Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0D14883g46746024760.0
Sklu_2401.74733658291e-106
Kwal_23.39954743708181e-104
Scas_716.344793707302e-91
YGR091W (PRP31)4943707191e-89
CAGL0G03025g4793196266e-76
ADR032W4392433862e-41
AFR328C5132501503e-10
YOR310C (NOP58)5112541485e-10
KLLA0F08613g5112541486e-10
Kwal_34.158945122501469e-10
Scas_665.125152541442e-09
ACL144C5492221272e-07
Kwal_56.246545072201272e-07
KLLA0D12254g5132201244e-07
CAGL0I09790g5131681211e-06
Sklu_1985.14982221173e-06
Scas_537.75102221173e-06
CAGL0A04015g5081111173e-06
YLR197W (SIK1)5042201155e-06
CAGL0I04862g1507103683.0
Kwal_55.2151556771664.8
Scas_544.452472656.3
Sklu_2251.5266171646.6
Kwal_23.5161148981648.0
Scas_694.25751217648.9
Scas_706.3435034639.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D14883g
         (460 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D14883g 1254381..1255784 some similarities with sp|P49704 S...   958   0.0  
Sklu_2401.7 YGR091W, Contig c2401 14483-15904                         323   e-106
Kwal_23.3995                                                          319   e-104
Scas_716.34                                                           285   2e-91
YGR091W (PRP31) [2051] chr7 (666343..667827) Protein required fo...   281   1e-89
CAGL0G03025g 280230..281669 similar to sp|P49704 Saccharomyces c...   245   6e-76
ADR032W [1773] [Homologous to ScYGR091W (PRP31) - SH] complement...   153   2e-41
AFR328C [3520] [Homologous to ScYOR310C (NOP58) - SH] (1032031.....    62   3e-10
YOR310C (NOP58) [5094] chr15 complement(896820..898355) Nucleola...    62   5e-10
KLLA0F08613g complement(801623..803158) similar to sp|Q12499 Sac...    62   6e-10
Kwal_34.15894                                                          61   9e-10
Scas_665.12                                                            60   2e-09
ACL144C [905] [Homologous to ScYLR197W (SIK1) - SH] (94809..9645...    54   2e-07
Kwal_56.24654                                                          54   2e-07
KLLA0D12254g 1045077..1046618 highly similar to sp|Q12460 Saccha...    52   4e-07
CAGL0I09790g complement(934746..936287) highly similar to sp|Q12...    51   1e-06
Sklu_1985.1 YLR197W, Contig c1985 148-1644 reverse complement          50   3e-06
Scas_537.7                                                             50   3e-06
CAGL0A04015g complement(397378..398904) similar to sp|Q12460 Sac...    50   3e-06
YLR197W (SIK1) [3600] chr12 (546099..547613) Nucleolar protein c...    49   5e-06
CAGL0I04862g complement(438338..442861) highly similar to sp|P32...    31   3.0  
Kwal_55.21515                                                          30   4.8  
Scas_544.4                                                             30   6.3  
Sklu_2251.5 YNL032W, Contig c2251 2992-3792 reverse complement         29   6.6  
Kwal_23.5161                                                           29   8.0  
Scas_694.25                                                            29   8.9  
Scas_706.34                                                            29   9.3  

>KLLA0D14883g 1254381..1255784 some similarities with sp|P49704
           Saccharomyces cerevisiae YGR091w PRP31 pre-mRNA splicing
           protein, hypothetical start
          Length = 467

 Score =  958 bits (2476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/460 (100%), Positives = 460/460 (100%)

Query: 1   MDLLDDEDYGSVSDEESLDDGLSGVTSGITSGIATESDILPSPSVSNLISDFHAQFWHQG 60
           MDLLDDEDYGSVSDEESLDDGLSGVTSGITSGIATESDILPSPSVSNLISDFHAQFWHQG
Sbjct: 1   MDLLDDEDYGSVSDEESLDDGLSGVTSGITSGIATESDILPSPSVSNLISDFHAQFWHQG 60

Query: 61  ADLDDLIQLAKHETIIRDATNHTTEPYNVIKLGQLMPLFDTELSMVFQCIVDTYKAKFPG 120
           ADLDDLIQLAKHETIIRDATNHTTEPYNVIKLGQLMPLFDTELSMVFQCIVDTYKAKFPG
Sbjct: 61  ADLDDLIQLAKHETIIRDATNHTTEPYNVIKLGQLMPLFDTELSMVFQCIVDTYKAKFPG 120

Query: 121 LETIVPERKQYVDVVKMLQQDIPNVQLDQVLSKEETLVVSMSLKTDFKEGARIDKDLLSK 180
           LETIVPERKQYVDVVKMLQQDIPNVQLDQVLSKEETLVVSMSLKTDFKEGARIDKDLLSK
Sbjct: 121 LETIVPERKQYVDVVKMLQQDIPNVQLDQVLSKEETLVVSMSLKTDFKEGARIDKDLLSK 180

Query: 181 AIHWFDILYNLRDNVSHYVETRIQMVAPNLCALLGPDTAAKLVTHCGSVKELSVVPSCNL 240
           AIHWFDILYNLRDNVSHYVETRIQMVAPNLCALLGPDTAAKLVTHCGSVKELSVVPSCNL
Sbjct: 181 AIHWFDILYNLRDNVSHYVETRIQMVAPNLCALLGPDTAAKLVTHCGSVKELSVVPSCNL 240

Query: 241 ASIGQDKTLHGKSLDISGVRQKGYLFYTDVVQTQPPEFQKQALRMVSAKVALAARADCTM 300
           ASIGQDKTLHGKSLDISGVRQKGYLFYTDVVQTQPPEFQKQALRMVSAKVALAARADCTM
Sbjct: 241 ASIGQDKTLHGKSLDISGVRQKGYLFYTDVVQTQPPEFQKQALRMVSAKVALAARADCTM 300

Query: 301 GNQVINPDGNSDGNSDASKLGLKWRHEIVEKLKKIIDPPNISNIKPLPIPEDAPKKKRAG 360
           GNQVINPDGNSDGNSDASKLGLKWRHEIVEKLKKIIDPPNISNIKPLPIPEDAPKKKRAG
Sbjct: 301 GNQVINPDGNSDGNSDASKLGLKWRHEIVEKLKKIIDPPNISNIKPLPIPEDAPKKKRAG 360

Query: 361 RRFRKYKEQFKMSHLRQMQNRMEFGKEEQTTMDPYGEEIGFGMADSKNVSALSSFNKTKM 420
           RRFRKYKEQFKMSHLRQMQNRMEFGKEEQTTMDPYGEEIGFGMADSKNVSALSSFNKTKM
Sbjct: 361 RRFRKYKEQFKMSHLRQMQNRMEFGKEEQTTMDPYGEEIGFGMADSKNVSALSSFNKTKM 420

Query: 421 RKSMRLRLDQETKNTHSFLQDERSEKLKRSAEHPQATDPA 460
           RKSMRLRLDQETKNTHSFLQDERSEKLKRSAEHPQATDPA
Sbjct: 421 RKSMRLRLDQETKNTHSFLQDERSEKLKRSAEHPQATDPA 460

>Sklu_2401.7 YGR091W, Contig c2401 14483-15904
          Length = 473

 Score =  323 bits (829), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 170/365 (46%), Positives = 241/365 (66%), Gaps = 26/365 (7%)

Query: 89  VIKLGQLMPLFDTELSMVFQCIVDTYKAKFPGLETIVPERKQYVDVVKMLQ----QDIPN 144
           V  L +L P+  +EL+++   I   Y  KF  L+++V   + Y  ++K L+    +D+  
Sbjct: 92  VTLLSELQPVIQSELALLHNYIKSLYSKKFSELDSLVNPPRSYSKLIKFLETSDARDLST 151

Query: 145 VQLDQVLSKEETLVVSMSLKTDFKEGARI---DKDLLSKAIHWFDILYNLRDNVSHYVET 201
             L+ +LSKE+ L+VSMS+KT FK    +   +K  L  AI     LY+L+D ++ ++ +
Sbjct: 152 --LEGILSKEQILIVSMSMKTGFKRDLALPSDEKTYLLTAIDMLIQLYDLQDEITSFIAS 209

Query: 202 RIQMVAPNLCALLGPDTAAKLVTHCGSVKELSVVPSCNLASIGQDKTL-HGKSLDISGVR 260
           ++  +APN+CA++GP  A+K+++  G + ELS VPSCNLASIG+D+ + H  + D+SGVR
Sbjct: 210 QVINIAPNVCAIVGPQVASKILSAAGGLLELSQVPSCNLASIGKDRYMSHEINTDMSGVR 269

Query: 261 QKGYLFYTDVVQTQPPEFQKQALRMVSAKVALAARADCTMGNQVINPDGNSDGNSDASKL 320
           Q+GY++   ++Q QPP   KQALRMV AKV+LAAR D +              N+  + L
Sbjct: 270 QRGYVYSCSLIQDQPPHVHKQALRMVCAKVSLAARVDIS--------------NNKDNSL 315

Query: 321 GLKWRHEIVEKLKKIIDPPNISNIKPLPIPEDAPKKKRAGRRFRKYKEQFKMSHLRQMQN 380
           G+KW +EI EKL K+ DPPNISN KPLPIPED PKKKRAGR+FRKYK+QF++SHLRQ+QN
Sbjct: 316 GVKWANEISEKLNKLQDPPNISNTKPLPIPEDKPKKKRAGRKFRKYKQQFQLSHLRQLQN 375

Query: 381 RMEFGKEEQTTMDPYGEEIGFGMADSKNVSALSSFNKT-KMRKSMRLRLDQETKNTHSF- 438
           R+EFG +E+T +D YGEEIG GMA S   +  S+ N T KMRKSM+ R+     N   F 
Sbjct: 376 RVEFGTQERTVIDSYGEEIGMGMAGSLQATQYSTHNNTAKMRKSMKRRIADAEDNVRDFV 435

Query: 439 LQDER 443
           L D+R
Sbjct: 436 LLDDR 440

>Kwal_23.3995
          Length = 474

 Score =  319 bits (818), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 174/370 (47%), Positives = 236/370 (63%), Gaps = 22/370 (5%)

Query: 87  YNVIKLGQLMPLFDTELSMVFQCIVDTYKAKFPGLETIVPERKQYVDVVKMLQ-QDI--P 143
           +N ++L +L P+   E+ ++ + +   Y+ +FP L++++   K Y  VVK L+  DI   
Sbjct: 84  FNAMQLSKLQPIVLEEMGLLQKLMAKIYERRFPELQSLMTSPKGYAQVVKHLETSDINEG 143

Query: 144 NVQ-LDQVLSKEETLVVSMSLKTDFKEGARIDKDLLSKAIHWFDILYNL---RDNVSHYV 199
           N++ L+ ++SKE  LV+SM++ T FK+   +  +     I   D+L  L   RD +  YV
Sbjct: 144 NLRGLEDIISKEHFLVLSMAMHTGFKQDVPLTAEDSRLVIQTADVLLELCDIRDKIERYV 203

Query: 200 ETRIQMVAPNLCALLGPDTAAKLVTHCGSVKELSVVPSCNLASIGQDK-TLHGKSLDISG 258
            + +  VAPNLC L+G   AA L+   G + ELS +PSCNL+SIG+ K + H    D SG
Sbjct: 204 ASLVSDVAPNLCILVGSQIAASLIAVAGGLSELSEIPSCNLSSIGKTKNSSHTSDTDASG 263

Query: 259 VRQKGYLFYTDVVQTQPPEFQKQALRMVSAKVALAARADCTMGNQVINPDGNSDGNSDAS 318
           VRQKGY++ +D+V  QP  FQKQALRMV AKV+L ARAD +       P G         
Sbjct: 264 VRQKGYIYQSDLVSGQPVSFQKQALRMVCAKVSLCARADRSKSC----PSGT-------- 311

Query: 319 KLGLKWRHEIVEKLKKIIDPPNISNIKPLPIPEDAPKKKRAGRRFRKYKEQFKMSHLRQM 378
            LG KW+ +++EKL+K+ DPPNISN K LPIPED PKKKRAGRRFRKYKEQF++SH RQ+
Sbjct: 312 -LGAKWKEQVLEKLRKLQDPPNISNTKALPIPEDKPKKKRAGRRFRKYKEQFQLSHTRQL 370

Query: 379 QNRMEFGKEEQTTMDPYGEEIGFGMADSKNVSALSSFNKTKMRKSMRLRLDQETKNTHSF 438
           QNRMEFGK+E TT D +GEEIG GMA +         N+ KMRKSM+ RL  E++ T  F
Sbjct: 371 QNRMEFGKQENTTFDAFGEEIGMGMAHTLRAPTTVFRNRAKMRKSMQQRLLSESQGTQDF 430

Query: 439 L-QDERSEKL 447
           L  D+RS  L
Sbjct: 431 LTTDDRSNIL 440

>Scas_716.34
          Length = 479

 Score =  285 bits (730), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 152/370 (41%), Positives = 225/370 (60%), Gaps = 37/370 (10%)

Query: 92  LGQLMPLFDTELSMVFQCIVDTYKAKFPGLETIVPERKQYVDVVKMLQQ-------DIP- 143
           L +L      E+ +++Q   + Y  +F  L+TI     QY  V  +++         +P 
Sbjct: 115 LNELSHQIRREIDILYQYSKNIYSTRFTELDTIAATPYQYAKVTSLIEGTSDDKAGQLPI 174

Query: 144 NVQLDQVLSKEETLVVSMSLKTDFKEGARIDKD---LLSKAIHWFDILYNLRDNVSHYVE 200
           N++++  LSKE+ LV+ MS++T F +   ++K    LL +A      L +L++ +  Y+ 
Sbjct: 175 NIEIEAKLSKEQVLVLRMSMQTSFLKNKPLEKKVKHLLLEACSMIIQLTDLQNVILQYIS 234

Query: 201 TRIQMVAPNLCALLGPDTAAKLVTHCGSVKELSVVPSCNLASIGQDKTL-HGKSLDISGV 259
           + +  +APNLC L+GP+ A+ L+ H G + +L+ +PSCNLASIG+++ L H     +SGV
Sbjct: 235 SNVSDIAPNLCVLVGPEVASLLIAHTGGILQLAEIPSCNLASIGKNRHLSHELHTTLSGV 294

Query: 260 RQKGYLFYTDVVQTQPPEFQKQALRMVSAKVALAARADCTMGNQVINPDGNSDGNSDASK 319
           RQ+GY++ +++VQ QP +  KQ LRMV AKVALAAR D               G   A+K
Sbjct: 295 RQEGYIYSSELVQNQPIQNHKQMLRMVCAKVALAARVDA--------------GQRGAAK 340

Query: 320 ---LGLKWRHEIVEKLKKIIDPPNISNIKPLPIPEDAPKKKRAGRRFRKYKEQFKMSHLR 376
              LG +WR E+  K++K+ + PNISN+KPLPIPED PKKKRAGR+FRKYK+QF++SHLR
Sbjct: 341 NDLLGQRWREELETKIQKVTESPNISNVKPLPIPEDKPKKKRAGRKFRKYKQQFQLSHLR 400

Query: 377 QMQNRMEFGKEEQTTMDPYGEEIGFGMADSKNVSALSSF--------NKTKMRKSMRLRL 428
           Q+QNRMEFGK+EQ+TMD +GEEIG GM  S    ++           N  K+ K M+ RL
Sbjct: 401 QLQNRMEFGKQEQSTMDAFGEEIGMGMTSSSIQQSIGGIRASSQRVDNSAKITKVMKRRL 460

Query: 429 DQETKNTHSF 438
            +    +  F
Sbjct: 461 KEADSQSKEF 470

>YGR091W (PRP31) [2051] chr7 (666343..667827) Protein required for
           pre-mRNA splicing, associated with U4/U6.U5 tri-snRNP
           [1485 bp, 494 aa]
          Length = 494

 Score =  281 bits (719), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 145/370 (39%), Positives = 231/370 (62%), Gaps = 33/370 (8%)

Query: 92  LGQLMPLFDTELSMVFQCIVDTYKAKFPGLETIVPERKQYVDVVKMLQ-QDIPNVQLDQV 150
             +++PL  + + ++   ++  Y  +FP L +++P   QY  V+ +L+ ++    + D++
Sbjct: 98  FNEIIPLIKSNIKLMHNFLISLYSRRFPELSSLIPSPLQYSKVISILENENYSKNESDEL 157

Query: 151 ---------LSKEETLVVSMSLKTDFKEGARIDKDLLSKAIHWFDILYNL---RDNVSHY 198
                    L++E+ LV++MS+KT FK    +D    ++ +    IL NL   ++++  Y
Sbjct: 158 FFHLENKAKLTREQILVLTMSMKTSFKNKEPLDIKTRTQILEANSILENLWKLQEDIGQY 217

Query: 199 VETRIQMVAPNLCALLGPDTAAKLVTHCGSVKELSVVPSCNLASIGQDKTL-HGKSLDIS 257
           + ++I ++APN+C L+GP+ AA+L+ H G V E S +PSCN+ASIG++K L H      S
Sbjct: 218 IASKISIIAPNVCFLVGPEIAAQLIAHAGGVLEFSRIPSCNIASIGKNKHLSHELHTLES 277

Query: 258 GVRQKGYLFYTDVVQTQPPEFQKQALRMVSAKVALAARADCTMGNQVINPDGNSDGNSDA 317
           GVRQ+GYLF +D++Q  P    KQ LRM+ AKV+LAAR D           G  +G+ + 
Sbjct: 278 GVRQEGYLFASDMIQKFPVSVHKQMLRMLCAKVSLAARVDA----------GQKNGDRN- 326

Query: 318 SKLGLKWRHEIVEKLKKIIDPPNISNIKPLPIPEDAPKKKRAGRRFRKYKEQFKMSHLRQ 377
           + L  KW+ E+ +K +K+ + P+IS  K LPIPED PKKKRAGR+FRKYKE+F++SH+RQ
Sbjct: 327 TVLAHKWKAELSKKARKLSEAPSISETKALPIPEDQPKKKRAGRKFRKYKEKFRLSHVRQ 386

Query: 378 MQNRMEFGKEEQTTMDPYGEEIGFGMADSKNVSAL--------SSFNKTKMRKSMRLRLD 429
           +QNRMEFGK+EQT +D YGEE+G GM+++    A+        S+ N+ K+ K M+ R+ 
Sbjct: 387 LQNRMEFGKQEQTVLDSYGEEVGLGMSNTSLQQAVGATSGSRRSAGNQAKLTKVMKHRIS 446

Query: 430 QETKNTHSFL 439
           +  +    FL
Sbjct: 447 EANQQADEFL 456

>CAGL0G03025g 280230..281669 similar to sp|P49704 Saccharomyces
           cerevisiae YGR091w PRP31 pre-mRNA splicing protein,
           hypothetical start
          Length = 479

 Score =  245 bits (626), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 141/319 (44%), Positives = 201/319 (63%), Gaps = 31/319 (9%)

Query: 110 IVDTYKAKFPGLETIVPERKQYVDVVKMLQQDIPNVQLDQVL---------SKEETLVVS 160
           + + Y+ KF  L++I+    QY   + +L+Q    ++L+QV+         S+E  +V++
Sbjct: 131 LTEIYEDKFSELKSILRLPHQYAQCISLLEQ---GLELEQVVLRFEELCSTSRELIMVLN 187

Query: 161 MSLKTDFKEGARIDKDLLSKAIHWF-DILYNLRD---NVSHYVETRIQMVAPNLCALLGP 216
           MSL+ D+K   ++  D   K++H    I++   D    VS  +  RI  +APNLCALLG 
Sbjct: 188 MSLRADYKGNYKL-TDTNKKSLHKLTSIIFEAHDIIRFVSVEIANRIGEIAPNLCALLGT 246

Query: 217 DTAAKLVTHCGSVKELSVVPSCNLASIGQDKTLHGKSLDISGVRQKGYLFYTDVVQTQPP 276
           +TA+ LV+H G + +LS +PSCN+A+IG+  T     L+ S     GY+F  ++VQ QP 
Sbjct: 247 NTASLLVSHTGGLLQLSKIPSCNIANIGKKNTKDHNILNFSN--PGGYIFQNELVQNQPI 304

Query: 277 EFQKQALRMVSAKVALAARADCTMGNQVINPDGNSDGNSDASKLGLKWRHEIVEKLKKII 336
           E  KQ +RM+S+KV+LAAR D  +           D N+   KLG +WR EI EK+KKI 
Sbjct: 305 ENHKQMMRMLSSKVSLAARVDAGLKT--------GDKNN---KLGKQWRVEIEEKIKKIR 353

Query: 337 DPPNISNIKPLPIPEDAPKKKRAGRRFRKYKEQFKMSHLRQMQNRMEFGKEEQTTMDPYG 396
            PPNIS++K LPIPED PKKKRAGR+FRKYKEQFK+S  RQ+QNRM FGK+E T  D +G
Sbjct: 354 APPNISDVKALPIPEDKPKKKRAGRKFRKYKEQFKLSGTRQLQNRMVFGKQEATIYDTFG 413

Query: 397 EEIGFGM-ADSKNVSALSS 414
           +E+G GM +  KN  A+S+
Sbjct: 414 DEVGLGMTSQRKNGLAIST 432

>ADR032W [1773] [Homologous to ScYGR091W (PRP31) - SH]
           complement(763163..764482) [1320 bp, 439 aa]
          Length = 439

 Score =  153 bits (386), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 85/243 (34%), Positives = 143/243 (58%), Gaps = 21/243 (8%)

Query: 92  LGQLMPLFDTELSMVFQCIVDTYKAKFPGLETIVPERKQYVDVVKMLQQDIPNVQLDQVL 151
           LGQL+P+   E + V++ +   Y+  FP L  +VP ++ YV V++ L+   P   LD++L
Sbjct: 67  LGQLLPVLRDEAADVYRQLEARYRPVFPELAELVPSQRTYVRVLRALETGAP---LDELL 123

Query: 152 SKEETLVVSMSL-KTDFKEGARIDKDLLSKAIHWFDILYNLRDNVSHYVETRIQMVAPNL 210
           ++E+ ++V+M+  +    + AR  ++L   A    + L+   D +  ++  +   +AP +
Sbjct: 124 TREQAMLVAMTRPQAPRADPARWPRELAPHADR-HEQLHTAVDAIDAHIVRQAHRLAPTV 182

Query: 211 CALLGPDTAAKLVTHCGSVKELSVVPSCNLASIGQDK-TLHGKSLDISGVRQKGYLFYTD 269
            AL+GP  AA L++H GSV+EL+ VP+CNLA+IG  +   H +  D SGVR +G+++ T 
Sbjct: 183 TALVGPVVAAALLSHAGSVRELAQVPACNLAAIGAPRHAAHARRTDASGVRLRGHVWDTP 242

Query: 270 VVQTQPPEFQKQALRMVSAKVALAARADCTMGNQVINPDGNSDGNSDASKLGLKWRHEIV 329
           +VQ QPP  Q+QALRM+ A++ALAAR D +       PD           L  +WR +I+
Sbjct: 243 LVQEQPPALQRQALRMLCARLALAARVDAS------APD---------PALAARWRADIL 287

Query: 330 EKL 332
            ++
Sbjct: 288 ARI 290

>AFR328C [3520] [Homologous to ScYOR310C (NOP58) - SH]
           (1032031..1033572) [1542 bp, 513 aa]
          Length = 513

 Score = 62.4 bits (150), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 53/250 (21%), Positives = 113/250 (45%), Gaps = 14/250 (5%)

Query: 89  VIKLGQLMPLFDTELSMVFQCIVDTYKAKFPGLETIVPERKQYVDVVKML--QQDIPNVQ 146
           +I+   L+   D EL+       + Y   FP L  IV +   +  ++  +  + +     
Sbjct: 163 IIQAIALLDDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAFARIILTMGVRSNAAETD 222

Query: 147 LDQVLSKE-ETLVVSMSLKTDFKEGARIDKDLLSKAIHWFDILYNLRDNVSHYVETRIQM 205
           + ++L +E E  V S +  +   E  ++D D +             R+ +S+Y+ +R++ 
Sbjct: 223 MSEILPEEIEERVKSAAEVSMGTEITQVDLDNIKSLAEQIVEFAAYREQLSNYLSSRMKA 282

Query: 206 VAPNLCALLGPDTAAKLVTHCGSVKELSVVPSCNLASIGQDKTLHGKSLDISGVRQKGYL 265
           +APNL  L+G    A+L+ H GS+  L+  P+  +  +G +K L           + G L
Sbjct: 283 IAPNLTQLVGELVGARLIAHAGSLVSLAKAPASTIQILGAEKALFRALKTKHDTPKYGLL 342

Query: 266 FYTDVVQTQPPEFQKQALRMVSAKVALAARADCTMGNQVINPDGNSDGNSDASKLGLKWR 325
           ++  +V     + + +  R+++AK A++ R D             ++   D+  +GL+ R
Sbjct: 343 YHASLVGQATGKNKGKIARVLAAKAAVSLRYDAL-----------AEDRDDSGDIGLEAR 391

Query: 326 HEIVEKLKKI 335
            ++  +L ++
Sbjct: 392 AKVESRLSQL 401

>YOR310C (NOP58) [5094] chr15 complement(896820..898355) Nucleolar
           protein component of box C/D snoRNPs, which are
           necessary for 2'-O-methylation of ribosomal RNAs,
           component of U3 snoRNP (also called small subunit
           processome), which is required for 18S rRNA biogenesis
           [1536 bp, 511 aa]
          Length = 511

 Score = 61.6 bits (148), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 54/254 (21%), Positives = 116/254 (45%), Gaps = 22/254 (8%)

Query: 89  VIKLGQLMPLFDTELSMVFQCIVDTYKAKFPGLETIVPERKQYVDVV-------KMLQQD 141
           +I+   L+   D EL+       + Y   FP L  IV +   Y  ++       K  + D
Sbjct: 163 IIQAIALLDDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRSKASETD 222

Query: 142 IPNVQLDQVLSKEETLVVSMSLKTDFKEGARIDKDLLSKAIHWFDILYNLRDNVSHYVET 201
           +  +  +++  + +T    +S+ T+  +    + + L++ I  F      R+ +S+Y+  
Sbjct: 223 LSEILPEEIEERVKT-AAEVSMGTEITQTDLDNINALAEQIVEF---AAYREQLSNYLSA 278

Query: 202 RIQMVAPNLCALLGPDTAAKLVTHCGSVKELSVVPSCNLASIGQDKTLHGKSLDISGVRQ 261
           R++ +APNL  L+G    A+L+ H GS+  L+  P+  +  +G +K L           +
Sbjct: 279 RMKAIAPNLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPK 338

Query: 262 KGYLFYTDVVQTQPPEFQKQALRMVSAKVALAARADCTMGNQVINPDGNSDGNSDASKLG 321
            G L++  +V     + + +  R+++AK A++ R D             ++   D+  +G
Sbjct: 339 YGLLYHASLVGQATGKNKGKIARVLAAKAAVSLRYDAL-----------AEDRDDSGDIG 387

Query: 322 LKWRHEIVEKLKKI 335
           L+ R ++  +L ++
Sbjct: 388 LESRAKVENRLSQL 401

>KLLA0F08613g complement(801623..803158) similar to sp|Q12499
           Saccharomyces cerevisiae YOR310c NOP58 required for
           pre-18S rRNA processing, start by similarity
          Length = 511

 Score = 61.6 bits (148), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 54/254 (21%), Positives = 116/254 (45%), Gaps = 22/254 (8%)

Query: 89  VIKLGQLMPLFDTELSMVFQCIVDTYKAKFPGLETIVPERKQYVDVVKML-------QQD 141
           +I+   L+   D EL+       + Y   FP L  IV +   Y  ++  +       + D
Sbjct: 163 IIQAIALLDDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRVNAAETD 222

Query: 142 IPNVQLDQVLSKEETLVVSMSLKTDFKEGARIDKDLLSKAIHWFDILYNLRDNVSHYVET 201
           +  +  +++  + +T    +S+ T+      I+   L++ I  F      R+ +S+Y+ +
Sbjct: 223 MSEILPEEIEERVKT-AAEVSMGTEITPVDLINIKCLAEQIVEFA---AYREQLSNYLSS 278

Query: 202 RIQMVAPNLCALLGPDTAAKLVTHCGSVKELSVVPSCNLASIGQDKTLHGKSLDISGVRQ 261
           R++ +APNL  L+G    A+L+ H GS+  L+  P+  +  +G +K L           +
Sbjct: 279 RMKAIAPNLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPK 338

Query: 262 KGYLFYTDVVQTQPPEFQKQALRMVSAKVALAARADCTMGNQVINPDGNSDGNSDASKLG 321
            G L++  +V     + + +  R+++AK A++ R D             ++   D+  +G
Sbjct: 339 YGLLYHASLVGQASGKNKGKIARVLAAKAAVSLRYDAL-----------AEDRDDSGDIG 387

Query: 322 LKWRHEIVEKLKKI 335
           L+ R ++  +L ++
Sbjct: 388 LESRAKVESRLSQL 401

>Kwal_34.15894
          Length = 512

 Score = 60.8 bits (146), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 54/250 (21%), Positives = 111/250 (44%), Gaps = 14/250 (5%)

Query: 89  VIKLGQLMPLFDTELSMVFQCIVDTYKAKFPGLETIVPERKQYVDVVKML--QQDIPNVQ 146
           +I+   L+   D EL+       + Y   FP L  IV +   +  ++  +  + +     
Sbjct: 163 IIQAIALLDDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAFARIILTMGVRSNAAETD 222

Query: 147 LDQVLSKE-ETLVVSMSLKTDFKEGARIDKDLLSKAIHWFDILYNLRDNVSHYVETRIQM 205
           L ++L +E E  V S +  +   E   +D D +             R+ +S+Y+  R++ 
Sbjct: 223 LSEILPEEIEERVKSAAEISMGTEITSVDLDNIKSLATQITEFAAYREQLSNYLSARMKA 282

Query: 206 VAPNLCALLGPDTAAKLVTHCGSVKELSVVPSCNLASIGQDKTLHGKSLDISGVRQKGYL 265
           +APNL  L+G    A+L+ H GS+  L+  P+  +  +G +K L           + G L
Sbjct: 283 IAPNLTQLVGELVGARLIAHAGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLL 342

Query: 266 FYTDVVQTQPPEFQKQALRMVSAKVALAARADCTMGNQVINPDGNSDGNSDASKLGLKWR 325
           ++  +V     + + +  R+++AK A++ R D             ++   D+  +GL+ R
Sbjct: 343 YHASLVGQATGKNKGKIARVLAAKAAVSLRYDAL-----------AEDRDDSGDIGLESR 391

Query: 326 HEIVEKLKKI 335
            ++  +L ++
Sbjct: 392 SKVESRLSQL 401

>Scas_665.12
          Length = 515

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 55/254 (21%), Positives = 113/254 (44%), Gaps = 22/254 (8%)

Query: 89  VIKLGQLMPLFDTELSMVFQCIVDTYKAKFPGLETIVPERKQYVDVV-------KMLQQD 141
           +I+   L+   D EL+       + Y   FP L  IV +   Y  ++       K    D
Sbjct: 163 IIQAIALLDDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRSKAADTD 222

Query: 142 IPNVQLDQVLSKEETLVVSMSLKTDFKEGARIDKDLLSKAIHWFDILYNLRDNVSHYVET 201
           +  +  +++  + +T    +S+ T+  +    +   L+  I  F      R+ +S+Y+  
Sbjct: 223 MSEILPEEIEERVKT-AAEVSMGTEITQLDLENIKCLADQIVEF---AAYREQLSNYLSA 278

Query: 202 RIQMVAPNLCALLGPDTAAKLVTHCGSVKELSVVPSCNLASIGQDKTLHGKSLDISGVRQ 261
           R++ +APNL  L+G    A+L+ H GS+  L+  P+  +  +G +K L           +
Sbjct: 279 RMKAIAPNLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPK 338

Query: 262 KGYLFYTDVVQTQPPEFQKQALRMVSAKVALAARADCTMGNQVINPDGNSDGNSDASKLG 321
            G L++  +V     + + +  R+++AK A++ R D             ++   DA  +G
Sbjct: 339 YGLLYHASLVGQATGKNKGKIARVLAAKAAVSIRYDAL-----------AEDRDDAGDIG 387

Query: 322 LKWRHEIVEKLKKI 335
           L+ R ++  +L ++
Sbjct: 388 LESRAKVENRLSQL 401

>ACL144C [905] [Homologous to ScYLR197W (SIK1) - SH] (94809..96458)
           [1650 bp, 549 aa]
          Length = 549

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/222 (22%), Positives = 103/222 (46%), Gaps = 16/222 (7%)

Query: 88  NVIKLGQLMPLFDTELSMVFQCIVDTYKAKFPGLETIVPERKQYVDVVKMLQ-----QDI 142
           ++I+   L+   D +++     + + Y   FP L  +VP+  ++  +V  ++      D 
Sbjct: 172 HIIQAIALLDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDE 231

Query: 143 PNVQLDQVLSKEETL---VVS---MSLKTDFKEGARIDKDLLSKAIHWFDILYNLRDNVS 196
               L  +L ++  +   V+S   +S+  D  E   +D + +S        L   R  + 
Sbjct: 232 SLHDLSAILGEDAGIAERVISNARISMGQDLSE---VDMENVSVFAERVVNLVEYRRQLY 288

Query: 197 HYVETRIQMVAPNLCALLGPDTAAKLVTHCGSVKELSVVPSCNLASIGQDKTLHGKSLDI 256
            Y+  ++  VAPNL  L+G    A+L++H GS+  LS   +  +  +G +K L  ++L  
Sbjct: 289 EYLCEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALF-RALKT 347

Query: 257 SGVRQK-GYLFYTDVVQTQPPEFQKQALRMVSAKVALAARAD 297
            G   K G ++++  +     + + +  R ++ K ++A+R D
Sbjct: 348 KGNTPKYGLIYHSGFISKASAKNKGRISRYLANKCSMASRID 389

>Kwal_56.24654
          Length = 507

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/220 (21%), Positives = 99/220 (45%), Gaps = 12/220 (5%)

Query: 88  NVIKLGQLMPLFDTELSMVFQCIVDTYKAKFPGLETIVPERKQYVDVVKMLQQDIPNVQL 147
           ++I+   L+   D +++     + + Y   FP L  +VP+  ++  +V +  +D  ++  
Sbjct: 172 HIIQAIALLDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLV-LFIKDKASLSE 230

Query: 148 DQVLSKEETLVVSMSLKTDFKEGARI---------DKDLLSKAIHWFDILYNLRDNVSHY 198
           D +      L     +     + ARI         D D +         L + R  +  Y
Sbjct: 231 DSLHDLSAILDNDAGIAERVIDNARISMGQDLSETDMDNVCVFAERVTSLADYRRQLYEY 290

Query: 199 VETRIQMVAPNLCALLGPDTAAKLVTHCGSVKELSVVPSCNLASIGQDKTLHGKSLDISG 258
           + +++  VAPNL  L+G    A+L++H GS+  LS   +  +  +G +K L  ++L   G
Sbjct: 291 LCSKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALF-RALKTKG 349

Query: 259 VRQK-GYLFYTDVVQTQPPEFQKQALRMVSAKVALAARAD 297
              K G ++++  +     + + +  R ++ K ++A+R D
Sbjct: 350 NTPKYGLIYHSGFIGKAAAKNKGRISRYLANKCSIASRID 389

>KLLA0D12254g 1045077..1046618 highly similar to sp|Q12460
           Saccharomyces cerevisiae YLR197w SIK1 involved in
           pre-rRNA processing, start by similarity
          Length = 513

 Score = 52.4 bits (124), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 48/220 (21%), Positives = 100/220 (45%), Gaps = 12/220 (5%)

Query: 88  NVIKLGQLMPLFDTELSMVFQCIVDTYKAKFPGLETIVPERKQYVDVVKMLQQDIPNVQL 147
           ++I+   L+   D +++     + + Y   FP L  +VP+  ++  +V +  +D  ++  
Sbjct: 172 HIIQAIALLDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLV-LFIKDKASLNE 230

Query: 148 DQVLSKEETLVVSMSLKTDFKEGARID--KDLLSKAIHWFDI-------LYNLRDNVSHY 198
           + +    E L     +     + ARI   +DL    +    I       L   R  +  Y
Sbjct: 231 ESLHDLSEILDNDAGISERVIDNARISMGQDLSETDMENVTIFAKRVVSLVEYRKQLYDY 290

Query: 199 VETRIQMVAPNLCALLGPDTAAKLVTHCGSVKELSVVPSCNLASIGQDKTLHGKSLDISG 258
           +  ++  VAPNL  L+G    A+L++H GS+  LS   +  +  +G +K L  ++L   G
Sbjct: 291 LCEKMHTVAPNLSELIGEVIGARLISHSGSLTNLSKQAASTVQILGAEKALF-RALKTKG 349

Query: 259 VRQK-GYLFYTDVVQTQPPEFQKQALRMVSAKVALAARAD 297
              K G ++++  +     + + +  R ++ K ++A+R D
Sbjct: 350 NTPKYGLIYHSGFIAKASAKNKGRISRYLANKCSMASRID 389

>CAGL0I09790g complement(934746..936287) highly similar to sp|Q12499
           Saccharomyces cerevisiae YOR310c, start by similarity
          Length = 513

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 78/168 (46%), Gaps = 11/168 (6%)

Query: 89  VIKLGQLMPLFDTELSMVFQCIVDTYKAKFPGLETIVPERKQYVDVV-------KMLQQD 141
           +I+   L+   D E++       + Y   FP L  IV +   Y  ++       K  + D
Sbjct: 163 IIQAIALLDDLDKEVNTYSMRCKEWYGWHFPELAKIVTDSVAYARLILTMGVRSKAAETD 222

Query: 142 IPNVQLDQVLSKEETLVVSMSLKTDFKEGARIDKDLLSKAIHWFDILYNLRDNVSHYVET 201
           +  + L + + +       +S+ T+  +   I+   L+  I  F      R+ +S+Y+ +
Sbjct: 223 MSEI-LPEEIEERVKAAAEVSMGTEITDVDLINIRALADQIVEFA---AYREQLSNYLSS 278

Query: 202 RIQMVAPNLCALLGPDTAAKLVTHCGSVKELSVVPSCNLASIGQDKTL 249
           R++ +APNL  L+G    A+L+ H GS+  L+  P+  +  +G +K L
Sbjct: 279 RMKAIAPNLTQLVGELVGARLIAHAGSLISLAKSPASTIQILGAEKAL 326

>Sklu_1985.1 YLR197W, Contig c1985 148-1644 reverse complement
          Length = 498

 Score = 49.7 bits (117), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 45/222 (20%), Positives = 101/222 (45%), Gaps = 16/222 (7%)

Query: 88  NVIKLGQLMPLFDTELSMVFQCIVDTYKAKFPGLETIVPERKQYVDVVKMLQ-------- 139
           ++I+   L+   D +++     + + Y   FP L  +VP+  ++  +V  ++        
Sbjct: 172 HIIQAIALLDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEE 231

Query: 140 --QDIPNVQLDQVLSKEETL-VVSMSLKTDFKEGARIDKDLLSKAIHWFDILYNLRDNVS 196
              D+ ++  D     E  +    +S+  D  E    +  + ++ +     L + R  + 
Sbjct: 232 SLHDLASILNDDAGIAERVIDNARISMGQDLSETDMENVCIFAERVVS---LADYRRQLY 288

Query: 197 HYVETRIQMVAPNLCALLGPDTAAKLVTHCGSVKELSVVPSCNLASIGQDKTLHGKSLDI 256
            Y+  ++  VAPNL  L+G    A+L++H GS+  LS   +  +  +G +K L  ++L  
Sbjct: 289 DYLCEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALF-RALKT 347

Query: 257 SGVRQK-GYLFYTDVVQTQPPEFQKQALRMVSAKVALAARAD 297
            G   K G ++++  +     + + +  R ++ K ++A+R D
Sbjct: 348 KGNTPKYGLIYHSGFIAKASAKNKGRISRYLANKCSMASRID 389

>Scas_537.7
          Length = 510

 Score = 49.7 bits (117), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 45/222 (20%), Positives = 99/222 (44%), Gaps = 16/222 (7%)

Query: 88  NVIKLGQLMPLFDTELSMVFQCIVDTYKAKFPGLETIVPERKQYVDVVKMLQ-------- 139
           ++I+   L+   D +++     + + Y   FP L  +VP+  ++  +V  ++        
Sbjct: 172 HIIQAIALLDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNDE 231

Query: 140 --QDIPNVQLDQVLSKEETL-VVSMSLKTDFKEGARIDKDLLSKAIHWFDILYNLRDNVS 196
              D+  +  D     E  +    +S+  D  E    +  + ++ +     L   R  + 
Sbjct: 232 SLHDLAAILNDDAGIAERVIDNARISMGQDISETDMENVGVFAQRVVS---LVEYRKQLY 288

Query: 197 HYVETRIQMVAPNLCALLGPDTAAKLVTHCGSVKELSVVPSCNLASIGQDKTLHGKSLDI 256
            Y+  ++  VAPNL  L+G    A+L++H GS+  LS   +  +  +G +K L  ++L  
Sbjct: 289 DYLCEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALF-RALKT 347

Query: 257 SGVRQK-GYLFYTDVVQTQPPEFQKQALRMVSAKVALAARAD 297
            G   K G ++++  +     + + +  R ++ K ++A+R D
Sbjct: 348 KGNTPKYGLIYHSGFIAKASAKNKGRISRYLANKCSMASRID 389

>CAGL0A04015g complement(397378..398904) similar to sp|Q12460
           Saccharomyces cerevisiae YLR197w SIK1 involved in
           pre-rRNA processing, hypothetical start
          Length = 508

 Score = 49.7 bits (117), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 58/111 (52%), Gaps = 2/111 (1%)

Query: 188 LYNLRDNVSHYVETRIQMVAPNLCALLGPDTAAKLVTHCGSVKELSVVPSCNLASIGQDK 247
           L + R  +  Y+  ++  VAPNL  L+G    A+L++H GS+  LS   +  +  +G +K
Sbjct: 279 LVDYRKQLYDYLCEKMHTVAPNLSGLIGEVIGARLISHAGSLTSLSKQAASTVQILGAEK 338

Query: 248 TLHGKSLDISGVRQK-GYLFYTDVVQTQPPEFQKQALRMVSAKVALAARAD 297
            L  ++L   G   K G ++++  +     + + +  R ++ K ++A+R D
Sbjct: 339 ALF-RALKTKGNTPKYGLIYHSGFIAKASAKNKGRISRYLANKCSMASRID 388

>YLR197W (SIK1) [3600] chr12 (546099..547613) Nucleolar protein
           component of box C/D snoRNPs, which are necessary for
           2'-O-methylation of ribosomal RNAs, component of U3
           snoRNP (also called small subunit processome), which is
           required for 18S rRNA biogenesis [1515 bp, 504 aa]
          Length = 504

 Score = 48.9 bits (115), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 46/220 (20%), Positives = 100/220 (45%), Gaps = 12/220 (5%)

Query: 88  NVIKLGQLMPLFDTELSMVFQCIVDTYKAKFPGLETIVPERKQYVDVVKMLQQDIPNVQL 147
           ++I+   L+   D +++     + + Y   FP L  +VP+   +  +V +  +D  ++  
Sbjct: 173 HIIQAIALLDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYTFAKLV-LFIKDKASLND 231

Query: 148 DQVLSKEETLVVSMSLKTDFKEGARI-------DKDLLSKAIHWFDI--LYNLRDNVSHY 198
           D +      L     +     + ARI       + D+ +  +    +  L + R  +  Y
Sbjct: 232 DSLHDLAALLNEDSGIAQRVIDNARISMGQDISETDMENVCVFAQRVASLADYRRQLYDY 291

Query: 199 VETRIQMVAPNLCALLGPDTAAKLVTHCGSVKELSVVPSCNLASIGQDKTLHGKSLDISG 258
           +  ++  VAPNL  L+G    A+L++H GS+  LS   +  +  +G +K L  ++L   G
Sbjct: 292 LCEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALF-RALKTKG 350

Query: 259 VRQK-GYLFYTDVVQTQPPEFQKQALRMVSAKVALAARAD 297
              K G ++++  +     + + +  R ++ K ++A+R D
Sbjct: 351 NTPKYGLIYHSGFISKASAKNKGRISRYLANKCSMASRID 390

>CAGL0I04862g complement(438338..442861) highly similar to sp|P32568
           Saccharomyces cerevisiae YDR011w SNQ2 multidrug
           resistance protein, hypothetical start
          Length = 1507

 Score = 30.8 bits (68), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 45/103 (43%), Gaps = 23/103 (22%)

Query: 173 IDKDLLSKAIH-WFDILYN---------LRDNVSHYVETRIQMVAPNLCALLGPDTAAKL 222
           I ++L SK I  W ++ Y          L DNVS + +         L AL+G   A K 
Sbjct: 847 IFEELESKGIFIWRNVCYTIPYDGGMRQLLDNVSGFCK------PGTLTALMGESGAGKT 900

Query: 223 VTHCGSVKELSVVPSCNLASIGQDKTLHGKSLDISGVRQKGYL 265
                    L+ +   N+  I  D  ++GK +DIS  R+ GY+
Sbjct: 901 TL-------LNTLAQRNVGIITGDMLVNGKPIDISFERRTGYV 936

>Kwal_55.21515
          Length = 567

 Score = 30.0 bits (66), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 6/71 (8%)

Query: 269 DVVQTQPPEFQ-KQALRMVSAKVALAARADCTMGNQVINPDGNSDGNSDASKLGLKWRHE 327
           ++ QTQ  E + K+ L  +SA++    +             GNSD N+ ASKL  KW  +
Sbjct: 359 ELAQTQEAEAESKKELSKLSARLEYITKEFVK-----FRETGNSDENTSASKLNEKWSEK 413

Query: 328 IVEKLKKIIDP 338
                +K++D 
Sbjct: 414 YQRMKQKLLDE 424

>Scas_544.4
          Length = 524

 Score = 29.6 bits (65), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 35/72 (48%), Gaps = 5/72 (6%)

Query: 277 EFQKQALRMVSAKVALAARADCTMGNQVINPDGNSDGNSDASKLGLKWRHEIVEKLKKII 336
           EF K  LRM + +V L   AD  +G+  INP    +  + +    LK     +  ++KII
Sbjct: 317 EFTKLDLRMKNIEVDLKRLADKKIGSMCINPQRPYEIATGSLDRTLK-----IWDIRKII 371

Query: 337 DPPNISNIKPLP 348
           + P+ S  +  P
Sbjct: 372 EKPDWSQYEDFP 383

>Sklu_2251.5 YNL032W, Contig c2251 2992-3792 reverse complement
          Length = 266

 Score = 29.3 bits (64), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 34/171 (19%), Positives = 69/171 (40%), Gaps = 20/171 (11%)

Query: 19  DDGLSGVTSGITSGIATESDILPS-----PSVSNLISDFHAQFWHQGADLDDLIQLAKHE 73
           ++G+     G+ SG      +L           ++I  FH        D DDL    +H 
Sbjct: 27  EEGILAAKLGLDSGTVDVHKVLKEDPELQKEFESVIEKFHQTQVRNEEDTDDLYDAEEHN 86

Query: 74  TIIRDATNHTTEPYNVIKLGQLMPLFDTELSMVFQCIVDTYKAKFPGLE--TIVPERKQY 131
           +   +A  H          GQ   +     S +   + D Y++ FP LE  + + +R + 
Sbjct: 87  SKTIEALEHK---------GQEEVVPPENFSHI---VGDIYRSSFPRLENFSFLRDRIRL 134

Query: 132 VDVVKMLQQDIPNVQLDQVLSKEETLVVSMSLKTDFKEGARIDKDLLSKAI 182
             ++ ++ +D P   L + + + +  +  + +  + +    I  DLL+KA+
Sbjct: 135 KSILVLIPEDYPQENL-EFMEQADIKLFQVGMSGNKEPFVNIPSDLLTKAL 184

>Kwal_23.5161
          Length = 1489

 Score = 29.3 bits (64), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 37/81 (45%), Gaps = 15/81 (18%)

Query: 191 LRDNVSHYVETRIQMVAP-NLCALLGPDTAAKLVTHCGSVKELSVVPSCNLASIGQDKTL 249
           L DNVS Y        AP +L AL+G   A K          L+ +   N+  I  D  +
Sbjct: 863 LLDNVSGYC-------APGSLTALMGESGAGKTTL-------LNTLAQRNVGIITGDMLV 908

Query: 250 HGKSLDISGVRQKGYLFYTDV 270
           +GK +D S  R+ GY+   DV
Sbjct: 909 NGKPIDASFERRTGYVQQQDV 929

>Scas_694.25
          Length = 751

 Score = 29.3 bits (64), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 44/217 (20%), Positives = 90/217 (41%), Gaps = 40/217 (18%)

Query: 177 LLSKAIHWFDILYNLRDNVSHYVETRIQMVAPNLCALLGPD--TAAKLVTHCGSVKELSV 234
           L S+  +W+ +L+   D         + +   ++ A  G +  ++  LV  CG+ +E  V
Sbjct: 142 LQSQRSNWYQLLFECFDI------PEVTLGIDSMFAFYGLNERSSTGLVIDCGN-EETDV 194

Query: 235 VPSCNLASIGQDKTLHGKSLDISGVRQKGYLFYTDVVQTQPPEFQKQALRMVSAKVALAA 294
           +P    A +  D     K ++  G +   YL   D++  + P F     ++ +A+     
Sbjct: 195 IPVVEGAGMLTD----AKRINWGGRQAVDYL--NDLLTLKYPYF---PTKLSTAQYQRVY 245

Query: 295 RADCTMG---NQVINPDGNSDGNSDASKLGLKWRHEIVEKLKKIIDPPNISNIKPLPIPE 351
           +  C +    +Q I    N D               ++EK   +I+ P    ++P    E
Sbjct: 246 QDYCYVAKDYDQEIQTILNLD---------------VLEKKNVVIEAPFTEVLQPQKTEE 290

Query: 352 D----APKKKRAGRRFRKYKEQFKMSHLRQMQNRMEF 384
           +    A K+K +G+R ++  +Q ++  L Q +   E+
Sbjct: 291 ELRIQAEKRKESGKRLQEQAKQKRIEKLVQKEEEYEY 327

>Scas_706.34
          Length = 350

 Score = 28.9 bits (63), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 21/34 (61%)

Query: 325 RHEIVEKLKKIIDPPNISNIKPLPIPEDAPKKKR 358
           + +++   K  +DPPN +  KP PIP+  P++ +
Sbjct: 18  KKDLIPCSKMFVDPPNKATYKPPPIPKLTPEQNK 51

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.132    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 15,270,714
Number of extensions: 676134
Number of successful extensions: 2635
Number of sequences better than 10.0: 48
Number of HSP's gapped: 2643
Number of HSP's successfully gapped: 48
Length of query: 460
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 355
Effective length of database: 12,961,219
Effective search space: 4601232745
Effective search space used: 4601232745
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 63 (28.9 bits)