L     L+ T F 
Sbjct: 67  EIAILKKIKHPHIVGLLECERTGTDFYLMMEYCALGDLTFFIKKRRSLMDKHPLVRTLFE 126

Query: 268 QAP-----HARF-------YISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFG 315
           + P     H          Y+ ++  A+  L      HRD+KP+N L+ +     L D+ 
Sbjct: 127 KYPPPSEHHNGLNRVLVVNYLQQLSSALKFLRSKNLVHRDIKPQNLLLSTP----LVDYN 182

Query: 316 -----LASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHST 370
                 A G V +  +  +KI      +  F  F   +                  A + 
Sbjct: 183 DPAEFHARGFVGIYNLPILKI-----ADFGFARFLPNT----------------SLAETL 221

Query: 371 VGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGNSTNETYENLRNWKHVLQ 430
            GSP YMA E+L  + Y+   D WS+G +L+E   G  PF  ++  E ++ ++    V+Q
Sbjct: 222 CGSPLYMAPEILNYQKYNAKADLWSVGTVLYEMCCGKPPFKASNHLELFQKIKKANDVIQ 281

Query: 431 RPKCDNGRYAFSDRTWELITRLIADPINRLKSFEHVKRMRY 471
            PK      A      +LI  L+        +FE  KRM +
Sbjct: 282 FPK----HAALESAMVDLICGLL--------TFEPAKRMGF 310

>Scas_573.10
          Length = 569

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 50/202 (24%), Positives = 87/202 (43%), Gaps = 17/202 (8%)

Query: 239 FQDPQSLY-LAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDLK 297
           FQ+ ++ Y +  E + GG+    ++   +     +R  I ++  AV  LH LG  HRD+K
Sbjct: 215 FQESKTYYYIVQELIHGGEIFGEIVKYTYFSEDLSRHVIKQLALAVQHLHSLGVVHRDIK 274

Query: 298 PENFLIDSKGHIKLTDFGLAS----GTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRR 353
           PEN L +    I   +  L       T S E +    +    +  ++  +F         
Sbjct: 275 PENLLFEPIEFIPSKEPKLRKSDDPSTKSDEGLFVPGVGGGGIGVVKLADF--------- 325

Query: 354 RMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGN 413
            +  ++     +    TVG   Y A EV++ ++Y   VD W +GC+L+  L G+ PF   
Sbjct: 326 GLSKQIFATNTKTPCGTVG---YTAPEVVKDEHYSMKVDMWGVGCVLYTMLCGFPPFYDE 382

Query: 414 STNETYENLRNWKHVLQRPKCD 435
             +   E +   ++   RP  D
Sbjct: 383 KIDVLTEKISRGEYTFLRPWWD 404

>Kwal_56.23717
          Length = 858

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 49/183 (26%), Positives = 76/183 (41%), Gaps = 42/183 (22%)

Query: 245 LYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFLID 304
            Y+  E+V GG     ++    L+   AR +   +  A+  LH     HRDLK EN +I 
Sbjct: 8   FYMLFEYVSGGQLLDYIIQHGSLRERSARKFARGIASALQYLHMNNIVHRDLKIENIMIS 67

Query: 305 SKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEV 364
           + G IK+ DFGL++                                    MYN  ++   
Sbjct: 68  TSGEIKIIDFGLSN------------------------------------MYNPKKQ--- 88

Query: 365 RYAHSTVGSPDYMALEVLEAKNYDFT-VDYWSLGCILFESLVGYTPFSGNSTNETYENLR 423
              H+  GS  + A E+L+A  Y    VD WS G +LF  + G  PF   +++  +E ++
Sbjct: 89  --LHTFCGSLYFAAPELLKACPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSVLHEKIK 146

Query: 424 NWK 426
             K
Sbjct: 147 QGK 149

>ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -
           SH] complement(560761..563556) [2796 bp, 931 aa]
          Length = 931

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 48/193 (24%), Positives = 82/193 (42%), Gaps = 43/193 (22%)

Query: 232 LVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGY 291
           +V+L    Q+ + + + +++  GG+F   +   + L+ P A    +++   V+ +H  G 
Sbjct: 110 IVRLEEVLQNSKYIGIVLQYASGGEFYKYIQKKRRLKEPPACRLFAQLISGVHYIHYKGL 169

Query: 292 THRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDD 351
            HRDLK EN L+D   ++ +TDFG  +                        EF +  +  
Sbjct: 170 AHRDLKLENLLLDEHENLIITDFGFVN------------------------EFHKNDL-- 203

Query: 352 RRRMYNKLREEEVRYAHSTVGSPDYMALE-VLEAKNYDFT-VDYWSLGCILFESLVGYTP 409
                            ++ GSP Y A E V+ +K Y     D WS G IL+  L GY P
Sbjct: 204 ---------------MRTSCGSPCYAAPELVVSSKPYSAQKADVWSCGVILYAMLAGYLP 248

Query: 410 FSGNSTNETYENL 422
           +  +  N   E++
Sbjct: 249 WDDDPENPEGEDI 261

>Scas_602.11
          Length = 1186

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 62/228 (27%), Positives = 94/228 (41%), Gaps = 39/228 (17%)

Query: 215 DHVLTERDILTTTRSEWLVKLLYAFQDPQS--LYLAMEFVPGGDFR--------TLLLNT 264
           D +  E  I+     + +VKL+    D +S  +YL +E+   G+ +        T     
Sbjct: 226 DRIKREIAIMKKLHHKHVVKLIEVLDDLKSRKIYLVLEYCAQGEIKWCPKDCLETEAKGP 285

Query: 265 KFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFG--LASGTVS 322
             L    AR  I  +   +  LH  G  HRD+KP N L+D +G +K++DFG  LAS +  
Sbjct: 286 PLLSFQSAREIIRGVILGLEYLHYQGIIHRDIKPANLLVDEEGTVKISDFGVSLASRSSG 345

Query: 323 MERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREE---EVRYAHSTVGSPDYMAL 379
                S  +     +NL       RS  +     N   +E   EV  A  T G+P + A 
Sbjct: 346 NSTANSSSVLGGTPRNL------SRSSTESMNTTNNNDDESIDEVELA-KTAGTPAFFAP 398

Query: 380 EV-LEAKNYD----------------FTVDYWSLGCILFESLVGYTPF 410
           E+ L  + +D                F +D W+LG   +  L G  PF
Sbjct: 399 EICLGEEAFDKFSLRKNEMFKGSCISFMIDIWALGITFYCLLFGMLPF 446

>YDL028C (MPS1) [834] chr4 complement(400994..403288)
           Multi-functional serine/threonine/tyrosine protein
           kinase involved in mitotic checkpoint, spindle pole body
           duplication in meiosis and mitosis, and proper
           chromosome segregation in meiosis [2295 bp, 764 aa]
          Length = 764

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 52/187 (27%), Positives = 72/187 (38%), Gaps = 61/187 (32%)

Query: 245 LYLAMEFVPGGDFRTLLLNTKF---LQAPHARFYISEMFCAVNALHQLGYTHRDLKPENF 301
           LYL ME   G    + +LN +    L     RFY  EM   +  +H  G  H DLKP NF
Sbjct: 512 LYLIMEC--GDHDLSQILNQRSGMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANF 569

Query: 302 LIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLRE 361
           ++  KG +K+ DFG+A                                       N + E
Sbjct: 570 VL-VKGILKIIDFGIA---------------------------------------NAVPE 589

Query: 362 EEVR-YAHSTVGSPDYMALEVLEAKNYDFT---------------VDYWSLGCILFESLV 405
             V  Y  + +G+P+YMA E L A NY                   D WS GCI+++ + 
Sbjct: 590 HTVNIYRETQIGTPNYMAPEALVAMNYTQNSENQHEGNKWKVGRPSDMWSCGCIIYQMIY 649

Query: 406 GYTPFSG 412
           G  P+  
Sbjct: 650 GKPPYGS 656

>Scas_673.20*
          Length = 758

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 81/197 (41%), Gaps = 47/197 (23%)

Query: 217 VLTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGG---DFRTLLLNTKFLQAPHAR 273
           + TE  +L   +   ++  + ++    +L++ ME++ GG   D  +    T+   A   R
Sbjct: 523 IWTEMLVLKEYQHPNIINFINSYLLHDTLWIVMEYMDGGSLADIVSFFTPTEEQMATICR 582

Query: 274 FYISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRL 333
               E    +N LH  G  HRD+K +N L+   G IK+TDFG                  
Sbjct: 583 ----ETLFGLNFLHSRGIVHRDIKSDNILLSMNGDIKITDFGFC---------------- 622

Query: 334 QEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDY 393
                                   +L E   +   + VG+P +MA EV+ +K Y   VD 
Sbjct: 623 -----------------------GQLTESNTKRT-TMVGTPYWMAPEVIASKEYGPKVDV 658

Query: 394 WSLGCILFESLVGYTPF 410
           WSLG ++ E + G  P+
Sbjct: 659 WSLGIMIIEMIEGEPPY 675

>Scas_693.17
          Length = 1049

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 76/183 (41%), Gaps = 42/183 (22%)

Query: 245 LYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFLID 304
            Y+  E+V GG     ++    L+   AR +  ++  A+  LH     HRDLK EN +I 
Sbjct: 175 FYMLFEYVSGGQLLDYIIQHGSLKESRARTFTRQICSALKYLHSHNIVHRDLKIENIMIS 234

Query: 305 SKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEV 364
             G+IKL DFGL++                                    +Y+K  +   
Sbjct: 235 KDGNIKLIDFGLSN------------------------------------LYDKCNK--- 255

Query: 365 RYAHSTVGSPDYMALEVLEAKNY-DFTVDYWSLGCILFESLVGYTPFSGNSTNETYENLR 423
               +  GS  + A E+L+A  Y    +D WS G +L+  + G  PF   ++N  +E ++
Sbjct: 256 --LKTYCGSLYFAAPELLKATPYIGPEIDVWSFGVVLYVLVCGKVPFDDENSNVLHEKIK 313

Query: 424 NWK 426
             K
Sbjct: 314 QGK 316

>Scas_564.7
          Length = 1210

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 64/266 (24%), Positives = 100/266 (37%), Gaps = 68/266 (25%)

Query: 188 LARKKDTKEICAXXXXXXXXXX---XXEGTDHVLTERDILT--------------TTRSE 230
           LAR   TKEICA               +      TE+++L               T R  
Sbjct: 178 LARHHQTKEICAIKIVNRAMKAFLHKEQSMPPPRTEQEVLERQKKLEKEISRDKRTIREA 237

Query: 231 WLVKLLYAFQD---------PQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFC 281
            L ++LY                 Y+  E+V GG     ++    L+  HAR +   +  
Sbjct: 238 SLGQVLYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYIIQHGSLREHHARKFARGIAS 297

Query: 282 AVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEF 341
           A+  +H     HRDLK EN +I + G IK+ DFGL+                        
Sbjct: 298 ALEYIHANNIVHRDLKIENIMISTSGEIKIIDFGLS------------------------ 333

Query: 342 PEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFT-VDYWSLGCIL 400
                 ++ DR++             H+  GS  + A E+L+A  Y    VD WS G +L
Sbjct: 334 ------NVFDRKKQL-----------HTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVL 376

Query: 401 FESLVGYTPFSGNSTNETYENLRNWK 426
           +  + G  PF   +++  +E ++  K
Sbjct: 377 YVLVCGKVPFDDENSSVLHEKIKQGK 402

>Scas_628.9
          Length = 621

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 50/85 (58%), Gaps = 1/85 (1%)

Query: 232 LVKLLYAFQDPQSLYL-AMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLG 290
           +V  L  FQD +  Y   ME+  GGD  +L+++   L+   A  +  ++   V  +H +G
Sbjct: 400 IVTTLDLFQDAKGEYCEVMEYCSGGDLFSLIVSAGKLEYAEADCFFKQLMRGVVYMHDMG 459

Query: 291 YTHRDLKPENFLIDSKGHIKLTDFG 315
            +HRDLKPEN L+ S G +K+TDFG
Sbjct: 460 VSHRDLKPENLLLTSDGVLKITDFG 484

>Scas_668.22
          Length = 893

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 50/194 (25%), Positives = 82/194 (42%), Gaps = 41/194 (21%)

Query: 217 VLTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYI 276
           ++ E  ++  +R   +V  + ++     L++ ME++ GG    ++ +   L         
Sbjct: 653 IINEILVMKGSRHPNIVNFIDSYLLDGDLWVIMEYMEGGSLTDVVTHC-ILTEGQIGAVC 711

Query: 277 SEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEV 336
            E    +  LH  G  HRD+K +N L+   G IKLTDFG  +             ++ E+
Sbjct: 712 RETLSGLQFLHSKGVLHRDIKSDNILLSISGDIKLTDFGFCA-------------QINEI 758

Query: 337 KNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSL 396
            NL+           R  M               VG+P +MA EV+  K Y   VD WSL
Sbjct: 759 -NLK-----------RTTM---------------VGTPYWMAPEVVSRKEYGPKVDIWSL 791

Query: 397 GCILFESLVGYTPF 410
           G ++ E + G  P+
Sbjct: 792 GIMIIEMIEGEPPY 805

>Scas_640.16
          Length = 505

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 53/197 (26%), Positives = 82/197 (41%), Gaps = 48/197 (24%)

Query: 228 RSEWLVKLLYAFQD--PQSLYLAMEFVPGGDFRTL---LLNTKFLQAPHARFYISE-MFC 281
           +S+++V+    F D    S+Y+AME++ G     +   LL+     +      ISE +  
Sbjct: 265 KSDYIVRYYGMFNDVNSSSIYIAMEYMGGKSLEAVYKNLLSRGGRISEKVLGKISESVLR 324

Query: 282 AVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEF 341
            ++ LH+    HRD+KP+N L + KG +KL DFG     VS E + S+            
Sbjct: 325 GLSYLHEQKVIHRDIKPQNILFNEKGQVKLCDFG-----VSGEAVNSL------------ 367

Query: 342 PEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILF 401
                                    A +  G+  YMA E ++ + Y  T D WSLG  + 
Sbjct: 368 -------------------------ATTFTGTSFYMAPERIQGQPYSVTCDIWSLGLTIL 402

Query: 402 ESLVGYTPFSGNSTNET 418
           E   G  PF  +    T
Sbjct: 403 EVAQGRFPFGSDKITAT 419

>CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4 ser/thr protein kinase or
           tr|Q03002 Saccharomyces cerevisiae YPL141c, start by
           similarity
          Length = 661

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 50/187 (26%), Positives = 79/187 (42%), Gaps = 42/187 (22%)

Query: 232 LVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGY 291
           +V+L    Q+ + + + +E+  GG+F   +   + L+   A    +++   V  +H    
Sbjct: 115 VVRLEEVLQNSKYIGIVLEYASGGEFYKYIQRKRRLKESTACRLFAQLISGVTYMHSKNL 174

Query: 292 THRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDD 351
            HRDLK EN L+D   ++ +TDFG  +                     EF          
Sbjct: 175 VHRDLKLENLLLDKNENLVITDFGFVN---------------------EF---------- 203

Query: 352 RRRMYNKLREEEVRYAHSTVGSPDYMALE-VLEAKNY-DFTVDYWSLGCILFESLVGYTP 409
                  L + E  Y  ++ GSP Y A E V+  + Y     D WS G IL+  L GY P
Sbjct: 204 -------LPDNE--YMKTSCGSPCYAAPELVISTRPYVARKADVWSCGIILYAMLAGYLP 254

Query: 410 FSGNSTN 416
           +  +STN
Sbjct: 255 WDDDSTN 261

>AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W
           (KIN1) - SH] complement(823632..826847) [3216 bp, 1071
           aa]
          Length = 1071

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 63/248 (25%), Positives = 99/248 (39%), Gaps = 54/248 (21%)

Query: 245 LYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFLID 304
            Y+  E+V GG     ++    L+  HAR +   +  A+  LH     HRDLK EN +I 
Sbjct: 155 FYMLFEYVSGGQLLDYIIQHGSLRERHARKFARGIASALQYLHLNNIVHRDLKIENIMIS 214

Query: 305 SKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEV 364
           S G I++ DFGL++                                    MY+  ++   
Sbjct: 215 SSGEIRIIDFGLSN------------------------------------MYDPKKQ--- 235

Query: 365 RYAHSTVGSPDYMALEVLEAKNYDFT-VDYWSLGCILFESLVGYTPFSGNSTNETYENLR 423
              H+  GS  + A E+L+A  Y    VD WS G +L+  + G  PF   + +  +E ++
Sbjct: 236 --LHTFCGSLYFAAPELLKAHPYTGPEVDIWSFGVVLYVLVCGKVPFDDENASVLHEKIK 293

Query: 424 NWKHVLQRPKCDNGRYAFSDRTWELITRLIADPINR--LKSFEHVKRMRYFSEIDFNTLR 481
                    K +  ++   D    L   L+ DP  R  LK   H + M+     DF    
Sbjct: 294 QG-------KVEYPQHLSIDVISLLSKMLVVDPYKRATLKQVVHHQWMQ--KGYDFPPPS 344

Query: 482 TIHPPFIP 489
            + PP +P
Sbjct: 345 YL-PPCVP 351

>Kwal_26.8709
          Length = 829

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 80/182 (43%), Gaps = 44/182 (24%)

Query: 232 LVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFL-QAPHARFYISEMFCAVNALHQLG 290
           +V+L    Q+ + + + +E+  GG+F   +   + L + P  R + +++   V  +H  G
Sbjct: 107 IVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRLKEGPACRLF-AQLISGVYYMHSKG 165

Query: 291 YTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMD 350
             HRDLK EN L+D   ++ +TDFG  +                     EF         
Sbjct: 166 LVHRDLKLENLLLDKNENLLITDFGFVN---------------------EF--------- 195

Query: 351 DRRRMYNKLREEEVRYAHSTVGSPDYMALE-VLEAKNYDF-TVDYWSLGCILFESLVGYT 408
                   L E E+    ++ GSP Y A E V+ A+ Y+    D WS G IL+  L GY 
Sbjct: 196 --------LPENEL--MKTSCGSPCYAAPELVVTARPYEARKADVWSCGVILYAMLAGYL 245

Query: 409 PF 410
           P+
Sbjct: 246 PW 247

>Kwal_23.3590
          Length = 499

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 65/291 (22%), Positives = 103/291 (35%), Gaps = 70/291 (24%)

Query: 189 ARKKDTKEICAXXXXXXXXXXXXEGTDHVLTERDILTTTRSEWLVKLLYAFQDPQS---- 244
           A  KD+ ++ A            + T     E  IL + + + +VKL+  F +P S    
Sbjct: 203 AIDKDSGDVVAVKIFHAQHNDDQKKTKQFREETKILMSIQHKNIVKLIDRFVEPVSKAQI 262

Query: 245 -LYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFLI 303
             +L +E V  G+    ++    L+         ++   +  LH     HRD+KPEN L+
Sbjct: 263 QTFLVLEKVSDGELFDRIVRKTRLREDETNAIFKQILNGLRYLHAKNIIHRDIKPENILL 322

Query: 304 DSKGH-------------------IKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEF 344
             +                     IK+ DFGLA                           
Sbjct: 323 SIRKRRHSDEQQLGPWDDDEIDITIKIADFGLAKFI------------------------ 358

Query: 345 RERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESL 404
                             E+++ ++  G+P Y+A EVL    Y   VD WS G +L+  L
Sbjct: 359 -----------------GEMQFTNTLCGTPSYVAPEVLTKTGYTSRVDMWSAGVLLYVCL 401

Query: 405 VGYTPFSGN-STNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITRLIA 454
            G+ PFS   +     E + N K     P  D+      D    LI+ L+ 
Sbjct: 402 CGFPPFSEQLAPPSMKEQILNGKFAFYSPYWDD----IDDSCLHLISNLLV 448

>CAGL0D02244g complement(229504..230967) similar to sp|P24719
           Saccharomyces cerevisiae YOR351c MEK1 ser/thr protein
           kinase, hypothetical start
          Length = 487

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 59/208 (28%), Positives = 87/208 (41%), Gaps = 34/208 (16%)

Query: 220 ERDILTTTRSEWLVKLLYAFQD-PQSLYLAMEFVPGGDFRTLLLNTKFLQA---PHARFY 275
           E  IL       ++K+     D   +LY+  E +PGGD  + L     L       A  +
Sbjct: 205 EAKILMQLNHPNIIKVFKTHTDKSNNLYIFQELIPGGDLFSYLAKGDCLMPISQTEALVF 264

Query: 276 ISEMFCAVNALHQLGYTHRDLKPENFLIDSK---GHIKLTDFGLASGTVSMERIESMKIR 332
           + ++  A+  LH  G  HRDLK +N L+ +      I L DFG+A        + +MK R
Sbjct: 265 VYQILHALKYLHTKGIVHRDLKLDNILLCTPEPFTKIVLADFGIA------RTVTTMKSR 318

Query: 333 LQEVKNLEFPEF--RERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFT 390
           +  V  +  PE+   E      R+ Y           HS      +     LE + YD  
Sbjct: 319 MFTV--VGTPEYCAPEVGFKANRKAY-----------HS------FFRAATLEQQGYDSK 359

Query: 391 VDYWSLGCILFESLVGYTPFSGNSTNET 418
            D WSLG I    L G +PF G+ T ++
Sbjct: 360 CDLWSLGVITHIMLTGISPFYGDGTEQS 387

>Kwal_33.13831
          Length = 700

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 50/196 (25%), Positives = 78/196 (39%), Gaps = 40/196 (20%)

Query: 216 HVLTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTK--FLQAPHAR 273
           H L+ER+  +      ++K+L   Q        +EF P GD  +LL  T    L    A 
Sbjct: 454 HSLSERETASQKPHPNILKMLDLMQTHDGFIEVLEFCPSGDLYSLLSRTSKNGLHPLEAD 513

Query: 274 FYISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRL 333
            ++ ++   V  +H  G  H DLKPEN L   +G +K+ DFG +                
Sbjct: 514 CFMKQLLHGVKYMHDHGIAHCDLKPENILFGPQGVLKICDFGTSC--------------- 558

Query: 334 QEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMAL-EVLEAKNYD-FTV 391
                                ++    E++V +    VGS  Y+A  E +  + YD   V
Sbjct: 559 ---------------------VFQTAWEKQVHFQTGAVGSEPYVAPEEFIAEREYDPRLV 597

Query: 392 DYWSLGCILFESLVGY 407
           D WS G I    ++G+
Sbjct: 598 DSWSCGVIYCTMVLGH 613

>Kwal_0.307
          Length = 490

 Score = 65.5 bits (158), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 55/100 (55%), Gaps = 1/100 (1%)

Query: 217 VLTERDILTTTRSEWLVKLLYAFQDPQSLYL-AMEFVPGGDFRTLLLNTKFLQAPHARFY 275
           + +E  I ++ +   ++  L  FQD +  Y   ME+  GGD  TL++    L+   A  +
Sbjct: 318 LTSEFCISSSLKHTNIIMTLDLFQDAKGDYCQVMEYCFGGDLFTLIIAAGKLEYMEADCF 377

Query: 276 ISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFG 315
             ++   V  +H +G  HRDLKPEN L+ S G +K+TDFG
Sbjct: 378 FKQLIRGVVYMHDMGVCHRDLKPENLLLSSNGTLKITDFG 417

>YHL007C (STE20) [2279] chr8 complement(95113..97932)
           Serine/threonine protein kinase of the pheromone
           response pathway, also participates in the filamentous
           growth and STE vegetative growth pathways [2820 bp, 939
           aa]
          Length = 939

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 81/194 (41%), Gaps = 41/194 (21%)

Query: 217 VLTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYI 276
           ++ E  ++  ++   +V  + ++     L++ ME++ GG    ++ +   L         
Sbjct: 662 IINEILVMKGSKHPNIVNFIDSYVLKGDLWVIMEYMEGGSLTDVVTHC-ILTEGQIGAVC 720

Query: 277 SEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEV 336
            E    +  LH  G  HRD+K +N L+  +G IKLTDFG  +      +I  + ++    
Sbjct: 721 RETLSGLEFLHSKGVLHRDIKSDNILLSMEGDIKLTDFGFCA------QINELNLK---- 770

Query: 337 KNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSL 396
                          R  M               VG+P +MA EV+  K Y   VD WSL
Sbjct: 771 ---------------RTTM---------------VGTPYWMAPEVVSRKEYGPKVDIWSL 800

Query: 397 GCILFESLVGYTPF 410
           G ++ E + G  P+
Sbjct: 801 GIMIIEMIEGEPPY 814

>KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062
           Saccharomyces cerevisiae YPL141c, start by similarity
          Length = 909

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 75/178 (42%), Gaps = 42/178 (23%)

Query: 232 LVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGY 291
           +V L    Q+ + + + + +  GG+F   +   + L+ P A    +++   V+ +H  G 
Sbjct: 120 IVTLEEVLQNSKYIGIVLHYASGGEFYKYIQKKRRLKEPAACRLFAQLISGVHYMHHKGL 179

Query: 292 THRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDD 351
            HRDLK EN L+D   ++ +TDFG  +                        EF  R    
Sbjct: 180 AHRDLKLENLLLDEHENLIITDFGFVN------------------------EFSSR---- 211

Query: 352 RRRMYNKLREEEVRYAHSTVGSPDYMALE-VLEAKNYDF-TVDYWSLGCILFESLVGY 407
                N L +       ++ GSP Y A E V+  K Y+    D WS G IL+  L GY
Sbjct: 212 -----NDLMK-------TSCGSPCYAAPELVVTTKAYEARKADVWSCGVILYAMLAGY 257

>ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH]
           (1386601..1388079) [1479 bp, 492 aa]
          Length = 492

 Score = 65.1 bits (157), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 71/282 (25%), Positives = 105/282 (37%), Gaps = 84/282 (29%)

Query: 213 GTDHVLTERDILTTTRSEWLVKLLYAFQDPQ-SLYLAMEFVPGGDFRTLLLNTKFLQAP- 270
           G +HVLT            ++K+   F D   ++Y+  + V GGD  + L     L AP 
Sbjct: 206 GEEHVLTRGQ-------PNVIKVHDTFVDENDNIYIFEDLVAGGDLFSYLAKKDCL-API 257

Query: 271 ---HARFYISEMFCAVNALHQLGYTHRDLKPENFLI---DSKGHIKLTDFGLASGTVSME 324
               A   + ++  A+  LH  G  HRDLK +N L+   +    I L DFG+A       
Sbjct: 258 SETEALVIVYQILQALKFLHSKGIVHRDLKLDNILLCTPEPCSRIVLADFGIAK------ 311

Query: 325 RIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEV--- 381
                          + P  R R                    H+ VG+P+Y A EV   
Sbjct: 312 ---------------DLPSTRVR-------------------MHTIVGTPEYCAPEVGFR 337

Query: 382 --------------LEAKNYDFTVDYWSLGCILFESLVGYTPFSGNSTNETYENLRNWKH 427
                         +E + YDF  D WSLG +    L G +PF G+ T  +   +RN K 
Sbjct: 338 VDRNSYRNFSRTASMEQQGYDFKCDLWSLGVMTHIMLTGISPFYGDGTEASI--IRNVK- 394

Query: 428 VLQRPKCDNGRYAFSDRTWELITRLIADPINRLKSFEHVKRM 469
                    G+  F  + W  ++      + +L      KRM
Sbjct: 395 --------IGKLNFGTKQWVGVSDTAKSFVRQLLEVNAEKRM 428

>CAGL0H01639g 158967..160532 similar to sp|P08458 Saccharomyces
           cerevisiae YDR523c SPS1 ser/thr protein kinase,
           hypothetical start
          Length = 521

 Score = 65.1 bits (157), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 52/203 (25%), Positives = 82/203 (40%), Gaps = 45/203 (22%)

Query: 224 LTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLN--TKFLQAPHARFYISEMFC 281
           L   +S ++   +    +  S+++AME+  GG    LL    T  L     RF   E+  
Sbjct: 55  LAELKSPYVTNYIATVVEDVSMWIAMEYCGGGSVGDLLKYHYTSGLPEHKTRFITREILK 114

Query: 282 AVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEF 341
            ++ LH     HRD+K  N L+  +G +KL+DFG++   +S                   
Sbjct: 115 GLSYLHSQRKIHRDIKAANILLTDEGKVKLSDFGVSGKLLS------------------- 155

Query: 342 PEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVL--EAKNYDFTVDYWSLGCI 399
             FR  +                      VG+P +MA E++  +++ YD   D WSLG  
Sbjct: 156 -SFRRDTF---------------------VGTPYWMAPEIVAHDSEGYDERADIWSLGIT 193

Query: 400 LFESLVGYTPFSGNSTNETYENL 422
           + E L G  P S     +   NL
Sbjct: 194 VIEMLRGSPPLSKYDPMKVIANL 216

>YCR008W (SAT4) [542] chr3 (128467..130278) Serine/threonine protein
           kinase involved in sensitivity to salt [1812 bp, 603 aa]
          Length = 603

 Score = 65.5 bits (158), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 48/85 (56%), Gaps = 1/85 (1%)

Query: 232 LVKLLYAFQDPQSLYL-AMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLG 290
           +V  L  FQD +  Y   ME+  GGD  TL++    L+   A  +  ++   V  +H++G
Sbjct: 385 IVTTLDLFQDAKGEYCEVMEYCAGGDLFTLVVAAGKLEYMEADCFFKQLIRGVVYMHEMG 444

Query: 291 YTHRDLKPENFLIDSKGHIKLTDFG 315
             HRDLKPEN L+   G +K+TDFG
Sbjct: 445 VCHRDLKPENLLLTHDGVLKITDFG 469

>Kwal_0.96
          Length = 427

 Score = 64.7 bits (156), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 52/188 (27%), Positives = 74/188 (39%), Gaps = 45/188 (23%)

Query: 232 LVKLLYAFQDPQSLYLAMEFVPGGD-FRTLLLNTKFLQAPHARFYISEMFCAVNALHQLG 290
           +VK    F+     Y+  +   GG+ F  +L   KF +    R  + ++  AV  LH   
Sbjct: 107 IVKFKDWFESKDKFYIVTQLATGGELFDRILKQGKFTEEDAVRI-VYQILKAVEYLHSRN 165

Query: 291 YTHRDLKPENFLIDSKG---HIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRER 347
             HRDLKPEN L  ++     + L DFG+A                +E+KN         
Sbjct: 166 IVHRDLKPENLLYLTEAADSQLVLGDFGIA----------------KELKN--------- 200

Query: 348 SMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGY 407
             DD                H   GS  Y+A EV+    +    D WSLG + +  L GY
Sbjct: 201 --DD-------------ELIHKAAGSMGYVAPEVVTTSGHGKPCDIWSLGVVTYTLLCGY 245

Query: 408 TPFSGNST 415
           +PF   S 
Sbjct: 246 SPFVAESV 253

>YDR523C (SPS1) [1335] chr4 complement(1485554..1487026)
           Serine/threonine protein kinase involved in middle/late
           stage of meiosis [1473 bp, 490 aa]
          Length = 490

 Score = 65.1 bits (157), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 69/257 (26%), Positives = 101/257 (39%), Gaps = 60/257 (23%)

Query: 224 LTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHAR--FYISEMFC 281
           L   +S  +   +    +  S+++ ME+  GG    LL  +     P  +  F I E+  
Sbjct: 68  LAELKSPLITNYIATMLEDVSMWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTL 127

Query: 282 AVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEF 341
            +  LH+    HRD+K  N L++ +G +KL DFG+ SG +                    
Sbjct: 128 GLKYLHEQRKIHRDIKAANILLNEEGMVKLGDFGV-SGHI-------------------- 166

Query: 342 PEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVL--EAKNYDFTVDYWSLGCI 399
                RS   R                + VG+P +MA EV+  E   Y+   D WSLG  
Sbjct: 167 -----RSTLKR---------------DTFVGTPYWMAPEVVCCEVDGYNEKADIWSLGIT 206

Query: 400 LFESLVGYTPFSGNSTNETYENLRNWKHV-LQRPKCDNGRYAFSDRTWELITR-LIADPI 457
            +E L G  P S     +   NL   K   LQ P        FSD   + +   L+  P 
Sbjct: 207 TYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGP--------FSDAAKDFVAGCLVKTPA 258

Query: 458 NR-----LKSFEHVKRM 469
           +R     L SFE VK +
Sbjct: 259 DRPSAYNLLSFEFVKNI 275

>CAGL0M10153g complement(1010688..1013291) some similarities with
           sp|Q03497 Saccharomyces cerevisiae YHL007c ser/thr
           protein kinase of the pheromone pathway, hypothetical
           start
          Length = 867

 Score = 65.5 bits (158), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 83/194 (42%), Gaps = 41/194 (21%)

Query: 217 VLTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYI 276
           ++ E  ++++++ + +V  + ++     L++ ME++ GG   T ++    L         
Sbjct: 609 IVNEIMVMSSSKHQNIVNYIDSYLSGLDLWVVMEYMEGGCL-TDVVTYCVLTEGQIGAVC 667

Query: 277 SEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEV 336
            E+   +  LH  G  HRD+K +N L+   G IKLTDFG  +      ++    I+    
Sbjct: 668 REVLQGLEFLHSKGVLHRDIKSDNVLLSMNGDIKLTDFGFCA------QVNDTVIK---- 717

Query: 337 KNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSL 396
                          R  M               VG+P +MA E++  K Y   VD WSL
Sbjct: 718 ---------------RTTM---------------VGTPYWMAPEIVSRKEYGPKVDIWSL 747

Query: 397 GCILFESLVGYTPF 410
           G ++ E + G  P+
Sbjct: 748 GIMIIEMIEGEPPY 761

>Kwal_26.7861
          Length = 955

 Score = 65.5 bits (158), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 82/194 (42%), Gaps = 41/194 (21%)

Query: 217 VLTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYI 276
           ++ E  ++  ++   +V  + ++     L++ ME++ GG    ++ +   L         
Sbjct: 709 IINEILVMKASKHANIVNFIDSYLLRGDLWVVMEYMEGGSLTDVVTHC-ILTEGQIGAVS 767

Query: 277 SEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEV 336
            E    +  LH  G  HRD+K +N L+   G IKLTDFG  +             ++ E+
Sbjct: 768 RETLKGLQFLHSKGVIHRDIKSDNVLLSMSGEIKLTDFGFCA-------------QINEI 814

Query: 337 KNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSL 396
            NL+           R  M               VG+P +MA EV+  K Y   VD WSL
Sbjct: 815 -NLK-----------RTTM---------------VGTPYWMAPEVVSRKEYGPKVDIWSL 847

Query: 397 GCILFESLVGYTPF 410
           G ++ E + G  P+
Sbjct: 848 GIMIIEMIEGEPPY 861

>CAGL0L07810g complement(857656..859446) similar to sp|P25333
           Saccharomyces cerevisiae YCR008w SAT4
           serine/threonine-specific protein kinase, start by
           similarity
          Length = 596

 Score = 65.1 bits (157), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 57/228 (25%), Positives = 84/228 (36%), Gaps = 56/228 (24%)

Query: 232 LVKLLYAFQDPQSLYL-AMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLG 290
           +V  L  FQD    Y   ME+  GGD  TL++    L+   A  +  ++   V  +H +G
Sbjct: 360 IVDTLDLFQDANGDYCEVMEYCAGGDLFTLIIAAGKLEYMEADCFFKQLLRGVVYMHDMG 419

Query: 291 YTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMD 350
             HRDLKPEN ++   G +K+TDFG                                   
Sbjct: 420 VCHRDLKPENLILTHDGVLKITDFG----------------------------------- 444

Query: 351 DRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYD-FTVDYWSLGCILFESLVGYT- 408
                +    EE++  +    GS  Y+A E    + +D   VD W+ G I      G   
Sbjct: 445 -NSECFKMAWEEDIHLSGGVCGSSPYIAPEEYVLEEFDPRPVDIWACGVIYMAMRTGRQL 503

Query: 409 --------PF-----SGNSTNETYENLRNWKHVLQRPKCDNGRYAFSD 443
                   PF      G      YE + +    L+R +C N  Y+  D
Sbjct: 504 WTAAKKDDPFYNKYLQGRRQKSGYEPIES----LKRARCRNVIYSMLD 547

>Scas_713.7
          Length = 983

 Score = 65.1 bits (157), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 50/195 (25%), Positives = 78/195 (40%), Gaps = 44/195 (22%)

Query: 217 VLTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTK-FLQAPHARFY 275
           ++TE D+L       +VK     Q   +LY+ +EF   G  + LL   K  +    A+ Y
Sbjct: 68  IMTEIDLLKNLNHVNIVKYHGFIQKSSNLYIILEFCSKGSLKNLLTGYKDGIPELDAKVY 127

Query: 276 ISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQE 335
           I +    +  LH+ G  HRD+K  N L+DS   +KL DFG+++                +
Sbjct: 128 IRQTLNGLVYLHEQGVIHRDIKAANLLLDSNDVVKLADFGVST----------------K 171

Query: 336 VKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWS 395
           V N                            A +  GS  +M+ E++  +      D WS
Sbjct: 172 VSNT---------------------------AMTLAGSLHWMSPEIIGNRGASTLSDIWS 204

Query: 396 LGCILFESLVGYTPF 410
           LG  + E + G  PF
Sbjct: 205 LGATVVELVTGNPPF 219

>Scas_685.24
          Length = 515

 Score = 64.7 bits (156), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 78/192 (40%), Gaps = 47/192 (24%)

Query: 224 LTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLL---LNTKFLQAPHARFYISEMF 280
           L   +S +++  +    +  S+++ ME+  GG    LL    N    +   A +   E+ 
Sbjct: 72  LAELKSPYIINYITTLLEDASMWIVMEYCGGGSCSDLLKYYFNNGLPEKKVA-YITREIL 130

Query: 281 CAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLE 340
             +  LH+    HRD+K  N L+  +GH+KL DFG++                       
Sbjct: 131 KGLQYLHEQKKIHRDIKAANILLTEEGHVKLGDFGVSG---------------------- 168

Query: 341 FPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEA--KNYDFTVDYWSLGC 398
                        ++ + LR   +      VG+P +MA EV     + YD  +D WSLG 
Sbjct: 169 -------------QLKSTLRRGTI------VGTPYWMAPEVASQNIEGYDEKIDIWSLGI 209

Query: 399 ILFESLVGYTPF 410
            +FE L G  P 
Sbjct: 210 TVFELLKGVPPL 221

>CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces
           cerevisiae YDR122w KIN1 or sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2, hypothetical start
          Length = 944

 Score = 65.1 bits (157), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 72/182 (39%), Gaps = 42/182 (23%)

Query: 246 YLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFLIDS 305
           Y+  EF+ GG     ++    L+  HAR     +  A+  LH     HRDLK EN ++  
Sbjct: 167 YMFFEFISGGQLLDYIIQHGSLKENHARKVSRGILSALQYLHANNIVHRDLKIENIMLSK 226

Query: 306 KGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEVR 365
            G IKL DFGL+                              +M D R+           
Sbjct: 227 TGEIKLIDFGLS------------------------------NMYDPRKSLQTF------ 250

Query: 366 YAHSTVGSPDYMALEVLEAKNY-DFTVDYWSLGCILFESLVGYTPFSGNSTNETYENLRN 424
                 GS  + A E+L+A  Y    VD WS G +L+  + G  PF   +++  +E ++ 
Sbjct: 251 -----CGSLYFAAPELLKAHPYLGPEVDVWSFGVVLYVLVCGKVPFDDENSSALHEKIKK 305

Query: 425 WK 426
            K
Sbjct: 306 GK 307

>ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH]
           (157357..160200) [2844 bp, 947 aa]
          Length = 947

 Score = 65.1 bits (157), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 46/171 (26%), Positives = 73/171 (42%), Gaps = 50/171 (29%)

Query: 245 LYLAMEFVPGGDFRTLL----LNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPEN 300
           L++ ME+  GG  RTLL    ++ K+L        + ++  A+  +H+    HRD+K  N
Sbjct: 97  LWVIMEYCAGGSLRTLLRPGKIDEKYLG-----VIVRKLLIALVYIHKDNVIHRDIKAAN 151

Query: 301 FLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLR 360
            LI ++GH+KL DFG+A+                    L     + ++M           
Sbjct: 152 VLITNEGHVKLCDFGVAA-------------------QLTAANHKRQTM----------- 181

Query: 361 EEEVRYAHSTVGSPDYMALEV-LEAKNYDFTVDYWSLGCILFESLVGYTPF 410
                      G+P +MA EV +E   Y+   D WSLG   +E   G  P+
Sbjct: 182 ----------AGTPYWMAPEVIMEGVYYNTKADIWSLGITAYEIATGNPPY 222

>KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20 ser/thr protein
           kinase of the pheromone pathway, hypothetical start
          Length = 989

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 48/166 (28%), Positives = 70/166 (42%), Gaps = 41/166 (24%)

Query: 245 LYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFLID 304
           L++ ME++ GG    ++ +   L          E    +  LH  G  HRD+K +N L+ 
Sbjct: 768 LWVVMEYMEGGSLTDVVTHC-ILTEGQIGAVSRETLKGLQFLHSKGVIHRDIKSDNILLS 826

Query: 305 SKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEV 364
             G IKLTDFG  +             ++ EV NL+           R  M         
Sbjct: 827 MNGDIKLTDFGFCA-------------QINEV-NLK-----------RTTM--------- 852

Query: 365 RYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPF 410
                 VG+P +MA EV+  K Y   VD WSLG ++ E + G  P+
Sbjct: 853 ------VGTPYWMAPEVVSRKEYGPKVDIWSLGIMIIEMIEGEPPY 892

>ABR014W [605] [Homologous to ScYHL007C (STE20) - SH]
           complement(417710..420625) [2916 bp, 971 aa]
          Length = 971

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 46/194 (23%), Positives = 82/194 (42%), Gaps = 41/194 (21%)

Query: 217 VLTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYI 276
           ++ E  ++  +R   +V  + ++     L++ ME++ GG    ++ +    +   A    
Sbjct: 725 IINEILVMKGSRHNNIVNFIDSYLLKGDLWVIMEYMEGGSLTDVVTHCILTEGQIAAVS- 783

Query: 277 SEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEV 336
            E    ++ LH  G  HRD+K +N L+   G+IKLTDFG  +                  
Sbjct: 784 RETLRGLHFLHSKGVIHRDIKSDNILLSMDGNIKLTDFGFCA------------------ 825

Query: 337 KNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSL 396
                                ++ E  ++   + VG+P +MA EV+  K Y   VD WSL
Sbjct: 826 ---------------------QINETNLKRT-TMVGTPYWMAPEVVSRKEYGPKVDIWSL 863

Query: 397 GCILFESLVGYTPF 410
           G ++ E + G  P+
Sbjct: 864 GIMIIEMIEGEPPY 877

>YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine protein
            kinase of the MEKK family involved in the cell wall
            integrity (low-osmolarity) and nutrient sensing pathways
            [4437 bp, 1478 aa]
          Length = 1478

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 74/176 (42%), Gaps = 41/176 (23%)

Query: 238  AFQDPQSLY-LAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDL 296
             F++  ++Y L +E+V GG   +L+        P  +   +++   +  LH  G  HRD+
Sbjct: 1245 GFENKNNIYSLFLEYVAGGSVGSLIRMYGRFDEPLIKHLTTQVLKGLAYLHSKGILHRDM 1304

Query: 297  KPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMY 356
            K +N L+D  G  K++DFG++  +  +     M +R                        
Sbjct: 1305 KADNLLLDQDGICKISDFGISRKSKDIYSNSDMTMR------------------------ 1340

Query: 357  NKLREEEVRYAHSTVGSPDYMALEVLEAK-NYDFTVDYWSLGCILFESLVGYTPFS 411
                           G+  +MA E+++ K  Y   VD WSLGCI+ E   G  P+S
Sbjct: 1341 ---------------GTVFWMAPEMVDTKQGYSAKVDIWSLGCIVLEMFAGKRPWS 1381

>AER195C [2697] [Homologous to ScYCR008W (SAT4) - SH]
           (1005431..1006945) [1515 bp, 504 aa]
          Length = 504

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 48/85 (56%), Gaps = 1/85 (1%)

Query: 232 LVKLLYAFQDPQSLYL-AMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLG 290
           ++  L  FQD +  Y   ME+  GGD  +L++    L+   A  +  +M   V  +H +G
Sbjct: 286 IINTLDLFQDAKGDYCEVMEYCSGGDLFSLIVTAGKLEYMEADCFFKQMIRGVVYMHDMG 345

Query: 291 YTHRDLKPENFLIDSKGHIKLTDFG 315
             HRDLKPEN ++ + G +K+TDFG
Sbjct: 346 VCHRDLKPENLILTANGVLKITDFG 370

>YOR061W (CKA2) [4869] chr15 (441535..442554) Casein kinase II
           (Protein kinase CK2), catalytic (alpha-prime) subunit
           [1020 bp, 339 aa]
          Length = 339

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 75/291 (25%), Positives = 120/291 (41%), Gaps = 68/291 (23%)

Query: 217 VLTERDILTT-TRSEWLVKLLYAFQDPQSLYLAMEF--VPGGDFRTLLLNTKFLQAPHAR 273
           +  E  ILT  T    +V L    QD  S   A+ F  +   DFRTL    K    P  +
Sbjct: 89  IYRELKILTNLTGGPNVVGLYDIVQDADSKIPALIFEEIKNVDFRTLYPTFKL---PDIQ 145

Query: 274 FYISEMFCAVNALHQLGYTHRDLKPENFLID-SKGHIKLTDFGLASGTVSMERIESMKIR 332
           +Y +++  A++  H +G  HRD+KP+N +ID ++  ++L D+GLA               
Sbjct: 146 YYFTQLLIALDYCHSMGIMHRDVKPQNVMIDPTERKLRLIDWGLA--------------- 190

Query: 333 LQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVD 392
                     EF    +D     YN      VR A      P+ +    +    YD+++D
Sbjct: 191 ----------EFYHPGVD-----YN------VRVASRYHKGPELL----VNLNQYDYSLD 225

Query: 393 YWSLGCILFESLVGYTPFSGNSTNE-----------TYENLRNW-KHVLQRP-KCDNGRY 439
            WS+GC+L   +    PF   S+N            T E L    K+ L  P + DN   
Sbjct: 226 LWSVGCMLAAIVFKKEPFFKGSSNPDQLVKIATVLGTKELLGYLGKYGLHLPSEYDNIMR 285

Query: 440 AFSDRTW--------ELITRLIADPINRLKSFEHVKRMRYFSEIDFNTLRT 482
            F+ ++W        +L    + D I+ L  ++H +R+     +D    +T
Sbjct: 286 DFTKKSWTHFITSETKLAVPEVVDLIDNLLRYDHQERLTAKEAMDHKFFKT 336

>Scas_711.25
          Length = 1515

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 45/176 (25%), Positives = 74/176 (42%), Gaps = 41/176 (23%)

Query: 238  AFQDPQSLY-LAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDL 296
             F++  ++Y L +E+V GG   +L+        P  R   +++   +  LH  G  HRD+
Sbjct: 1284 GFENKDNIYSLFLEYVAGGSVGSLIRMYGRFDEPLIRHLNTQVLRGLAYLHSRGILHRDM 1343

Query: 297  KPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMY 356
            K +N L+D  G  K++DFG++  +  +     M +R                        
Sbjct: 1344 KADNLLLDQDGVCKISDFGISRKSKDIYSNSDMTMR------------------------ 1379

Query: 357  NKLREEEVRYAHSTVGSPDYMALEVLEAK-NYDFTVDYWSLGCILFESLVGYTPFS 411
                           G+  +MA E+++ K  Y   VD WSLGCI+ E   G  P+S
Sbjct: 1380 ---------------GTVFWMAPEMVDTKQGYSAKVDIWSLGCIVLEMFAGKRPWS 1420

>Kwal_33.13112
          Length = 505

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 59/239 (24%), Positives = 97/239 (40%), Gaps = 50/239 (20%)

Query: 224 LTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHAR--FYISEMFC 281
           L+  R+ ++      + +  S+++ MEF  GG    LL +    + P  +  + I E+  
Sbjct: 86  LSELRAPFVTTYYKTYVEDVSMWIVMEFCGGGSCADLLKHLPEHRLPENKVAYIIREVLY 145

Query: 282 AVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEF 341
            +  LH     HRD+K  N L+  +G +KL DFG     VS + + ++K           
Sbjct: 146 GLEYLHSQRKIHRDVKAANILLTDEGEVKLGDFG-----VSGQIMATLK----------- 189

Query: 342 PEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKN-YDFTVDYWSLGCIL 400
                                     ++ VG+P +MA E++   N YD   D WSLG   
Sbjct: 190 -------------------------RNTFVGTPYWMAPEIIARDNGYDEKADIWSLGITA 224

Query: 401 FESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITRLIADPINR 459
            E L G  P++     +   N+      L++P    GR+  S R +  +  L  DP  R
Sbjct: 225 MELLTGQPPYAKYDPMKVLMNIP-----LRKPPRLQGRFTSSARDFIALC-LTKDPALR 277

>KLLA0F16467g 1519800..1520822 highly similar to sp|P19454
           Saccharomyces cerevisiae YOR061w CKA2 casein kinase II
           alpha chain, start by similarity
          Length = 340

 Score = 63.2 bits (152), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 55/204 (26%), Positives = 89/204 (43%), Gaps = 47/204 (23%)

Query: 217 VLTERDILTT-TRSEWLVKLLYAFQDPQSLYLAMEF--VPGGDFRTLLLNTKFLQAPHAR 273
           +  E  +LT  T    ++ LL   QDP S   A+ F  V   DFRTL  +         +
Sbjct: 90  IYRELKVLTNLTGGPNIIGLLDIVQDPGSKIPALIFEEVKNVDFRTLYPS---FTLSDTQ 146

Query: 274 FYISEMFCAVNALHQLGYTHRDLKPENFLID-SKGHIKLTDFGLASGTVSMERIESMKIR 332
           FY +++  A++  H +G  HRD+KP+N +ID ++  ++L D+GLA               
Sbjct: 147 FYFTQLLTALDYCHSMGIMHRDVKPQNVMIDPNERKLRLIDWGLA--------------- 191

Query: 333 LQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVD 392
                     EF    +D     YN      +R A      P+ +    +    YD+++D
Sbjct: 192 ----------EFYHPGVD-----YN------IRVASRYHKGPELL----VSLNQYDYSLD 226

Query: 393 YWSLGCILFESLVGYTPFSGNSTN 416
            W++GC++   +    PF   STN
Sbjct: 227 LWAVGCMIAAIVFKKEPFFKGSTN 250

>CAGL0F00649g 71961..73505 similar to sp|P38623 Saccharomyces
           cerevisiae YLR248w RCK2 Ca/calmodulin-dependent or
           sp|P38622 Saccharomyces cerevisiae YGL158w RCK1,
           hypothetical start
          Length = 514

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 62/258 (24%), Positives = 103/258 (39%), Gaps = 31/258 (12%)

Query: 224 LTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAV 283
           LT      +VKLL      +  Y   E++ GG+    ++   +      R  I ++  AV
Sbjct: 130 LTKANVPNVVKLLEFQVSKKYYYFIQEYIEGGEIFNQIVKYTYFSEDLTRHVIRQVATAV 189

Query: 284 NALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPE 343
             LH+    HRD+KPEN + +      +           + + +  K +L E K   F  
Sbjct: 190 KGLHENNIIHRDIKPENLIFEP-----IIKEQTIHRYQKLRKSDDPKTKLDEGK---FIP 241

Query: 344 FRERSMDDRRRMYN----KLREEEVRYAHSTVGSPDYMALEVLEA---------KNYDFT 390
                   + R+ +    +L +     A +  G+  Y+A EVL            +Y + 
Sbjct: 242 GIGGGGIGKVRLVDFGLSRLMDPAESGARTPCGTFGYLAPEVLNQYKVDPRTSNTSYSYK 301

Query: 391 VDYWSLGCILFESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELIT 450
           VD W++GCIL+  L G+ PF  +  ++  E+L +        K   G Y F    W+ I+
Sbjct: 302 VDIWAIGCILYTMLCGFPPFYEDEFSK--ESLGD--------KISRGNYKFLAPWWDEIS 351

Query: 451 RLIADPINRLKSFEHVKR 468
               D I  L   +  KR
Sbjct: 352 IEAQDLIRNLLQVDPAKR 369

>Kwal_14.1273
          Length = 415

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 52/205 (25%), Positives = 83/205 (40%), Gaps = 49/205 (23%)

Query: 233 VKLLYAFQDPQSLYL-AMEFVPGGDFRTLLLNTKFLQAPHARFYIS----EMFCAVNALH 287
           V  L  F + ++ Y+  ME+   GD   ++   K   A      ++    ++  A+   H
Sbjct: 66  VCALLDFYERETCYVFVMEYAARGDLYDVIRGWKRHSAERVPVELARVVLQLCSAIEYAH 125

Query: 288 QLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRER 347
             G  HRD+KPEN L+DS G++KL D+GL           S ++R+              
Sbjct: 126 SCGIAHRDIKPENVLLDSAGNVKLADWGL-----------STRMRV-------------- 160

Query: 348 SMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGY 407
           S D R                  +G+  Y+A E   + +  F  D+WSLG  L   + G 
Sbjct: 161 SCDTR------------------IGTEKYLAPEAYASPHDTFLADFWSLGVTLLFVMFGA 202

Query: 408 TPFSGNSTNETYENLRNWKHVLQRP 432
            PF      ++  N  N+ H +  P
Sbjct: 203 CPFKNACLTKSPNN-PNFAHFVASP 226

>YDL025C (YDL025C) [836] chr4 complement(405341..407203)
           Serine/threonine protein kinase with similarity to
           members of the NPR1 subfamily [1863 bp, 620 aa]
          Length = 620

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 53/186 (28%), Positives = 80/186 (43%), Gaps = 39/186 (20%)

Query: 217 VLTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYI 276
           V TE  I +T   E +V+ L    +  +  L ME+ P  DF  L+++    Q      Y 
Sbjct: 354 VTTEFCIGSTLHHENIVETLDMLTEGDTYLLVMEYAPY-DFFNLVMSNLMTQD-EVNCYF 411

Query: 277 SEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEV 336
            ++   VN LH +G  HRDLK +N ++   G +KL DFG  S  V               
Sbjct: 412 KQLCHGVNYLHSMGLAHRDLKLDNCVVTKDGILKLIDFG--SAVV--------------- 454

Query: 337 KNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTV-DYWS 395
              ++P                  E+ +  +H  VGS  Y+A E+L+  +YD  V D WS
Sbjct: 455 --FQYP-----------------YEDTIVKSHGIVGSDPYLAPELLKQTSYDPRVADVWS 495

Query: 396 LGCILF 401
           +  I +
Sbjct: 496 IAIIFY 501

>ADR204W [1945] [Homologous to ScYOR061W (CKA2) - SH]
           complement(1062595..1063614) [1020 bp, 339 aa]
          Length = 339

 Score = 62.4 bits (150), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 86/204 (42%), Gaps = 47/204 (23%)

Query: 217 VLTERDILTT-TRSEWLVKLLYAFQDPQSLYLAMEF--VPGGDFRTLLLNTKFLQAPHAR 273
           +  E  ILT  T    ++ LL   QDP S   A+ F  V   +FRTL          H  
Sbjct: 89  IYRELKILTNLTGGPNIIGLLDIVQDPGSKIPALIFEEVKNVEFRTLYPAFTLSDTQH-- 146

Query: 274 FYISEMFCAVNALHQLGYTHRDLKPENFLID-SKGHIKLTDFGLASGTVSMERIESMKIR 332
            Y  ++  A++  H +G  HRD+KP+N +ID ++  ++L D+GLA               
Sbjct: 147 -YFKQLLIALDYCHSMGIMHRDVKPQNVMIDPTERKLRLIDWGLA--------------- 190

Query: 333 LQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVD 392
                     EF    +D     YN      VR A      P+ +    +    YD+++D
Sbjct: 191 ----------EFYHPGVD-----YN------VRVASRYHKGPELL----VNLNQYDYSLD 225

Query: 393 YWSLGCILFESLVGYTPFSGNSTN 416
            WS+GC+L   +    PF   STN
Sbjct: 226 LWSVGCMLAAIVFKKEPFFKGSTN 249

>KLLA0D07304g 623352..624749 some similarities with sp|P32491
           Saccharomyces cerevisiae YPL140c MKK2 protein kinase of
           the map kinase kinase (MEK) family, hypothetical start
          Length = 465

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 52/194 (26%), Positives = 86/194 (44%), Gaps = 54/194 (27%)

Query: 226 TTRSEWLVKL--LYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARF------YIS 277
           + +S+++V+   ++A ++  ++++AME++ G   R+L    K L +   R        I+
Sbjct: 231 SCKSDFIVRYYGMFACEETSTIFIAMEYMGG---RSLDSVYKHLLSKGGRIGEKVLGKIA 287

Query: 278 E-MFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEV 336
           E +   +  LH+    HRD+KP+N L +  G IKL DFG     VS E + S+       
Sbjct: 288 ESVLRGLFYLHERKIIHRDIKPQNILFNEIGQIKLCDFG-----VSGEAVNSL------- 335

Query: 337 KNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSL 396
                                         A +  G+  YMA E ++ + Y  T D WSL
Sbjct: 336 ------------------------------ATTFTGTSYYMAPERIQGQPYSVTSDVWSL 365

Query: 397 GCILFESLVGYTPF 410
           G  L E   G++PF
Sbjct: 366 GLTLLEVAQGHSPF 379

>AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH]
            complement(595092..599363) [4272 bp, 1423 aa]
          Length = 1423

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 75/176 (42%), Gaps = 41/176 (23%)

Query: 238  AFQDPQSLY-LAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDL 296
             F++   +Y L +E+V GG   +L+           RF  +++   +  LH  G  HRD+
Sbjct: 1194 GFENKNCIYSLFLEYVAGGSVGSLIRLYGHFDEQLIRFLTTQVLEGLAYLHLRGILHRDM 1253

Query: 297  KPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMY 356
            K +N L+D+ G  K++DFG++  + ++     M +R                        
Sbjct: 1254 KADNLLLDNDGVCKISDFGISRKSNNIYSNSEMTMR------------------------ 1289

Query: 357  NKLREEEVRYAHSTVGSPDYMALEVLE-AKNYDFTVDYWSLGCILFESLVGYTPFS 411
                           G+  +MA E+++  + Y   VD WSLGC++ E   G  P+S
Sbjct: 1290 ---------------GTVFWMAPEMVDTTQGYSAKVDIWSLGCVVLEMFAGKRPWS 1330

>CAGL0L06006g complement(670707..673535) similar to sp|P53104
           Saccharomyces cerevisiae YGL180w APG1 essential for
           autophagocytosis, hypothetical start
          Length = 942

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 59/267 (22%), Positives = 104/267 (38%), Gaps = 51/267 (19%)

Query: 220 ERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARF----- 274
           E  IL   +   +V L+   +     YL M++   GD   L+   K L+  H        
Sbjct: 60  EIAILKKIKHPHIVGLIDCERTTTDFYLVMDYCALGDLTFLIKKRKELENNHPLLQTVFN 119

Query: 275 -------------------YISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFG 315
                              Y+ ++  A+  L      HRD+KP+N L+ +     LT++ 
Sbjct: 120 KYPPPSKEHNGLNRAFVVCYLQQLASALKFLRSKNLVHRDIKPQNLLLATP----LTNYR 175

Query: 316 LASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPD 375
            +     +  +    + + ++ +  F  F   +                  A +  GSP 
Sbjct: 176 DSKTFHELGYVGIYNLPILKIADFGFARFLPST----------------SLAETLCGSPL 219

Query: 376 YMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGNSTNETYENLRNWKHVLQRPK-C 434
           YMA E+L  + Y+   D WS+G +LFE   G  PF+ ++  E ++ ++     +  P+ C
Sbjct: 220 YMAPEILNYQKYNAKADLWSVGTVLFEMCCGVPPFTASNHLELFKKIKRAHDEINFPEVC 279

Query: 435 DNGRYAFSDRTWELITRLIA-DPINRL 460
           +       D   ELI  L+  DP  R+
Sbjct: 280 E-----VEDGLKELICSLLTFDPAKRI 301

>Kwal_27.12559
          Length = 414

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 79/183 (43%), Gaps = 41/183 (22%)

Query: 271 HARFYISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMK 330
           H + ++ ++ C +  +H     HRDLKP N L    G++K+ DFGLA G           
Sbjct: 171 HIKHFLYQILCGLKYIHSADVIHRDLKPGNILCSIGGNLKICDFGLARGIA--------- 221

Query: 331 IRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALE-VLEAKNYDF 389
                      P++ E+  D+              +  S V +  Y A E +L  + Y  
Sbjct: 222 -----------PQYFEQKSDE-------------IHITSYVATRWYRAPELILSHRRYTK 257

Query: 390 TVDYWSLGCILFESLVGYTP-FSG-NSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWE 447
            +D W++GCIL E   G  P F G +S ++  E L+    VL  P  +      S R+WE
Sbjct: 258 AIDIWAVGCILAE-FYGRKPIFMGHDSLHQVSEILK----VLGSPCRETVAKYCSARSWE 312

Query: 448 LIT 450
           + +
Sbjct: 313 IFS 315

>Kwal_47.17263
          Length = 1127

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 65/271 (23%), Positives = 106/271 (39%), Gaps = 35/271 (12%)

Query: 213 GTDHVLTERDILTTTRSEWLVKLLYAFQDPQS--LYLAMEFV--------PGGDFRTLLL 262
           G+D +  E  I+     E +VKL+    D  S  +YL +E+         PG    T   
Sbjct: 154 GSDKIKREIAIMKKCHHEHVVKLVEVLDDSTSRKIYLVLEYCSKGEVKWCPGDQLETEAR 213

Query: 263 NTKFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLA-SGTV 321
               L    AR     +   +  LH  G  HRD+KP N LI   G +K++DFG++ + + 
Sbjct: 214 GPPLLTFQRAREIFRGVVLGLEYLHYQGIIHRDIKPANLLISESGTVKISDFGVSFAASK 273

Query: 322 SMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEV 381
           S     S+   L+  K    P F    +        +   +     H ++ S        
Sbjct: 274 SGAGYGSLD-ELELAKTAGTPAFFAPEICLGHEASERFAPDRPSSDHGSIIS-------- 324

Query: 382 LEAKNYDFTVDYWSLGCILFESLVGYTPFSGNSTNETYENLRNWKHVLQ--RPKCDNGRY 439
                  + +D W++G  L   L G  PF      E ++ + N + VL+       NG  
Sbjct: 325 -------YNIDIWAIGVTLHCLLFGMLPFFSEFELELFDKIINQELVLKTYEEMASNGIS 377

Query: 440 AFSDR-----TWELITRLIA-DPINRLKSFE 464
             S++       +L+ RL+  +P  R+K  E
Sbjct: 378 KISNQEEYEAAKDLLGRLLTKNPFKRIKIAE 408

>Scas_619.5*
          Length = 510

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 71/298 (23%), Positives = 114/298 (38%), Gaps = 93/298 (31%)

Query: 220 ERDILTTTRSEWLVKLLYAFQD--PQSLYLAMEFVPGGDFRTLLLNTKFLQA---PHARF 274
           E  IL       ++K+ Y F D    +LY+  + +PGGD  + L   + L A        
Sbjct: 217 EAKILLKLNHANIIKIHYTFNDLMNNNLYIFQDLIPGGDLFSYLAKGECLTAISETETLI 276

Query: 275 YISEMFCAVNALHQLGYTHRDLKPENFLIDSK---GHIKLTDFGLASGTVSMERIESMKI 331
            + ++  A++ +H  G  HRDLK +N L+ S      I L DFG+A              
Sbjct: 277 IVYQILKALHYIHGRGIVHRDLKLDNILLCSPEPCTRIVLADFGIA-------------- 322

Query: 332 RLQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEV---------- 381
                        ++ S+ + R              ++ VG+P+Y A EV          
Sbjct: 323 -------------KDLSLKNTR-------------MNTIVGTPEYCAPEVGFKATRSIID 356

Query: 382 ----------LEAKNYDFTVDYWSLGCILFESLVGYTPFSGN-STNETYENLRNWKHVLQ 430
                          YD   D WSLG I    L G +PF G+ S N   +N++       
Sbjct: 357 QSCSRANTIDQSMNGYDSKCDIWSLGVITHIMLTGISPFYGDGSENSIIQNVK------- 409

Query: 431 RPKCDNGRYAFSDRTW--------ELITRLI-ADPINRL---KSFEHVKRMRYFSEID 476
                 G+  FS + W        + + +L+  D   RL   +SF+H    RY ++++
Sbjct: 410 -----RGKLDFSMKPWNNVNHNAKQFVEKLLEIDADKRLDSKQSFQHPWISRYQTQLE 462

>ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C
           (MKK2) - SH] complement(557738..559312) [1575 bp, 524
           aa]
          Length = 524

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 56/208 (26%), Positives = 86/208 (41%), Gaps = 54/208 (25%)

Query: 212 EGTDHVLTERDILTTTRSEWLVKLLYAFQDPQ--SLYLAMEFVPGGDFRTLLLNTKFLQA 269
           E    +  E     + +S+++V+    F D +  S+Y+AME++ G   R+L    K L  
Sbjct: 275 ESQKQIFRELQFNKSCKSDYIVRYYGMFTDEEHSSIYIAMEYMGG---RSLDAIYKHLLK 331

Query: 270 PHARF------YISE-MFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVS 322
              R        I+E +   ++ LHQ    HRD+KP+N L++  G +KL DFG     VS
Sbjct: 332 HGGRVGEKVLGKIAESVLRGLSYLHQRKIIHRDIKPQNILLNEAGQVKLCDFG-----VS 386

Query: 323 MERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVL 382
            E + S+                                     A +  G+  YMA E +
Sbjct: 387 GEAVNSL-------------------------------------ATTFTGTSYYMAPERI 409

Query: 383 EAKNYDFTVDYWSLGCILFESLVGYTPF 410
           + + Y  T D WSLG  L E    + PF
Sbjct: 410 QGQPYSVTSDVWSLGLTLLEVAQAHFPF 437

>CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces
           cerevisiae YOL016c CMK2 Ca2+/calmodulin-dependent
           ser/thr protein kinase, type II, hypothetical start
          Length = 442

 Score = 62.4 bits (150), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 64/255 (25%), Positives = 96/255 (37%), Gaps = 52/255 (20%)

Query: 220 ERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGD-FRTLLLNTKFLQAPHARFYISE 278
           E  IL   +   +V+    F+     Y+  +   GG+ F  +L   KF +       + +
Sbjct: 94  ELSILQMLKHPNIVEFKDWFESKDKFYIVTQLAVGGELFDRILAKGKFTERDAVSITM-Q 152

Query: 279 MFCAVNALHQLGYTHRDLKPENFLIDSK---GHIKLTDFGLASGTVSMERIESMKIRLQE 335
           +  AV+ +H     HRDLKPEN L   K     + + DFG+A              +LQ+
Sbjct: 153 ILSAVDYMHSKNVVHRDLKPENVLYIDKSDDSQLVIADFGIAK-------------QLQD 199

Query: 336 VKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWS 395
             +L F                              GS  Y+A EVL    +    D WS
Sbjct: 200 NDDLIF---------------------------KAAGSLGYVAPEVLTNNGHGKPCDIWS 232

Query: 396 LGCILFESLVGYTPFSGNSTNETYENLRNWKH--VLQRPKCDNGRYAFSDRTWELITR-L 452
           +G I++  L GY+ F   + +   E     K+     +P  DN     SD     I R L
Sbjct: 233 IGVIVYTLLCGYSAFVAETVDGFLEECTQNKYPVTFHKPYWDN----ISDEAKNFILRAL 288

Query: 453 IADPINRLKSFEHVK 467
             DP  R  + E +K
Sbjct: 289 TLDPAERPTAAELMK 303

>CAGL0G02035g 179911..180930 highly similar to sp|P19454
           Saccharomyces cerevisiae YOR061w CKA2 casein kinase II
           alpha chain, start by similarity
          Length = 339

 Score = 62.0 bits (149), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 56/201 (27%), Positives = 87/201 (43%), Gaps = 47/201 (23%)

Query: 220 ERDILTT-TRSEWLVKLLYAFQDPQSLYLAMEF--VPGGDFRTLLLNTKFLQAPHARFYI 276
           E  ILT  T    ++ LL   QD  S   A+ F  V   DFRTL  +         ++Y 
Sbjct: 92  ELKILTNLTGGPNVIGLLDIVQDQASKIPALIFEEVKNADFRTLYPS---FTLQDLQYYF 148

Query: 277 SEMFCAVNALHQLGYTHRDLKPENFLID-SKGHIKLTDFGLASGTVSMERIESMKIRLQE 335
           +++  A++  H +G  HRD+KP+N +ID ++  ++L D+GLA                  
Sbjct: 149 TQLLIALDYCHSMGIMHRDVKPQNVMIDPAQKKLRLIDWGLA------------------ 190

Query: 336 VKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWS 395
                  EF    +D     YN      VR A      P+ +    +    YD+++D WS
Sbjct: 191 -------EFYHPGVD-----YN------VRVASRYHKGPELL----VNLNQYDYSLDLWS 228

Query: 396 LGCILFESLVGYTPFSGNSTN 416
           +GC+L   +    PF   S+N
Sbjct: 229 VGCMLAAIIFKKEPFFKGSSN 249

>CAGL0K04169g 383738..384934 similar to sp|P14681 Saccharomyces
           cerevisiae YGR040w KSS1, start by similarity
          Length = 398

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 46/171 (26%), Positives = 71/171 (41%), Gaps = 32/171 (18%)

Query: 243 QSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFL 302
           + +YL  E +   D   +L ++  L   H ++++ ++  A+ A+H     HRDLKP N L
Sbjct: 110 KEIYLVQELM-ETDLSRILASSNTLTVDHIQYFLYQILRALKAIHSAKVIHRDLKPSNIL 168

Query: 303 IDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREE 362
           ++S   +K+ DFGLA                           R    DD     N     
Sbjct: 169 LNSNCDLKICDFGLA---------------------------RTYDPDDDASTMNG---N 198

Query: 363 EVRYAHSTVGSPDYMALEV-LEAKNYDFTVDYWSLGCILFESLVGYTPFSG 412
            V +    V +  Y A E+ L  ++Y   +D WS GC+L E L     F G
Sbjct: 199 NVGFLTEYVATRWYRAPEIMLNFQDYSTAIDIWSCGCVLAEMLFRKPIFPG 249

>YGL180W (ATG1) [1811] chr7 (160069..162762) Serine/threonine
           protein kinase involved in induction of autophagy after
           nutrient limitation [2694 bp, 897 aa]
          Length = 897

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 69/274 (25%), Positives = 104/274 (37%), Gaps = 65/274 (23%)

Query: 220 ERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLL------------LNTKFL 267
           E  IL   +   +V L+   +     YL ME+   GD   LL            L T F 
Sbjct: 73  EIAILKKIKHPHIVGLIDCERTSTDFYLIMEYCALGDLTFLLKRRKELMENHPLLRTVFE 132

Query: 268 QAP---------HARF---YISEMFCAVNALHQLGYTHRDLKPENFLI--------DSKG 307
           + P         H  F   Y+ ++  A+  L      HRD+KP+N L+        DSK 
Sbjct: 133 KYPPPSENHNGLHRAFVLSYLQQLASALKFLRSKNLVHRDIKPQNLLLSTPLIGYHDSKS 192

Query: 308 HIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYA 367
             +L       G V +  +  +KI      +  F  F   +                  A
Sbjct: 193 FHEL-------GFVGIYNLPILKI-----ADFGFARFLPNT----------------SLA 224

Query: 368 HSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGNSTNETYENLRNWKH 427
            +  GSP YMA E+L  + Y+   D WS+G ++FE   G  PF  ++  E ++ ++    
Sbjct: 225 ETLCGSPLYMAPEILNYQKYNAKADLWSVGTVVFEMCCGTPPFRASNHLELFKKIKRAND 284

Query: 428 VLQRPKCDNGRYAFSDRTWELITRLIA-DPINRL 460
           V+  P   N          ELI  L+  DP  R+
Sbjct: 285 VITFPSYCN----IEPELKELICSLLTFDPAQRI 314

>Scas_713.38
          Length = 432

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 66/251 (26%), Positives = 99/251 (39%), Gaps = 51/251 (20%)

Query: 220 ERDILTTTRSEWLVKLLYAFQDP-QSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISE 278
           E  +L   R E L+ L   F  P + +Y   E + G D   LL  T+ L+    ++++ +
Sbjct: 70  ELKLLKHLRHENLICLQDIFLSPLEDIYFVTE-LQGTDLHRLL-QTRPLEKQFVQYFLYQ 127

Query: 279 MFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKN 338
           +   +  +H +G  HRDLKP N LI+    +K+ DFGLA                     
Sbjct: 128 ILRGLKYVHSVGVIHRDLKPSNILINENCDLKICDFGLA--------------------- 166

Query: 339 LEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEV-LEAKNYDFTVDYWSLG 397
                   R  D +   Y   R               Y A E+ L  + YD  VD WS G
Sbjct: 167 --------RIQDPQMTGYVSTRY--------------YRAPEIMLTWQKYDVEVDIWSAG 204

Query: 398 CILFESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITRLIA-DP 456
           CI  E + G   F G      +  + +   +L  P  D      S+ T + +T L   DP
Sbjct: 205 CIFAEMIEGKPLFPGKDHVHQFSIITD---LLGSPPEDVINTICSENTLKFVTSLPHRDP 261

Query: 457 INRLKSFEHVK 467
           I   + F+ V+
Sbjct: 262 IPFSERFKTVE 272

>ADR300C [2042] [Homologous to ScYHR082C (KSP1) - SH]
           (1222346..1225018) [2673 bp, 890 aa]
          Length = 890

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 61/217 (28%), Positives = 89/217 (41%), Gaps = 62/217 (28%)

Query: 217 VLTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGD-FRTLLLNTKFLQAPHARFY 275
            L E DI +       +  LY + D    Y+ ME+  GGD +  +  +T   +       
Sbjct: 104 ALYEVDIQSKIGKHKNITELYDYFDS---YIIMEYCSGGDLYEAIKADTIPRKTRQLTHI 160

Query: 276 ISEMFCAVNALHQLGYTHRDLKPENFLI-DSKGHIKLTDFGLASG-TVSMERIESMKIRL 333
           IS++  AV  +H  G  HRD+KPEN LI DS   +KLTD+GLA+    SM+R        
Sbjct: 161 ISQILDAVEFVHSKGIYHRDIKPENILIADSNWTVKLTDWGLATTDQTSMDR-------- 212

Query: 334 QEVKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDF---- 389
                                                VGS  YMA E+ E+ N D+    
Sbjct: 213 ------------------------------------NVGSERYMAPELFES-NLDYDERN 235

Query: 390 ------TVDYWSLGCILFESLVGYTPFS-GNSTNETY 419
                  VD W++G +L   +    PFS  N T++++
Sbjct: 236 EPYECSKVDIWAIGIVLLNIVFHKNPFSVANQTDKSF 272

>Kwal_23.5668
          Length = 1689

 Score = 63.2 bits (152), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 52/169 (30%), Positives = 80/169 (47%), Gaps = 34/169 (20%)

Query: 244 SLYLAMEFVPGGDFRTL--LLNTKFLQAPHARFY--ISEMFCAVNALHQLGYTHRDLKPE 299
           +L++ ME+      RTL  L++T+ L A    ++    E+  A++ +H  G  HRDLKP 
Sbjct: 811 TLFIQMEYCEN---RTLFDLIHTENLCAQKEEYWRLFREILDALSYIHSQGIIHRDLKPM 867

Query: 300 NFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMDDRRRMYNKL 359
           N  ID   +IK+ DFGLA                   KN+       +S+ D  RM + +
Sbjct: 868 NIFIDESRNIKIGDFGLA-------------------KNV------HKSV-DLLRMDSHI 901

Query: 360 REEEVRYAHSTVGSPDYMALEVLEAK-NYDFTVDYWSLGCILFESLVGY 407
                    S +G+  Y+A EVL    NY+  +D +SLG I FE +  +
Sbjct: 902 STASTEDLTSAIGTALYVATEVLTGSGNYNEKIDMYSLGIIFFEMVYSF 950

>Scas_713.21
          Length = 641

 Score = 62.4 bits (150), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 42/153 (27%), Positives = 61/153 (39%), Gaps = 52/153 (33%)

Query: 272 ARFYISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKI 331
            R    EM   + A+H     H DLKP NF+   KG +KL DFG+A              
Sbjct: 421 VRLMSKEMIECIKAVHDSDIVHSDLKPANFIF-VKGTLKLIDFGIA-------------- 465

Query: 332 RLQEVKNLEFPEFRERSMDDRRRMYNKLREEEVR-YAHSTVGSPDYMALEVLEAKNYDFT 390
                                    NK+ +  +  Y ++ +G+P+YMA E L ++NY   
Sbjct: 466 -------------------------NKIADNTLNVYRNTQMGTPNYMAPETLISQNYSNN 500

Query: 391 V-----------DYWSLGCILFESLVGYTPFSG 412
                       D WS GCIL++   G+ P+S 
Sbjct: 501 NNNLLWKIGKPSDIWSYGCILYQMTYGHPPYSS 533

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.136    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 18,846,088
Number of extensions: 844223
Number of successful extensions: 4029
Number of sequences better than 10.0: 654
Number of HSP's gapped: 3839
Number of HSP's successfully gapped: 1006
Length of query: 558
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 451
Effective length of database: 12,891,983
Effective search space: 5814284333
Effective search space used: 5814284333
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)