Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0D14509g36035516620.0
Sklu_2248.436233211321e-155
Kwal_55.2080734329211251e-154
YMR010W40534010721e-145
Scas_717.243792929441e-126
ADR022W3573179311e-125
CAGL0K08822g4512979341e-124
YDR352W31749910.002
AFR605C31559780.092
Sklu_1971.229057750.23
Sklu_2437.130552740.31
KLLA0C03762g30652730.41
Scas_658.1531151710.71
CAGL0I07689g30952700.86
Scas_628.230552700.93
CAGL0A02508g31631691.3
ACL106C27340671.8
Kwal_55.2153829449671.9
Scas_653.9374179672.5
CAGL0L06710g32951662.6
Scas_652.2*73188654.8
Kwal_56.2262330852644.9
YBR147W29652645.3
KLLA0E21736g31959619.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D14509g
         (355 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D14509g 1230053..1231135 similar to sp|Q03687 Saccharomyces...   644   0.0  
Sklu_2248.4 YMR010W, Contig c2248 8114-9202                           440   e-155
Kwal_55.20807                                                         437   e-154
YMR010W (YMR010W) [3974] chr13 (285099..286316) Protein possibly...   417   e-145
Scas_717.24                                                           368   e-126
ADR022W [1763] [Homologous to ScYMR010W - SH] complement(744266....   363   e-125
CAGL0K08822g 884170..885525 similar to sp|Q03687 Saccharomyces c...   364   e-124
YDR352W (YDR352W) [1179] chr4 (1181790..1182743) Protein contain...    40   0.002
AFR605C [3797] [Homologous to ScYOL092W - SH; ScYBR147W - SH] (1...    35   0.092
Sklu_1971.2 YDR352W, Contig c1971 2812-3684                            33   0.23 
Sklu_2437.1 YOL092W, Contig c2437 3219-4136 reverse complement         33   0.31 
KLLA0C03762g 342637..343557 similar to sgd|S0005452 Saccharomyce...    33   0.41 
Scas_658.15                                                            32   0.71 
CAGL0I07689g 738658..739587 similar to tr|Q12010 Saccharomyces c...    32   0.86 
Scas_628.2                                                             32   0.93 
CAGL0A02508g 264398..265348 similar to tr|Q06328 Saccharomyces c...    31   1.3  
ACL106C [943] [Homologous to ScYDR352W - SH] (153775..154596) [8...    30   1.8  
Kwal_55.21538                                                          30   1.9  
Scas_653.9                                                             30   2.5  
CAGL0L06710g complement(756297..757286) similar to tr|Q12010 Sac...    30   2.6  
Scas_652.2*                                                            30   4.8  
Kwal_56.22623                                                          29   4.9  
YBR147W (YBR147W) [332] chr2 (536531..537421) Protein containing...    29   5.3  
KLLA0E21736g complement(1931058..1932017) similar to sgd|S000276...    28   9.9  

>KLLA0D14509g 1230053..1231135 similar to sp|Q03687 Saccharomyces
           cerevisiae YMR010w singleton, start by similarity
          Length = 360

 Score =  644 bits (1662), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/355 (92%), Positives = 328/355 (92%)

Query: 1   MEIAKRIVXXXXXXXXXXXXXGYFSKIDQFYIPEWLTMQFVANNLISFTPLFSYGTTVLA 60
           MEIAKRIV             GYFSKIDQFYIPEWLTMQFVANNLISFTPLFSYGTTVLA
Sbjct: 1   MEIAKRIVEAAAEAASDDASEGYFSKIDQFYIPEWLTMQFVANNLISFTPLFSYGTTVLA 60

Query: 61  IHKSQTSLGFSLDICATMLIASILRVSYYLITPYEITLLRQSIVMILIQLILLKVALNYR 120
           IHKSQTSLGFSLDICATMLIASILRVSYYLITPYEITLLRQSIVMILIQLILLKVALNYR
Sbjct: 61  IHKSQTSLGFSLDICATMLIASILRVSYYLITPYEITLLRQSIVMILIQLILLKVALNYR 120

Query: 121 PEDAKYENLEPVETLSELLQDVWEQYFPANPFDVYSTDWKPLLKSLSWKNLLGFGYKIVL 180
           PEDAKYENLEPVETLSELLQDVWEQYFPANPFDVYSTDWKPLLKSLSWKNLLGFGYKIVL
Sbjct: 121 PEDAKYENLEPVETLSELLQDVWEQYFPANPFDVYSTDWKPLLKSLSWKNLLGFGYKIVL 180

Query: 181 VCVYKFLKFFDPSFKRFKGFWQWNDDLMYWKFLLVFGSLQFFITLIISKVFNWESFSQWI 240
           VCVYKFLKFFDPSFKRFKGFWQWNDDLMYWKFLLVFGSLQFFITLIISKVFNWESFSQWI
Sbjct: 181 VCVYKFLKFFDPSFKRFKGFWQWNDDLMYWKFLLVFGSLQFFITLIISKVFNWESFSQWI 240

Query: 241 GSLIGSLGLFIESLLPLPQISIFYKLKSVQGFKLIILVSWLCGDILKISYLVFGASNISV 300
           GSLIGSLGLFIESLLPLPQISIFYKLKSVQGFKLIILVSWLCGDILKISYLVFGASNISV
Sbjct: 241 GSLIGSLGLFIESLLPLPQISIFYKLKSVQGFKLIILVSWLCGDILKISYLVFGASNISV 300

Query: 301 IFLCFGLFQMSLDXXXXXXXXXXXXXXPSLRHDEENPEIMSSKEELELRDLSSLQ 355
           IFLCFGLFQMSLD              PSLRHDEENPEIMSSKEELELRDLSSLQ
Sbjct: 301 IFLCFGLFQMSLDIYIACQYIYYKYYYPSLRHDEENPEIMSSKEELELRDLSSLQ 355

>Sklu_2248.4 YMR010W, Contig c2248 8114-9202
          Length = 362

 Score =  440 bits (1132), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 216/332 (65%), Positives = 267/332 (80%), Gaps = 10/332 (3%)

Query: 22  GYFSKIDQFYIPEWLTMQFVANNLISFTPLFSYGTTVLAIHKSQTSLGFSLDICATMLIA 81
            Y  ++DQFYIPEWLTMQF+ANNLISFTPLFSYGTTVL+I +S+T+LGFS+DICATML+A
Sbjct: 27  SYLPRVDQFYIPEWLTMQFIANNLISFTPLFSYGTTVLSIERSKTALGFSIDICATMLLA 86

Query: 82  SILRVSYYLITPYEITLLRQSIVMILIQLILLKVALNYRPEDAKYENLEPVETLSELLQD 141
           SILRVSYY+ITPYE+TLLRQS+VMI+IQL+LL+ +L YRPE+ KY+NL  VE  ++LLQD
Sbjct: 87  SILRVSYYIITPYELTLLRQSLVMIVIQLLLLRTSLYYRPEEYKYDNLTTVEPFTQLLQD 146

Query: 142 VWEQYFPANPFDVYSTDWKPLLKSLSWKNLLGFGYKIVLVCVYKFLKFFDPSFKRFKGFW 201
           VW +YFP NPF    T W+  LKSLS+KN+L F  K++L+ VYKFLKFFDPSFKRFK FW
Sbjct: 147 VWLEYFPLNPF---GTQWRETLKSLSYKNMLRFVCKVLLIFVYKFLKFFDPSFKRFKSFW 203

Query: 202 QWNDDLMYWKFLLVFGSLQFFITLIISKVFNWESFSQWIGSLIGSLGLFIESLLPLPQIS 261
           QWND+  YWKFL+VF + Q   T++ISK+ +W   +QWIGS+IG+LGL IE+LLPLPQIS
Sbjct: 204 QWNDESKYWKFLVVFSTGQLCFTVLISKIIHWNELAQWIGSMIGALGLLIEALLPLPQIS 263

Query: 262 IFYKLKSVQGFKLIILVSWLCGDILKISYLVFGASNISVIFLCFGLFQMSLDXXXXXXXX 321
           I YKLK+VQGFKL++LVSWLCGD+LKISYLVFGA NISV+FL F LFQMSLD        
Sbjct: 264 ILYKLKTVQGFKLVLLVSWLCGDVLKISYLVFGAKNISVLFLFFALFQMSLDIYIGGQYI 323

Query: 322 XXXXXXPSLRHDEENPEIMSSKEELELRDLSS 353
                 PSLR++       SS+E +E+ ++ +
Sbjct: 324 YYKFYYPSLRNE-------SSEESIEMAEMRT 348

>Kwal_55.20807
          Length = 343

 Score =  437 bits (1125), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 213/292 (72%), Positives = 249/292 (85%), Gaps = 3/292 (1%)

Query: 22  GYFSKIDQFYIPEWLTMQFVANNLISFTPLFSYGTTVLAIHKSQTSLGFSLDICATMLIA 81
            YF +IDQFYIPEWLTMQFV NN+ISFTPL SYGTTVL+I KS+T+LGFSLDICATML+A
Sbjct: 17  SYFPRIDQFYIPEWLTMQFVLNNMISFTPLLSYGTTVLSIRKSKTALGFSLDICATMLLA 76

Query: 82  SILRVSYYLITPYEITLLRQSIVMILIQLILLKVALNYRPEDAKYENLEPVETLSELLQD 141
           SILR+SYYLITPY+ITLLRQS+VMI IQLILL+ +L+YRPE  KYENLEPVE L++LL D
Sbjct: 77  SILRISYYLITPYDITLLRQSLVMIFIQLILLRTSLHYRPEQYKYENLEPVEPLTQLLHD 136

Query: 142 VWEQYFPANPFDVYSTDWKPLLKSLSWKNLLGFGYKIVLVCVYKFLKFFDPSFKRFKGFW 201
           VW +YFP NPF    +DW+ L+KSLS+K  L F YKIVLV +YKFLKFFDPS++RF+ FW
Sbjct: 137 VWLEYFPLNPF---GSDWRHLIKSLSYKGFLDFTYKIVLVLIYKFLKFFDPSYRRFRSFW 193

Query: 202 QWNDDLMYWKFLLVFGSLQFFITLIISKVFNWESFSQWIGSLIGSLGLFIESLLPLPQIS 261
           QW+ D  +W FL  F + Q  ITL +SK+ NWESFSQWIGS+IGSLGL IESLLPLPQIS
Sbjct: 194 QWDQDSKFWIFLAYFATAQITITLFVSKIMNWESFSQWIGSVIGSLGLLIESLLPLPQIS 253

Query: 262 IFYKLKSVQGFKLIILVSWLCGDILKISYLVFGASNISVIFLCFGLFQMSLD 313
           I  KLKS QGFKLI+LVSWLCGD++KISYL+FGA+NIS +FL F +FQMSLD
Sbjct: 254 ILNKLKSTQGFKLILLVSWLCGDVVKISYLIFGANNISALFLFFAMFQMSLD 305

>YMR010W (YMR010W) [3974] chr13 (285099..286316) Protein possibly
           required for full induction of IME1 during early meiosis
           [1218 bp, 405 aa]
          Length = 405

 Score =  417 bits (1072), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 207/340 (60%), Positives = 253/340 (74%), Gaps = 6/340 (1%)

Query: 22  GYFSKIDQFYIPEWLTMQFVANNLISFTPLFSYGTTVLAIHKSQTSLGFSLDICATMLIA 81
            Y  K+DQFYIPEWLTMQF+ANNLISFTPLFSYGTT+++I K +T+LGFS+DICATMLIA
Sbjct: 33  SYLPKVDQFYIPEWLTMQFIANNLISFTPLFSYGTTIISIEKCKTALGFSIDICATMLIA 92

Query: 82  SILRVSYYLITPYEITLLRQSIVMILIQLILLKVALNYRPEDAKYENLEPVETLSELLQD 141
           SILR+SYYLITPYEITLLRQS+VMI IQLILL+ +L YRP++ KY+NL  VE+LS L+ D
Sbjct: 93  SILRISYYLITPYEITLLRQSLVMIFIQLILLRTSLKYRPDEYKYQNLTDVESLSHLIHD 152

Query: 142 VWEQYFPA-NPFDVYSTDWKPLLKSLSWKNLLGFGYKIVLVCVYKFLKFFDPSFKRFKGF 200
           +W ++F   N     S DWK L+KSLS+ NLL F +KI L   YK LKFFDP+FKR   F
Sbjct: 153 IWFEFFSCINRPKFLSEDWKNLIKSLSFTNLLKFSFKIFLAFFYKILKFFDPNFKRIGAF 212

Query: 201 WQWNDDLMYWKFLLVFGSLQFFITLIISKVFNWESFSQWIGSLIGSLGLFIESLLPLPQI 260
           WQW+DD  +W+FL +F ++Q  +T  IS + NW+S +Q +GS+IGSLGL +ESLLPLPQI
Sbjct: 213 WQWDDDKNFWRFLALFATVQILVTFFISNILNWDSLAQGLGSIIGSLGLLVESLLPLPQI 272

Query: 261 SIFYKLKSVQGFKLIILVSWLCGDILKISYLVFGASNISVIFLCFGLFQMSLDXXXXXXX 320
           +I YKLKSVQGFKLI+LVSWLCGD LKI+YL+FGA NIS +F+ F LFQMSLD       
Sbjct: 273 AILYKLKSVQGFKLILLVSWLCGDTLKITYLIFGAKNISALFVIFALFQMSLDFYIGGQY 332

Query: 321 XXXXXXXPSLRH-----DEENPEIMSSKEELELRDLSSLQ 355
                  P LRH     D  +P      E  EL   ++LQ
Sbjct: 333 IYYRYYYPKLRHQHHPNDSNSPSDEDESEMYELDLFNTLQ 372

>Scas_717.24
          Length = 379

 Score =  368 bits (944), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 184/292 (63%), Positives = 230/292 (78%), Gaps = 6/292 (2%)

Query: 22  GYFSKIDQFYIPEWLTMQFVANNLISFTPLFSYGTTVLAIHKSQTSLGFSLDICATMLIA 81
            Y  ++DQFYIPEWLTMQF+ANNLISFTPLFSYGTT+++I KS+T+LGFS+DICATMLIA
Sbjct: 27  SYLPRVDQFYIPEWLTMQFIANNLISFTPLFSYGTTIISIEKSKTALGFSIDICATMLIA 86

Query: 82  SILRVSYYLITPYEITLLRQSIVMILIQLILLKVALNYRPEDAKYENLEPVETLSELLQD 141
           SILRVSYYLI+PYEITLLRQ++VMI IQLILLK +L YRP++ KY NL+ VET S+L ++
Sbjct: 87  SILRVSYYLISPYEITLLRQALVMIFIQLILLKTSLKYRPDEYKYHNLKSVETFSQLFKE 146

Query: 142 VWEQYFPANPFDVYSTDWKPLLKSLSWKNLLGFGYKIVLVCVYKFLKFFDPSFKRFKGFW 201
           +W + F +        ++  L +      +  F YK +L+ +YKFLKFFDPS+KRF  FW
Sbjct: 147 IWYESFQSVSLSHEEDNFSALTR------ICKFLYKFLLIFLYKFLKFFDPSYKRFGSFW 200

Query: 202 QWNDDLMYWKFLLVFGSLQFFITLIISKVFNWESFSQWIGSLIGSLGLFIESLLPLPQIS 261
           QW+ +  +WKFLL+F  LQ  +T  IS + NW S   ++GS+IGSLGLFIE+LLPLPQIS
Sbjct: 201 QWDKNRTFWKFLLIFTFLQMIVTFSISNILNWSSLESFLGSVIGSLGLFIEALLPLPQIS 260

Query: 262 IFYKLKSVQGFKLIILVSWLCGDILKISYLVFGASNISVIFLCFGLFQMSLD 313
           I  KLKS+QGFKLI+LVSWLCGD LKI+YL+FGA NIS++F  F  FQMSLD
Sbjct: 261 ILNKLKSIQGFKLILLVSWLCGDTLKITYLMFGAKNISMLFFFFAFFQMSLD 312

>ADR022W [1763] [Homologous to ScYMR010W - SH]
           complement(744266..745339) [1074 bp, 357 aa]
          Length = 357

 Score =  363 bits (931), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 182/317 (57%), Positives = 224/317 (70%), Gaps = 3/317 (0%)

Query: 23  YFSKIDQFYIPEWLTMQFVANNLISFTPLFSYGTTVLAIHKSQTSLGFSLDICATMLIAS 82
           Y+ +IDQFYIP WL +QF+ANN+ISFTPLFSYGTTV  I +S+T LG  +DICATMLIA 
Sbjct: 28  YWPRIDQFYIPPWLDVQFLANNIISFTPLFSYGTTVCIIKRSKTVLGIFIDICATMLIAC 87

Query: 83  ILRVSYYLITPYEITLLRQSIVMILIQLILLKVALNYRPEDAKYENLEPVETLSELLQDV 142
           ILRVSY LITPYE+ L R S+ MI +QLILL  ++ YRP + KYE+L+PV+   +L QDV
Sbjct: 88  ILRVSYNLITPYEVALFRYSLAMIFMQLILLYTSMCYRPVEYKYESLKPVDRFGQLSQDV 147

Query: 143 WEQYFPANPFDVYSTDWKPLLKSLSWKNLLGFGYKIVLVCVYKFLKFFDPSFKRFKGFWQ 202
           W+++FP          WK + +++SW +  G+  K++LV +YKFLKFFDP ++R   FWQ
Sbjct: 148 WQEFFPLCSM---GAGWKGIWQAMSWNSFAGYMEKMLLVALYKFLKFFDPGYQRIGAFWQ 204

Query: 203 WNDDLMYWKFLLVFGSLQFFITLIISKVFNWESFSQWIGSLIGSLGLFIESLLPLPQISI 262
           WN+   +W FLL F   QF +T  I++V N E   QW+GS IGSLGL IE+LLPLPQISI
Sbjct: 205 WNNPRYFWLFLLWFTCGQFLMTFFIARVMNLEWLGQWLGSFIGSLGLLIEALLPLPQISI 264

Query: 263 FYKLKSVQGFKLIILVSWLCGDILKISYLVFGASNISVIFLCFGLFQMSLDXXXXXXXXX 322
            + LKSVQGFKLI+LVSWLCGDILKISYLVFGA NIS+IF  F LFQM LD         
Sbjct: 265 LHTLKSVQGFKLILLVSWLCGDILKISYLVFGAKNISMIFFLFALFQMGLDIYIAFIYVY 324

Query: 323 XXXXXPSLRHDEENPEI 339
                P  R   E P I
Sbjct: 325 YKYYFPKYRRKSEPPRI 341

>CAGL0K08822g 884170..885525 similar to sp|Q03687 Saccharomyces
           cerevisiae YMR010w, hypothetical start
          Length = 451

 Score =  364 bits (934), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 177/297 (59%), Positives = 229/297 (77%), Gaps = 6/297 (2%)

Query: 23  YFSKIDQFYIPEWLTMQFVANNLISFTPLFSYGTTVLAIHKSQTSLGFSLDICATMLIAS 82
           Y  K+DQFYIPEWLTM+ +   + S TPLFSYG  +L+I + QT+ GFS+DICATMLIAS
Sbjct: 39  YLPKLDQFYIPEWLTMRVLTGYIYSCTPLFSYGAAILSIERCQTAFGFSIDICATMLIAS 98

Query: 83  ILRVSYYLITPYEITLLRQSIVMILIQLILLKVALNYRPEDAKYENLEPVETLSELLQDV 142
           ILR+SY+   PYE+TLLRQSI+M+L+QL+LL+  L YRPE+ KY+NL+ VE  ++L+ DV
Sbjct: 99  ILRISYFFFVPYEVTLLRQSIIMVLVQLLLLRTTLKYRPEEYKYDNLQSVEPFTQLIHDV 158

Query: 143 WEQYFP-ANPFDVYSTDWKPLLKSLSWKNLLGFGYKIVLVCVYKFLKFFDPSFKRFKGFW 201
           W +YF   N   ++S +WK LL+SLS++ L+GF +KI LV VYKFLKFFDPSFKR   FW
Sbjct: 159 WFEYFAIRNKPRMFSDEWKNLLRSLSFERLMGFIFKIFLVFVYKFLKFFDPSFKRVGSFW 218

Query: 202 QWNDDLMYWKFLLVFGSLQFFITLIISKVFNWESFSQWIGSLIGSLGLFIESLLPLPQIS 261
           QWNDD  YWKFL++F + QF  TL+I+KV  WE+F+  +GSLIG + L +ESLLPLPQIS
Sbjct: 219 QWNDDRKYWKFLIIFATFQFSFTLLITKVIAWENFAHNVGSLIGGISLLVESLLPLPQIS 278

Query: 262 IFYKLKSVQGFKLIILVSWLCGDILKISYLV---FGASNI--SVIFLCFGLFQMSLD 313
           I +KLKSVQGFK+I+L+SWLCGD +K+S+L+    G  N+  S +F  F LFQM LD
Sbjct: 279 ILHKLKSVQGFKIILLISWLCGDTVKLSFLLSLNSGEKNVDTSSLFEFFALFQMGLD 335

>YDR352W (YDR352W) [1179] chr4 (1181790..1182743) Protein containing
           two PQ loop repeat domains, has low similarity to S.
           pombe Stm1p, which is a G protein-coupled receptor that
           acts as a nutrient sensor for sexual diffentiation and
           stress response pathways [954 bp, 317 aa]
          Length = 317

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 27/49 (55%)

Query: 240 IGSLIGSLGLFIESLLPLPQISIFYKLKSVQGFKLIILVSWLCGDILKI 288
           + +L GSL  F   +   PQI   Y+ KSV G     L++WLCGDI  +
Sbjct: 11  VSNLCGSLSFFTSVISLFPQIIETYRDKSVDGLSPYFLLAWLCGDITSL 59

>AFR605C [3797] [Homologous to ScYOL092W - SH; ScYBR147W - SH]
           (1530918..1531865) [948 bp, 315 aa]
          Length = 315

 Score = 34.7 bits (78), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 33/59 (55%), Gaps = 4/59 (6%)

Query: 230 VFNWESFSQWIGSLIGSLGLFIESLLPLPQISIFYKLKSVQGFKLIILVSWLCGDILKI 288
           VFN E+ S     + GS+ +    ++ +PQI   ++ KS +G  L+ +V WL GDI  +
Sbjct: 5   VFNSETIS----GITGSISIACWVIVFVPQIYENFRRKSAEGLSLLFVVLWLAGDIFNL 59

>Sklu_1971.2 YDR352W, Contig c1971 2812-3684
          Length = 290

 Score = 33.5 bits (75), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 31/57 (54%), Gaps = 6/57 (10%)

Query: 233 WESFSQWIGSLIGSLGLFIESLLP-LPQISIFYKLKSVQGFKLIILVSWLCGDILKI 288
           W S S   GS+      FI S +  +PQ+   YK K+V+G   I L++WL GDI  +
Sbjct: 8   WPSVSAAAGSVS-----FITSFIAQIPQLIETYKDKTVEGLSPIFLLAWLFGDITSL 59

>Sklu_2437.1 YOL092W, Contig c2437 3219-4136 reverse complement
          Length = 305

 Score = 33.1 bits (74), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 29/52 (55%)

Query: 237 SQWIGSLIGSLGLFIESLLPLPQISIFYKLKSVQGFKLIILVSWLCGDILKI 288
           SQ +  + GS+ +    ++ +PQI   +  KS +G  L+ +V WL GDI  +
Sbjct: 8   SQTVSGITGSISIACWVIVFVPQIYENFYRKSAEGLSLLFVVLWLAGDIFNL 59

>KLLA0C03762g 342637..343557 similar to sgd|S0005452 Saccharomyces
           cerevisiae YOL092w, start by similarity
          Length = 306

 Score = 32.7 bits (73), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 29/52 (55%)

Query: 237 SQWIGSLIGSLGLFIESLLPLPQISIFYKLKSVQGFKLIILVSWLCGDILKI 288
           SQ +  + GS+ +    ++ +PQI   +  KS +G  L+ +V WL GDI  +
Sbjct: 10  SQTVSGITGSISIACWIIVFVPQIYENFYRKSAEGLSLMFVVLWLAGDIFNL 61

>Scas_658.15
          Length = 311

 Score = 32.0 bits (71), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 240 IGSLIGSLGLFIESLLPL-PQISIFYKLKSVQGFKLIILVSWLCGDILKIS 289
           + ++ GS+  F+ S + L PQI   Y  K+V G     L++WLCGDI  ++
Sbjct: 11  VSNVNGSIA-FVSSFISLLPQILETYHDKTVVGLSPWFLLAWLCGDITSLT 60

>CAGL0I07689g 738658..739587 similar to tr|Q12010 Saccharomyces
           cerevisiae YOL092w, hypothetical start
          Length = 309

 Score = 31.6 bits (70), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 28/52 (53%)

Query: 237 SQWIGSLIGSLGLFIESLLPLPQISIFYKLKSVQGFKLIILVSWLCGDILKI 288
           SQ +  + GS+ +    ++ +PQI   +  KS  G  L+ +V WL GD+  +
Sbjct: 11  SQAVSGIAGSVSIACWVVVFVPQIYENFYRKSADGLSLLFVVLWLAGDVFNL 62

>Scas_628.2
          Length = 305

 Score = 31.6 bits (70), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 28/52 (53%)

Query: 237 SQWIGSLIGSLGLFIESLLPLPQISIFYKLKSVQGFKLIILVSWLCGDILKI 288
           +Q +  + GS+ +    ++ +PQI   +  KS  G  L+ +V WL GD+  +
Sbjct: 10  AQNVSGMAGSISIACWVIVFMPQIYENFYRKSADGLSLLFVVLWLAGDVFNV 61

>CAGL0A02508g 264398..265348 similar to tr|Q06328 Saccharomyces
           cerevisiae YDR352w, start by similarity
          Length = 316

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%)

Query: 258 PQISIFYKLKSVQGFKLIILVSWLCGDILKI 288
           PQI   YK K+V+G   + L+ WL GDI  +
Sbjct: 29  PQIIETYKDKTVEGLSPLFLMCWLSGDITSL 59

>ACL106C [943] [Homologous to ScYDR352W - SH] (153775..154596) [822
           bp, 273 aa]
          Length = 273

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 1/40 (2%)

Query: 250 FIESLLP-LPQISIFYKLKSVQGFKLIILVSWLCGDILKI 288
           F  SL+  +PQ+   YK KSV G   + L+ W+ GDI  +
Sbjct: 24  FTTSLVASIPQVVETYKEKSVDGLSPLCLLCWISGDITTL 63

>Kwal_55.21538
          Length = 294

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 27/49 (55%)

Query: 240 IGSLIGSLGLFIESLLPLPQISIFYKLKSVQGFKLIILVSWLCGDILKI 288
           I ++ GS+      +  +PQ+   Y  K+V+G   + L++WL GDI  +
Sbjct: 11  ISTIAGSISFLSSFVAQIPQVLETYVDKTVEGLSPLFLLAWLMGDITTL 59

>Scas_653.9
          Length = 374

 Score = 30.4 bits (67), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 40/179 (22%), Positives = 76/179 (42%), Gaps = 36/179 (20%)

Query: 89  YLITPYEITLLRQSIVMILIQLILLKVALNYRPEDAKYENLEPVETLSELLQDVWEQYFP 148
           +L  P+ I L+ +   ++L     ++  +N  P+D++ + L  V+   +L+Q+ W+Q   
Sbjct: 112 FLSQPHIIELI-ECYELLLNHFHSMQKRVN--PDDSREDELNHVKISKDLIQEKWDQII- 167

Query: 149 ANPFDVYSTDWKPLLKSLSWKNLLGFGYKIVLV-----CVYKF-------LKFFDPSFKR 196
                    DW P +  L    L     ++ ++     C  +F       LK+ D +   
Sbjct: 168 --------NDWIPSIDKLK---LTKRSNRLPVISEDEYCCARFVCETLFRLKYMDQNSIN 216

Query: 197 FKGFW--QWNDDLMYWKF-------LLVFGSLQFFITLIISKVFNWESFSQWIGSLIGS 246
           FK F+  Q N+     +F       +LVF +L   +   +   F+  SF   +GS  G+
Sbjct: 217 FKSFYSLQSNEVSKMERFPILLHFQILVFKTLYILLPSFLRDRFSVTSFRHILGSEYGN 275

>CAGL0L06710g complement(756297..757286) similar to tr|Q12010
           Saccharomyces cerevisiae YOL092w or sp|P38279
           Saccharomyces cerevisiae YBR147w, start by similarity
          Length = 329

 Score = 30.0 bits (66), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 27/51 (52%)

Query: 238 QWIGSLIGSLGLFIESLLPLPQISIFYKLKSVQGFKLIILVSWLCGDILKI 288
           + +  + GS+ +    ++  PQI   ++ KS  G  L+ ++ WL GDI  I
Sbjct: 11  RTVSEIAGSISIACWVVVFAPQIYENFRRKSSDGLSLMFIILWLIGDIFNI 61

>Scas_652.2*
          Length = 731

 Score = 29.6 bits (65), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 40/88 (45%), Gaps = 3/88 (3%)

Query: 140 QDVWEQYFPANP--FDVYSTDWKPLLKSLSWKNLLGFGYKIVLVCVYKFLKFFDPSFKRF 197
           + VW  +FP +P   DV +   + +  ++     L +G+  V+  + KFL F +    R 
Sbjct: 74  KQVWPAFFPDSPPITDVETVFVQSMAVAVG-TGPLAYGFVGVIPAIEKFLTFEESGGSRT 132

Query: 198 KGFWQWNDDLMYWKFLLVFGSLQFFITL 225
           +G     + L+ W   L F  + F + L
Sbjct: 133 QGESFTLNQLLLWSLALAFFGIFFAVPL 160

>Kwal_56.22623
          Length = 308

 Score = 29.3 bits (64), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 27/52 (51%)

Query: 237 SQWIGSLIGSLGLFIESLLPLPQISIFYKLKSVQGFKLIILVSWLCGDILKI 288
           SQ +  + GS+ +    ++ +PQI   +   S  G  L+ +V WL GDI  +
Sbjct: 8   SQTVSGITGSISIACWIIVFVPQIYENFYRHSADGLSLLFVVLWLLGDIFNL 59

>YBR147W (YBR147W) [332] chr2 (536531..537421) Protein containing
           two PQ loop repeat domains, has low similarity to S.
           pombe Stm1p, which is a G protein-coupled receptor that
           acts as a nutrient sensor for sexual diffentiation and
           stress response pathways [891 bp, 296 aa]
          Length = 296

 Score = 29.3 bits (64), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 30/52 (57%)

Query: 237 SQWIGSLIGSLGLFIESLLPLPQISIFYKLKSVQGFKLIILVSWLCGDILKI 288
           ++ +  + GS+ +    ++ +PQI   ++ +S +G  L+ +V WL GDI  +
Sbjct: 10  AKNLSGMAGSISICCWIVVFVPQIYENFRRQSAEGLSLLFIVLWLLGDIFNV 61

>KLLA0E21736g complement(1931058..1932017) similar to sgd|S0002760
           Saccharomyces cerevisiae YDR352w, start by similarity
          Length = 319

 Score = 28.1 bits (61), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 30/59 (50%), Gaps = 2/59 (3%)

Query: 232 NWESFSQWIGSLIGSLGL-FIESLLP-LPQISIFYKLKSVQGFKLIILVSWLCGDILKI 288
            W   S W    + S G+ F+ S +  +PQ+   Y+ KSV+G     L+ WL GDI  +
Sbjct: 5   TWCDKSLWPQISVASGGISFLTSFVAQIPQLIETYRDKSVEGLSPGFLLCWLFGDITSL 63

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.327    0.143    0.442 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,519,792
Number of extensions: 434381
Number of successful extensions: 1515
Number of sequences better than 10.0: 33
Number of HSP's gapped: 1517
Number of HSP's successfully gapped: 33
Length of query: 355
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 252
Effective length of database: 13,030,455
Effective search space: 3283674660
Effective search space used: 3283674660
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 62 (28.5 bits)