Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0D11242g53452628380.0
Sklu_2168.454049723530.0
YMR015C (ERG5)53852522670.0
CAGL0M07656g53549522350.0
Scas_709.5352349522210.0
ABR053C51547220260.0
Kwal_26.817233633615590.0
KLLA0E03553g5272182092e-17
YHR007C (ERG11)5302241942e-15
ADR162W5292041932e-15
Sklu_2436.115321801914e-15
Kwal_47.183235362231888e-15
CAGL0E04334g5332441889e-15
Scas_699.205382231665e-12
AFR400C4942051112e-05
CAGL0F02607g4981561042e-04
Sklu_1634.3524207960.001
KLLA0C06743g513206850.026
AFR661W117925693.0
Scas_653.875237683.5
KLLA0C19206g511189665.2
Kwal_26.832362771656.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D11242g
         (526 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D11242g complement(959973..961577) highly similar to sp|P54...  1097   0.0  
Sklu_2168.4 YMR015C, Contig c2168 6356-7978 reverse complement        910   0.0  
YMR015C (ERG5) [3979] chr13 complement(300868..302484) Cytochrom...   877   0.0  
CAGL0M07656g 765772..767379 highly similar to sp|P54781 Saccharo...   865   0.0  
Scas_709.53                                                           860   0.0  
ABR053C [644] [Homologous to ScYMR015C (ERG5) - SH] (492258..493...   785   0.0  
Kwal_26.8172                                                          605   0.0  
KLLA0E03553g 329904..331487 highly similar to sp|P10614 Saccharo...    85   2e-17
YHR007C (ERG11) [2293] chr8 complement(120085..121677) Cytochrom...    79   2e-15
ADR162W [1904] [Homologous to ScYHR007C (ERG11) - SH] complement...    79   2e-15
Sklu_2436.11 YHR007C, Contig c2436 26015-27613 reverse complement      78   4e-15
Kwal_47.18323                                                          77   8e-15
CAGL0E04334g complement(415351..416952) highly similar to sp|P10...    77   9e-15
Scas_699.20                                                            69   5e-12
AFR400C [3592] [Homologous to ScYDR402C (DIT2) - SH] (1156683..1...    47   2e-05
CAGL0F02607g complement(253736..255232) similar to sp|P21595 Sac...    45   2e-04
Sklu_1634.3 YDR402C, Contig c1634 2102-3676 reverse complement         42   0.001
KLLA0C06743g complement(590585..592126) similar to sp|P21595 Sac...    37   0.026
AFR661W [3854] [Homologous to ScYGL140C - NSH] complement(164245...    31   3.0  
Scas_653.8                                                             31   3.5  
KLLA0C19206g 1711813..1713348 weakly similar to sp|O48923 Glycin...    30   5.2  
Kwal_26.8323                                                           30   6.7  

>KLLA0D11242g complement(959973..961577) highly similar to sp|P54781
           Saccharomyces cerevisiae YMR015c ERG5 C-22 sterol
           desaturase, start by similarity
          Length = 534

 Score = 1097 bits (2838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/526 (100%), Positives = 526/526 (100%)

Query: 1   MDNIVVSQTSNATQVASEASVKLFSLANAQQLVETVQQMSYFKLFCTLVAIVIVWDQVSY 60
           MDNIVVSQTSNATQVASEASVKLFSLANAQQLVETVQQMSYFKLFCTLVAIVIVWDQVSY
Sbjct: 1   MDNIVVSQTSNATQVASEASVKLFSLANAQQLVETVQQMSYFKLFCTLVAIVIVWDQVSY 60

Query: 61  QIQKGNIAGPKWKVWPVIGPFLESFDPKFEEYLAKWNSGPLSCVSIFHKFVVIASTRDLA 120
           QIQKGNIAGPKWKVWPVIGPFLESFDPKFEEYLAKWNSGPLSCVSIFHKFVVIASTRDLA
Sbjct: 61  QIQKGNIAGPKWKVWPVIGPFLESFDPKFEEYLAKWNSGPLSCVSIFHKFVVIASTRDLA 120

Query: 121 RKIFQSPQYVKPCVVDVAVKILRPSNWVFLDGKEHVDYRKSLNGLFTKQALAKYMPSQEL 180
           RKIFQSPQYVKPCVVDVAVKILRPSNWVFLDGKEHVDYRKSLNGLFTKQALAKYMPSQEL
Sbjct: 121 RKIFQSPQYVKPCVVDVAVKILRPSNWVFLDGKEHVDYRKSLNGLFTKQALAKYMPSQEL 180

Query: 181 LMDKYIEKFIELSKENKYEARVFFHDMREIMCALSLKAFCGDYITEDQIRKVADDYYLVT 240
           LMDKYIEKFIELSKENKYEARVFFHDMREIMCALSLKAFCGDYITEDQIRKVADDYYLVT
Sbjct: 181 LMDKYIEKFIELSKENKYEARVFFHDMREIMCALSLKAFCGDYITEDQIRKVADDYYLVT 240

Query: 241 AALELVNFPIIIPYTKTWYGKKTADMTMKIFEQCAQMAKDHIAAGGESTCVLDAWCSLMH 300
           AALELVNFPIIIPYTKTWYGKKTADMTMKIFEQCAQMAKDHIAAGGESTCVLDAWCSLMH
Sbjct: 241 AALELVNFPIIIPYTKTWYGKKTADMTMKIFEQCAQMAKDHIAAGGESTCVLDAWCSLMH 300

Query: 301 EAKNKDDADSKLYHREFTNREMSEAIFTFLFASQDASSSLACWIFQIIADRPDVMANIRE 360
           EAKNKDDADSKLYHREFTNREMSEAIFTFLFASQDASSSLACWIFQIIADRPDVMANIRE
Sbjct: 301 EAKNKDDADSKLYHREFTNREMSEAIFTFLFASQDASSSLACWIFQIIADRPDVMANIRE 360

Query: 361 EQLRVRNNDPNVKLSMDLIDEMKYTNMVVKETLRYRPPVIMVPYYVKKSFPVVPTYSAPK 420
           EQLRVRNNDPNVKLSMDLIDEMKYTNMVVKETLRYRPPVIMVPYYVKKSFPVVPTYSAPK
Sbjct: 361 EQLRVRNNDPNVKLSMDLIDEMKYTNMVVKETLRYRPPVIMVPYYVKKSFPVVPTYSAPK 420

Query: 421 GSMLIPTLYPALHDPEVYEDPDEFIPERWVEGSAANQAKKNWLVFGCGPHVCLGQTYVMQ 480
           GSMLIPTLYPALHDPEVYEDPDEFIPERWVEGSAANQAKKNWLVFGCGPHVCLGQTYVMQ
Sbjct: 421 GSMLIPTLYPALHDPEVYEDPDEFIPERWVEGSAANQAKKNWLVFGCGPHVCLGQTYVMQ 480

Query: 481 TFTGLIGKFAMFSDWEHKVTPLSEKIKVFATIFPKDDLLLSFKKRD 526
           TFTGLIGKFAMFSDWEHKVTPLSEKIKVFATIFPKDDLLLSFKKRD
Sbjct: 481 TFTGLIGKFAMFSDWEHKVTPLSEKIKVFATIFPKDDLLLSFKKRD 526

>Sklu_2168.4 YMR015C, Contig c2168 6356-7978 reverse complement
          Length = 540

 Score =  910 bits (2353), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/497 (83%), Positives = 469/497 (94%)

Query: 30  QQLVETVQQMSYFKLFCTLVAIVIVWDQVSYQIQKGNIAGPKWKVWPVIGPFLESFDPKF 89
           Q ++++VQ +SY+KLF T++ + +VWDQVSYQI+KG+IAGPKWKVWPVIGPFLES DPKF
Sbjct: 36  QNVIDSVQSISYWKLFVTIICVGLVWDQVSYQIKKGSIAGPKWKVWPVIGPFLESLDPKF 95

Query: 90  EEYLAKWNSGPLSCVSIFHKFVVIASTRDLARKIFQSPQYVKPCVVDVAVKILRPSNWVF 149
           EEY AKW+SGPLSCVSIFHKFVVIASTRDLARKI QSP++VKPCVVDVA+KILRPSNWVF
Sbjct: 96  EEYKAKWDSGPLSCVSIFHKFVVIASTRDLARKILQSPKFVKPCVVDVAIKILRPSNWVF 155

Query: 150 LDGKEHVDYRKSLNGLFTKQALAKYMPSQELLMDKYIEKFIELSKENKYEARVFFHDMRE 209
           LDGK+HVDYRKSLNGLFTK ALA+Y+PSQE +M+KY+EKF+ELSKENKYE +VFFH+MRE
Sbjct: 156 LDGKQHVDYRKSLNGLFTKSALAQYLPSQENVMNKYLEKFVELSKENKYEPQVFFHEMRE 215

Query: 210 IMCALSLKAFCGDYITEDQIRKVADDYYLVTAALELVNFPIIIPYTKTWYGKKTADMTMK 269
           IMCALSLKAFCGDYITEDQIRKVADDYYLVTAALELVNFPII+P+TKTWYGKKTADMTMK
Sbjct: 216 IMCALSLKAFCGDYITEDQIRKVADDYYLVTAALELVNFPIILPFTKTWYGKKTADMTMK 275

Query: 270 IFEQCAQMAKDHIAAGGESTCVLDAWCSLMHEAKNKDDADSKLYHREFTNREMSEAIFTF 329
           IFEQCAQMAKDHIA+GG +TCV+DAWC LMH+AKN++DADS+L HREF+N+E+SEAIFTF
Sbjct: 276 IFEQCAQMAKDHIASGGPTTCVMDAWCKLMHDAKNQNDADSRLLHREFSNKEISEAIFTF 335

Query: 330 LFASQDASSSLACWIFQIIADRPDVMANIREEQLRVRNNDPNVKLSMDLIDEMKYTNMVV 389
           LFASQDASSSLACW+FQI+ADRPDV+  IREEQL+VR NDP   LS+DLI+EMKYTNMVV
Sbjct: 336 LFASQDASSSLACWLFQIVADRPDVLEKIREEQLKVRENDPTKALSLDLIEEMKYTNMVV 395

Query: 390 KETLRYRPPVIMVPYYVKKSFPVVPTYSAPKGSMLIPTLYPALHDPEVYEDPDEFIPERW 449
           KE+LRYRPPV+MVPY VK+ FP+ P YSAPKGSMLIPTLYPALHDPEVYE+PDEFIPERW
Sbjct: 396 KESLRYRPPVLMVPYVVKQKFPIAPNYSAPKGSMLIPTLYPALHDPEVYENPDEFIPERW 455

Query: 450 VEGSAANQAKKNWLVFGCGPHVCLGQTYVMQTFTGLIGKFAMFSDWEHKVTPLSEKIKVF 509
           VEGS ANQAK+NWLVFG GPHVCLGQTYVM TFT LIGKFAM++D+EHKVTPLSEKIKVF
Sbjct: 456 VEGSPANQAKRNWLVFGSGPHVCLGQTYVMMTFTALIGKFAMYTDFEHKVTPLSEKIKVF 515

Query: 510 ATIFPKDDLLLSFKKRD 526
           ATIFPKDDLLLSFKKRD
Sbjct: 516 ATIFPKDDLLLSFKKRD 532

>YMR015C (ERG5) [3979] chr13 complement(300868..302484) Cytochrome
           P450, delta 22(23) sterol desaturase, catalyzes an
           intermediate pathway step in the biosynthesis of
           ergosterol [1617 bp, 538 aa]
          Length = 538

 Score =  877 bits (2267), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/525 (76%), Positives = 466/525 (88%)

Query: 2   DNIVVSQTSNATQVASEASVKLFSLANAQQLVETVQQMSYFKLFCTLVAIVIVWDQVSYQ 61
           +NI+   T N+T            +  A  +++T++ MSY K+F TL+ I++VWDQV+YQ
Sbjct: 6   ENIIQHATHNSTLHQLAKDQPSVGVTTAFSILDTLKSMSYLKIFATLICILLVWDQVAYQ 65

Query: 62  IQKGNIAGPKWKVWPVIGPFLESFDPKFEEYLAKWNSGPLSCVSIFHKFVVIASTRDLAR 121
           I+KG+IAGPK+K WP+IGPFLES DPKFEEY AKW SGPLSCVSIFHKFVVIASTRDLAR
Sbjct: 66  IKKGSIAGPKFKFWPIIGPFLESLDPKFEEYKAKWASGPLSCVSIFHKFVVIASTRDLAR 125

Query: 122 KIFQSPQYVKPCVVDVAVKILRPSNWVFLDGKEHVDYRKSLNGLFTKQALAKYMPSQELL 181
           KI QS ++VKPCVVDVAVKILRP NWVFLDGK H DYRKSLNGLFTKQALA+Y+PS E +
Sbjct: 126 KILQSSKFVKPCVVDVAVKILRPCNWVFLDGKAHTDYRKSLNGLFTKQALAQYLPSLEQI 185

Query: 182 MDKYIEKFIELSKENKYEARVFFHDMREIMCALSLKAFCGDYITEDQIRKVADDYYLVTA 241
           MDKY++KF+ LSKEN YE +VFFH+MREI+CALSL +FCG+YITEDQ+RK+ADDYYLVTA
Sbjct: 186 MDKYMDKFVRLSKENNYEPQVFFHEMREILCALSLNSFCGNYITEDQVRKIADDYYLVTA 245

Query: 242 ALELVNFPIIIPYTKTWYGKKTADMTMKIFEQCAQMAKDHIAAGGESTCVLDAWCSLMHE 301
           ALELVNFPIIIPYTKTWYGKKTADM MKIFE CAQMAKDHIAAGG+  CV+DAWC LMH+
Sbjct: 246 ALELVNFPIIIPYTKTWYGKKTADMAMKIFENCAQMAKDHIAAGGKPVCVMDAWCKLMHD 305

Query: 302 AKNKDDADSKLYHREFTNREMSEAIFTFLFASQDASSSLACWIFQIIADRPDVMANIREE 361
           AKN +D DS++YHREFTN+E+SEA+FTFLFASQDASSSLACW+FQI+ADRPDV+A IREE
Sbjct: 306 AKNSNDDDSRIYHREFTNKEISEAVFTFLFASQDASSSLACWLFQIVADRPDVLAKIREE 365

Query: 362 QLRVRNNDPNVKLSMDLIDEMKYTNMVVKETLRYRPPVIMVPYYVKKSFPVVPTYSAPKG 421
           QL VRNND + +L++DLI++MKYTNMV+KETLRYRPPV+MVPY VKK+FPV P Y+APKG
Sbjct: 366 QLAVRNNDMSTELNLDLIEKMKYTNMVIKETLRYRPPVLMVPYVVKKNFPVSPNYTAPKG 425

Query: 422 SMLIPTLYPALHDPEVYEDPDEFIPERWVEGSAANQAKKNWLVFGCGPHVCLGQTYVMQT 481
           +MLIPTLYPALHDPEVYE+PDEFIPERWVEGS A++AKKNWLVFGCGPHVCLGQTYVM T
Sbjct: 426 AMLIPTLYPALHDPEVYENPDEFIPERWVEGSKASEAKKNWLVFGCGPHVCLGQTYVMIT 485

Query: 482 FTGLIGKFAMFSDWEHKVTPLSEKIKVFATIFPKDDLLLSFKKRD 526
           F  L+GKFA+++D+ H VTPLSEKIKVFATIFPKDDLLL+FKKRD
Sbjct: 486 FAALLGKFALYTDFHHTVTPLSEKIKVFATIFPKDDLLLTFKKRD 530

>CAGL0M07656g 765772..767379 highly similar to sp|P54781
           Saccharomyces cerevisiae YMR015c C-22 sterol desaturase,
           start by similarity
          Length = 535

 Score =  865 bits (2235), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/495 (80%), Positives = 452/495 (91%)

Query: 32  LVETVQQMSYFKLFCTLVAIVIVWDQVSYQIQKGNIAGPKWKVWPVIGPFLESFDPKFEE 91
           L++ +Q MSY ++F TL+  V+VWDQVSYQ++KGNIAGP++KV+P+IGPFLES DPKFEE
Sbjct: 33  LLDKLQGMSYLQMFVTLICGVLVWDQVSYQMKKGNIAGPRFKVYPIIGPFLESLDPKFEE 92

Query: 92  YLAKWNSGPLSCVSIFHKFVVIASTRDLARKIFQSPQYVKPCVVDVAVKILRPSNWVFLD 151
           Y AKW+SGPLSCVSIFHKFV+IASTRDLARK+ Q+P+YVKPCVVDVAVKILRPSNWVFLD
Sbjct: 93  YKAKWDSGPLSCVSIFHKFVIIASTRDLARKVLQAPKYVKPCVVDVAVKILRPSNWVFLD 152

Query: 152 GKEHVDYRKSLNGLFTKQALAKYMPSQELLMDKYIEKFIELSKENKYEARVFFHDMREIM 211
           GK H DYRKSLNGLFTK ALA+Y+P  E LMDKYIEKF+ELSKEN YE ++FFH+MREI+
Sbjct: 153 GKAHTDYRKSLNGLFTKTALAQYLPPLEELMDKYIEKFVELSKENNYEPQIFFHEMREIL 212

Query: 212 CALSLKAFCGDYITEDQIRKVADDYYLVTAALELVNFPIIIPYTKTWYGKKTADMTMKIF 271
           CALSL++FCGDYI+EDQIRK+ADDYYLVTAALELVNFPII+P+TKTWYGK+TADM MKIF
Sbjct: 213 CALSLRSFCGDYISEDQIRKIADDYYLVTAALELVNFPIILPFTKTWYGKRTADMAMKIF 272

Query: 272 EQCAQMAKDHIAAGGESTCVLDAWCSLMHEAKNKDDADSKLYHREFTNREMSEAIFTFLF 331
           E CAQ AKDHIAAGG+  CV+D WC LMH+AKN+ D DS+L HREFTNRE+SEA+FTFLF
Sbjct: 273 ESCAQRAKDHIAAGGKPICVMDNWCKLMHDAKNRTDDDSRLLHREFTNREISEAVFTFLF 332

Query: 332 ASQDASSSLACWIFQIIADRPDVMANIREEQLRVRNNDPNVKLSMDLIDEMKYTNMVVKE 391
           ASQDASSSLACW+FQI+ADRPDV+A IREEQLRVR  D N +L +DL+D+M+YT+MVVKE
Sbjct: 333 ASQDASSSLACWLFQIVADRPDVLAKIREEQLRVREGDINKRLDIDLVDKMEYTHMVVKE 392

Query: 392 TLRYRPPVIMVPYYVKKSFPVVPTYSAPKGSMLIPTLYPALHDPEVYEDPDEFIPERWVE 451
           TLRYRPPV+MVPY VK  FPVVP Y APKGSMLI TLYPALHDPEVYE+PD+FIPERWVE
Sbjct: 393 TLRYRPPVLMVPYVVKNKFPVVPDYQAPKGSMLIATLYPALHDPEVYENPDDFIPERWVE 452

Query: 452 GSAANQAKKNWLVFGCGPHVCLGQTYVMQTFTGLIGKFAMFSDWEHKVTPLSEKIKVFAT 511
           GS AN+AKKNWLVFGCGPHVCLGQTYVM T T LIGKFA+F+D++HKVTPLSEKIKVFAT
Sbjct: 453 GSPANEAKKNWLVFGCGPHVCLGQTYVMITMTALIGKFALFTDFKHKVTPLSEKIKVFAT 512

Query: 512 IFPKDDLLLSFKKRD 526
           IFPKDDLLLSFKKRD
Sbjct: 513 IFPKDDLLLSFKKRD 527

>Scas_709.53
          Length = 523

 Score =  860 bits (2221), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/495 (77%), Positives = 459/495 (92%)

Query: 32  LVETVQQMSYFKLFCTLVAIVIVWDQVSYQIQKGNIAGPKWKVWPVIGPFLESFDPKFEE 91
           L+ T+QQ+SY+K+F T + IV+VWDQ+SYQI+KG+IAGP++K+WP+IGPFLES DPKFEE
Sbjct: 21  LISTIQQLSYWKIFVTFICIVLVWDQISYQIKKGSIAGPRFKIWPIIGPFLESLDPKFEE 80

Query: 92  YLAKWNSGPLSCVSIFHKFVVIASTRDLARKIFQSPQYVKPCVVDVAVKILRPSNWVFLD 151
           Y AKW+SG LSCVSIFHKFV+I+STRD++RKIFQS ++VKPCVVDVA+KILRP+NWVFLD
Sbjct: 81  YKAKWDSGALSCVSIFHKFVIISSTRDISRKIFQSSKFVKPCVVDVAIKILRPTNWVFLD 140

Query: 152 GKEHVDYRKSLNGLFTKQALAKYMPSQELLMDKYIEKFIELSKENKYEARVFFHDMREIM 211
           GK H+DYRKSLNGLFTK ALA+Y+PSQE +MDKY++KFIE+SKEN YE +VFFH+MREI+
Sbjct: 141 GKAHIDYRKSLNGLFTKTALAQYLPSQEQVMDKYLQKFIEISKENNYEPQVFFHEMREIL 200

Query: 212 CALSLKAFCGDYITEDQIRKVADDYYLVTAALELVNFPIIIPYTKTWYGKKTADMTMKIF 271
           CALSL+AFCG+YITEDQIRK+ADDYYLVTAALELVNFPIIIP+TKTWYGK+TAD  MKIF
Sbjct: 201 CALSLRAFCGEYITEDQIRKIADDYYLVTAALELVNFPIIIPFTKTWYGKRTADAAMKIF 260

Query: 272 EQCAQMAKDHIAAGGESTCVLDAWCSLMHEAKNKDDADSKLYHREFTNREMSEAIFTFLF 331
           EQCAQM+KD+IA GG+  CV+DAWC LMH+AK K+D DS++ HREF+N+E+SEAIFTFLF
Sbjct: 261 EQCAQMSKDYIAKGGKPICVMDAWCKLMHDAKTKNDEDSRILHREFSNKEISEAIFTFLF 320

Query: 332 ASQDASSSLACWIFQIIADRPDVMANIREEQLRVRNNDPNVKLSMDLIDEMKYTNMVVKE 391
           ASQDASSSLACW+FQI+ADRPD++  IR+EQ+ VRNND + +L+++LID+MKYTNMV+KE
Sbjct: 321 ASQDASSSLACWLFQIVADRPDILEKIRKEQMEVRNNDMSTELNIELIDKMKYTNMVIKE 380

Query: 392 TLRYRPPVIMVPYYVKKSFPVVPTYSAPKGSMLIPTLYPALHDPEVYEDPDEFIPERWVE 451
           TLRYRPPV+MVPY VK+ FPV P Y+APKGSMLIPTLYP+LHDPEVYE+PDEFIPERW E
Sbjct: 381 TLRYRPPVLMVPYVVKEKFPVTPNYTAPKGSMLIPTLYPSLHDPEVYENPDEFIPERWEE 440

Query: 452 GSAANQAKKNWLVFGCGPHVCLGQTYVMQTFTGLIGKFAMFSDWEHKVTPLSEKIKVFAT 511
           GS A++AKKNWLVFGCGPHVCLGQTYVM TF  L+GKFA+++D+EHK+TPLSEKIKVFAT
Sbjct: 441 GSPASEAKKNWLVFGCGPHVCLGQTYVMITFAALLGKFALYTDFEHKITPLSEKIKVFAT 500

Query: 512 IFPKDDLLLSFKKRD 526
           IFPKDDLL++FKKRD
Sbjct: 501 IFPKDDLLMTFKKRD 515

>ABR053C [644] [Homologous to ScYMR015C (ERG5) - SH]
           (492258..493805) [1548 bp, 515 aa]
          Length = 515

 Score =  785 bits (2026), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/472 (76%), Positives = 418/472 (88%), Gaps = 1/472 (0%)

Query: 56  DQVSYQIQKGNIAGPKWKVWPVIGPFLESFDPKFEEYLAKWNSGPLSCVSIFHKFVVIAS 115
           DQ +Y+  KG IAGP WK+WP+IGPFLES DPKFE Y AKW SGPLSCVSIFHKFVVIAS
Sbjct: 36  DQAAYRRNKGRIAGPAWKMWPLIGPFLESLDPKFEVYQAKWASGPLSCVSIFHKFVVIAS 95

Query: 116 TRDLARKIFQSPQYVKPCVVDVAVKILRPSNWVFLDGKEHVDYRKSLNGLFTKQALAKYM 175
           TRDL RKI QSP+YVKPC+VDVA KILRP+NWVFLDG+ H+DYR+SLNGLFT+ ALA+Y+
Sbjct: 96  TRDLTRKILQSPKYVKPCLVDVAKKILRPTNWVFLDGQAHLDYRRSLNGLFTRDALARYL 155

Query: 176 PSQELLMDKYIEKFIELSKENKYEARVFFHDMREIMCALSLKAFCGDYITEDQIRKVADD 235
           PSQE ++D+Y+ KF+  S+E  YE RVFFH+MRE++CALSLKAFCG YIT+DQ+RK+ADD
Sbjct: 156 PSQEAVIDRYMAKFVAFSRETDYEHRVFFHEMREMLCALSLKAFCGSYITDDQVRKIADD 215

Query: 236 YYLVTAALELVNFPIIIPYTKTWYGKKTADMTMKIFEQCAQMAKDHIAAGGESTCVLDAW 295
           YYLVTAALELVNFP+I+P+TKTWYGK+TADM MKIFE+CAQ AK HIAAGGE TCV+DAW
Sbjct: 216 YYLVTAALELVNFPLILPFTKTWYGKRTADMAMKIFERCAQEAKQHIAAGGEPTCVVDAW 275

Query: 296 CSLMHEAKNKDDADSKLYHREFTNREMSEAIFTFLFASQDASSSLACWIFQIIADRPDVM 355
           C LM +AK KDDADS+L HR+FTNREMSEA+FTFLFASQDASSSLACW+FQI+ADRPDV+
Sbjct: 276 CKLMLDAKAKDDADSRLLHRKFTNREMSEALFTFLFASQDASSSLACWLFQIVADRPDVL 335

Query: 356 ANIREEQLRVRNNDPNVKLSMDLIDEMKYTNMVVKETLRYRPPVIMVPYYVKKSFPVVPT 415
           A IREEQL VR NDP+V LS++LID+MKYT+M VKE LRYRPPV+MVPY V ++F V   
Sbjct: 336 AKIREEQLAVRRNDPSVPLSLELIDQMKYTHMAVKECLRYRPPVLMVPYQVHEAFAVSAD 395

Query: 416 YSAPKGSMLIPTLYPALHDPEVYEDPDEFIPERW-VEGSAANQAKKNWLVFGCGPHVCLG 474
           Y+APKGSML+ T+YPALHDP VYE+PD++IPERW  E S ANQAKKNWLVFG GPHVCLG
Sbjct: 396 YTAPKGSMLVATMYPALHDPAVYENPDDYIPERWDGEQSPANQAKKNWLVFGSGPHVCLG 455

Query: 475 QTYVMQTFTGLIGKFAMFSDWEHKVTPLSEKIKVFATIFPKDDLLLSFKKRD 526
           Q YV  TFT LIGKFA+F++++HKVT LSEKIKVFATIFP+DDLL+SFKKRD
Sbjct: 456 QKYVFMTFTALIGKFALFTEFDHKVTSLSEKIKVFATIFPQDDLLMSFKKRD 507

>Kwal_26.8172
          Length = 336

 Score =  605 bits (1559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/336 (82%), Positives = 309/336 (91%)

Query: 186 IEKFIELSKENKYEARVFFHDMREIMCALSLKAFCGDYITEDQIRKVADDYYLVTAALEL 245
           +EKF+  S E  +E +V+FH++REIMCALSLKAFCGDYITE QIRKVADDYYLVTAALEL
Sbjct: 1   MEKFVTYSAEKNFEPQVYFHELREIMCALSLKAFCGDYITESQIRKVADDYYLVTAALEL 60

Query: 246 VNFPIIIPYTKTWYGKKTADMTMKIFEQCAQMAKDHIAAGGESTCVLDAWCSLMHEAKNK 305
           VNFPII+P+TKTWYG++TADMTMKIFE+CAQMAKDHIAAGG+  CV+DAWC LMH AKNK
Sbjct: 61  VNFPIILPFTKTWYGQRTADMTMKIFEKCAQMAKDHIAAGGKPKCVMDAWCELMHNAKNK 120

Query: 306 DDADSKLYHREFTNREMSEAIFTFLFASQDASSSLACWIFQIIADRPDVMANIREEQLRV 365
           +D DS+L+HREFTNRE+SEA+FTFLFASQDASSSLACW+FQI+ADRPDVM  IREEQLRV
Sbjct: 121 NDEDSRLFHREFTNREISEAVFTFLFASQDASSSLACWLFQIVADRPDVMQKIREEQLRV 180

Query: 366 RNNDPNVKLSMDLIDEMKYTNMVVKETLRYRPPVIMVPYYVKKSFPVVPTYSAPKGSMLI 425
           RNNDP+  LS+DLIDEMKYT MVVKETLRYRPPVIMVPY VK  FP+ P Y+APKG+MLI
Sbjct: 181 RNNDPSKPLSLDLIDEMKYTYMVVKETLRYRPPVIMVPYVVKNKFPIAPNYTAPKGAMLI 240

Query: 426 PTLYPALHDPEVYEDPDEFIPERWVEGSAANQAKKNWLVFGCGPHVCLGQTYVMQTFTGL 485
           PTLYPALHDPEVY+DP+EFIPERWVEGS AN+AKKNWLVFG G HVCLGQTYVM TFT L
Sbjct: 241 PTLYPALHDPEVYDDPEEFIPERWVEGSPANEAKKNWLVFGSGSHVCLGQTYVMMTFTAL 300

Query: 486 IGKFAMFSDWEHKVTPLSEKIKVFATIFPKDDLLLS 521
           IGKFAM+++WEHKVTPLSEKIKVFATIFPKDDLLL+
Sbjct: 301 IGKFAMYTNWEHKVTPLSEKIKVFATIFPKDDLLLT 336

>KLLA0E03553g 329904..331487 highly similar to sp|P10614
           Saccharomyces cerevisiae YHR007c ERG11 cytochrome P450
           lanosterol 14a-demethylase, start by similarity
          Length = 527

 Score = 85.1 bits (209), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 58/218 (26%), Positives = 99/218 (45%), Gaps = 27/218 (12%)

Query: 297 SLMHEAKNKDDADSKLYHREFTNREMSEAIFTFLFASQDASSSLACWIFQIIADRPDVMA 356
           SLM  +  KD         + T++E++  +   L   Q  S++ + W+   +A+RPD+  
Sbjct: 287 SLMKNSTYKDGV-------KMTDQEIANLLIGVLMGGQHTSAATSAWVILHLAERPDIQE 339

Query: 357 NIREEQLRVRNNDPNVKLSMDLIDEMKYTNMVVKETLRYRPPVIMVPYYVKKSFPVV-PT 415
            + EEQ++V +N    +L+ DL+ EM   N  +KETLR   P+  +   V    PV   +
Sbjct: 340 KLYEEQMKVLDNGTK-ELTFDLLQEMPLLNQTIKETLRLHHPLHSLFRKVMNDMPVPNSS 398

Query: 416 YSAPKG-SMLIPTLYPALHDPEVYEDPDEFIPERWVEGSAANQAKKN------------- 461
           Y  PKG  +L+   Y  L D + + +  EF P RW   +A++ A                
Sbjct: 399 YVVPKGHHVLVSPGYCHLQD-KYFPNASEFNPNRWDNDAASSYASNEKVDYGFGSISKGV 457

Query: 462 ---WLVFGCGPHVCLGQTYVMQTFTGLIGKFAMFSDWE 496
              +L FG G H C+G+ +       ++  +     W+
Sbjct: 458 SSPYLPFGGGRHRCIGEHFAYMQLGTILSNYIRTLTWK 495

>YHR007C (ERG11) [2293] chr8 complement(120085..121677) Cytochrome
           P450 (lanosterol 14alpha-demethylase), essential for
           biosynthesis of ergosterol [1593 bp, 530 aa]
          Length = 530

 Score = 79.3 bits (194), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 61/224 (27%), Positives = 94/224 (41%), Gaps = 37/224 (16%)

Query: 297 SLMHEAKNKDDADSKLYHREFTNREMSEAIFTFLFASQDASSSLACWIFQIIADRPDVMA 356
           SLM  +  KD         + T++E++  +   L   Q  S++ + WI   +A+RPDV  
Sbjct: 286 SLMKNSTYKDGV-------KMTDQEIANLLIGVLMGGQHTSAATSAWILLHLAERPDVQQ 338

Query: 357 NIREEQLRVRNNDPNVKLSMDLIDEMKYTNMVVKETLRYRPPVIMVPYYVKKSFPVVPTY 416
            + EEQ+RV +     +L+ DL+ EM   N  +KETLR   P+  +   V K   V    
Sbjct: 339 ELYEEQMRVLDGGKK-ELTYDLLQEMPLLNQTIKETLRMHHPLHSLFRKVMKDMHV---- 393

Query: 417 SAPKGSMLIPTLYPALHDPEVYEDPDEFIP-------ERWVEGSAANQA----------- 458
             P  S +IP  Y  L  P      DE+ P        RW + SA++ +           
Sbjct: 394 --PNTSYVIPAGYHVLVSPGYTHLRDEYFPNAHQFNIHRWNKDSASSYSVGEEVDYGFGA 451

Query: 459 -----KKNWLVFGCGPHVCLGQTYVMQTFTGLIGKFAMFSDWEH 497
                   +L FG G H C+G+ +       L+  F     W +
Sbjct: 452 ISKGVSSPYLPFGGGRHRCIGEHFAYCQLGVLMSIFIRTLKWHY 495

>ADR162W [1904] [Homologous to ScYHR007C (ERG11) - SH]
           complement(987458..989047) [1590 bp, 529 aa]
          Length = 529

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 54/204 (26%), Positives = 91/204 (44%), Gaps = 37/204 (18%)

Query: 297 SLMHEAKNKDDADSKLYHREFTNREMSEAIFTFLFASQDASSSLACWIFQIIADRPDVMA 356
           +LM  A+ KD         + T+++++  +   L   Q  S++ + W+   +A+RPD+  
Sbjct: 284 ALMTSAQYKDGV-------KMTDQQIANLLIGVLMGGQHTSAATSAWVLLHLAERPDIQE 336

Query: 357 NIREEQLRVRNNDPNVKLSMDLIDEMKYTNMVVKETLRYRPPVIMVPYYVKKSFPVVPTY 416
            + EEQ+RV +     +L+ +L+ EM   N V+KETLR   P+  +   V +  PV    
Sbjct: 337 ELYEEQMRVLDGGAK-ELTYELLQEMPLLNQVIKETLRMHHPLHSLFRKVTRDMPV---- 391

Query: 417 SAPKGSMLIPTLYPALHDP-------EVYEDPDEFIPERWVE----------------GS 453
             P  S +IP  +  L  P       E + +  EF P RW                  G+
Sbjct: 392 --PNTSYVIPKDHYVLASPGFCHLSEEYFPNAKEFNPHRWDNDAASSVSTGEKVDYGFGA 449

Query: 454 AANQAKKNWLVFGCGPHVCLGQTY 477
            +      +L FG G H C+G+ +
Sbjct: 450 ISKGVSSPYLPFGGGRHRCIGEGF 473

>Sklu_2436.11 YHR007C, Contig c2436 26015-27613 reverse complement
          Length = 532

 Score = 78.2 bits (191), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 84/180 (46%), Gaps = 20/180 (11%)

Query: 316 EFTNREMSEAIFTFLFASQDASSSLACWIFQIIADRPDVMANIREEQLRVRNNDPNVKLS 375
           + T++E++  +   L   Q  S++ + W+   +A++P++   +  EQ+RV +N    +L+
Sbjct: 299 KMTDQEIANLLIGVLMGGQHTSAATSAWLLLHLAEKPELQEELYAEQMRVLDNGKK-ELT 357

Query: 376 MDLIDEMKYTNMVVKETLRYRPPVIMVPYYVKKSFPVVPT-YSAPKG-SMLIPTLYPALH 433
            DL+ EM   N  +KETLR   P+  +   V +  PV  T Y  PKG  +L+   Y  L 
Sbjct: 358 YDLLQEMPLLNQTIKETLRMHHPLHSIFRKVMRDLPVPNTSYVVPKGHHVLVSPGYAHLR 417

Query: 434 DPEVYEDPDEFIPERWVE----------------GSAANQAKKNWLVFGCGPHVCLGQTY 477
           D E +     F P RW                  GS +      +L FG G H C+G+ +
Sbjct: 418 D-EYFPHAATFDPHRWDNDAASSYSSSEQVDYGFGSVSKGVSSPYLPFGGGRHRCVGEHF 476

>Kwal_47.18323
          Length = 536

 Score = 77.0 bits (188), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 57/223 (25%), Positives = 98/223 (43%), Gaps = 29/223 (13%)

Query: 297 SLMHEAKNKDDADSKLYHREFTNREMSEAIFTFLFASQDASSSLACWIFQIIADRPDVMA 356
           +LM  +  KD         + T++E++  +   L   Q  S++ + W+   +A+RPD+  
Sbjct: 291 TLMKNSTYKDGT-------KMTDQEIANLLIGVLMGGQHTSAATSAWMLLHLAERPDLQE 343

Query: 357 NIREEQLRVRNNDPNVKLSMDLIDEMKYTNMVVKETLRYRPPVIMVPYYVKKSFPVVPT- 415
            +  EQ+ V +N    +L+ +L+ +M   N  +KETLR   P+  +   V++  PV  T 
Sbjct: 344 ELYAEQMEVLDNGKK-ELTYELLQQMPLLNQTIKETLRMHHPLHSIFRRVERDLPVPKTQ 402

Query: 416 YSAPKGS-MLIPTLYPALHDPEVYEDPDEFIPERWVE----------------GSAANQA 458
           Y  P+G  +L+   Y  L D E +   + F P RW                  G+ +   
Sbjct: 403 YVVPRGHFVLVSPGYCHLQD-EYFPKANTFDPHRWNNDYKSSYATGEEVDYGFGAISKGV 461

Query: 459 KKNWLVFGCGPHVCLGQTYVMQTFTGLIGKFAMFSDWEHKVTP 501
              +L FG G H C+G+ +       L+  +     W  K TP
Sbjct: 462 SSPYLPFGGGRHRCIGEHFAYCQLGVLMSVYIRTVKW--KFTP 502

>CAGL0E04334g complement(415351..416952) highly similar to sp|P10614
           Saccharomyces cerevisiae YHR007c ERG11, start by
           similarity
          Length = 533

 Score = 77.0 bits (188), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 59/244 (24%), Positives = 101/244 (41%), Gaps = 43/244 (17%)

Query: 290 CVLDAWCSLMHEAKNKDDADSKLYHREF------------TNREMSEAIFTFLFASQDAS 337
            +   + SL+ E + K+D  ++    E             T++E++  +   L   Q  S
Sbjct: 261 AISGTYMSLIKERREKNDIQNRDLIDELMKNSTYKDGTKMTDQEIANLLIGVLMGGQHTS 320

Query: 338 SSLACWIFQIIADRPDVMANIREEQLRVRNNDPNVKLSMDLIDEMKYTNMVVKETLRYRP 397
           ++ + W    +A+RPDV   + +EQ+RV NND   +L+ D +  M   N ++KETLR   
Sbjct: 321 AATSAWCLLHLAERPDVQEELYQEQMRVLNNDTK-ELTYDDLQNMPLLNQMIKETLRLHH 379

Query: 398 PVIMVPYYVKKSFPVVPTYSAPKGSMLIPTLYPALHDP-------EVYEDPDEFIPERWV 450
           P+  +   V +   +      P  S ++P  Y  L  P       E +  P+EF   RW 
Sbjct: 380 PLHSLFRKVMRDVAI------PNTSYVVPRDYHVLVSPGYTHLQEEFFPKPNEFNIHRWD 433

Query: 451 EGSAANQAKKN-----------------WLVFGCGPHVCLGQTYVMQTFTGLIGKFAMFS 493
             +A++ A                    +L FG G H C+G+ +       L+  F    
Sbjct: 434 GDAASSSAAGGDEVDYGFGAISKGVSSPYLPFGGGRHRCIGELFAYCQLGVLMSIFIRTM 493

Query: 494 DWEH 497
            W +
Sbjct: 494 KWRY 497

>Scas_699.20
          Length = 538

 Score = 68.6 bits (166), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 53/223 (23%), Positives = 92/223 (41%), Gaps = 37/223 (16%)

Query: 297 SLMHEAKNKDDADSKLYHREFTNREMSEAIFTFLFASQDASSSLACWIFQIIADRPDVMA 356
           +LM  +  KD         + T+ E++  +   L   Q  S++ + W    +A+RPDV  
Sbjct: 293 TLMKNSTYKDGV-------KMTDPEIANLLIGVLMGGQHTSAATSAWCLLHLAERPDVQE 345

Query: 357 NIREEQLRVRNNDPNVKLSMDLIDEMKYTNMVVKETLRYRPPVIMVPYYVKKSFPVVPTY 416
            + +EQ+RV +N    +++ DL+++M   N ++KETLR   P+  +    +K   V+   
Sbjct: 346 ELYQEQMRVLDNGKK-EITYDLLEQMPLLNQMIKETLRLHHPLHSL---FRK---VIRDM 398

Query: 417 SAPKGSMLIPTLYPALHDPEVYEDPDEFIPE-------RWVE----------------GS 453
             P  S +IP  Y  L  P      + + P+       RW                  G+
Sbjct: 399 QVPNTSYVIPKDYFVLVSPGYTHLQEHYFPQAHSFNIHRWDNDAESSYVVGEEVDYGFGA 458

Query: 454 AANQAKKNWLVFGCGPHVCLGQTYVMQTFTGLIGKFAMFSDWE 496
                   +L FG G H C+G+ Y       ++ +F     W 
Sbjct: 459 ITKGVTSPYLPFGGGRHRCIGEHYAYCQLGVIMAEFIREMKWH 501

>AFR400C [3592] [Homologous to ScYDR402C (DIT2) - SH]
           (1156683..1158167) [1485 bp, 494 aa]
          Length = 494

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/205 (22%), Positives = 84/205 (40%), Gaps = 28/205 (13%)

Query: 314 HREFTNREMSEAIFTFLFASQDASSSLACWIFQIIADRPDVMANIREEQLRVRNNDPNVK 373
           H E T +++++ I   + A  +    L      ++A  P+  A +R++          V 
Sbjct: 275 HGEITEKQLTDNIVILMVAGHENPQLLLTTCLYMLAKYPEWQARLRQQA---------VT 325

Query: 374 LSMDLIDEMKYTNMVVKETLRYRPPV-IMVPYYVKKSFPVVPTYSAPKGSMLIPTLYPAL 432
           L  DL+++    N  + ET+R  PP+  ++         + P    PK + +   +Y   
Sbjct: 326 LQDDLLNDSVEFNQFLFETVRVLPPLGQIINRKTSHKCKLGPEIVLPKDTYVGYQVYGTG 385

Query: 433 HDPEVY-EDPDEFIPERWVEGSAANQAKKNWL---------VFGCGPHVCLGQTY-VMQT 481
              +V+  D  EF PERW  GS      + W           F  G   CLG+   +M+T
Sbjct: 386 TSTQVWGPDAAEFKPERW--GSTNATVHETWRRSKNTGAMGAFHGGRRACLGEKMGLMET 443

Query: 482 FTGLIG-----KFAMFSDWEHKVTP 501
              L       ++ +  +W+ +VTP
Sbjct: 444 RVALAHMLRKLEWTLSPNWKDRVTP 468

>CAGL0F02607g complement(253736..255232) similar to sp|P21595
           Saccharomyces cerevisiae YDR402c DIT2 cytochrome P450,
           hypothetical start
          Length = 498

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 68/156 (43%), Gaps = 13/156 (8%)

Query: 381 EMKYTNMVVKETLRYRPPV-IMVPYYVKKSFPVVPTYSAPKGSMLIPTLYPALHDPEVY- 438
           E+   N  + E LRY PP+ +++     K   + P    PK + +    Y   HD   + 
Sbjct: 334 ELPLLNSFLYECLRYYPPLSVIINRKTTKRCMLGPGIVVPKDTYVGYHNYSTCHDSNFWG 393

Query: 439 EDPDEFIPERWVE-----GSAANQAKKNWLV--FGCGPHVCLGQTYVMQTFTGLIGKFAM 491
              D F P RW +       A    K N ++  F  G   CLG+  V  +   +I +F  
Sbjct: 394 HTSDIFDPTRWGKDIETINKAWKTTKNNCILNTFHGGKRACLGEKLVFVSTRIIIAEF-- 451

Query: 492 FSDWEHKVTPL-SEKIKVFATIFPKDDLLLSFKKRD 526
            S +E K++PL  E++     + PK DL L  + RD
Sbjct: 452 LSSFEWKLSPLWVEQMTHAGPLCPK-DLALDIRVRD 486

>Sklu_1634.3 YDR402C, Contig c1634 2102-3676 reverse complement
          Length = 524

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 83/207 (40%), Gaps = 28/207 (13%)

Query: 313 YHREFTN-REMSEAIFTFLFASQDASSSLACWIFQIIADRPDVMANIREEQLRVRNNDPN 371
           Y+RE  N +++++ I   + A  +    L   +  ++A           E+LR       
Sbjct: 310 YNREKLNEKQLTDNIVIIMVAGHENPQLLLTTLLYMLAKHHSTWQVRLREELR------- 362

Query: 372 VKLSMDLIDEMKYTNMVVKETLRYRPPV-IMVPYYVKKSFPVVPTYSAPKGSMLIPTLYP 430
              SM  I E+   N    E +R  PP+  ++     K+  +      PKGS +   +Y 
Sbjct: 363 -SCSMTEIHELPLLNAFFFECIRMYPPLGQIINRCTSKTCVLGRDIVIPKGSYVGYNVYA 421

Query: 431 ALHDPEVY-EDPDEFIPERWVEGSAANQAKKNWL---------VFGCGPHVCLGQ----T 476
                 V+  D +EF PERW  G + N+    W           F  G   CLG+    T
Sbjct: 422 TGRSRTVWGNDSNEFRPERW--GLSYNEVMDTWRHSKNSCAMSAFHGGRRACLGEKLALT 479

Query: 477 YVMQTFTGLIGKFA--MFSDWEHKVTP 501
            +  T   ++ +F   +  DW+ K+TP
Sbjct: 480 ELRITVAEMLTQFQWRLAPDWKDKMTP 506

>KLLA0C06743g complement(590585..592126) similar to sp|P21595
           Saccharomyces cerevisiae YDR402c DIT2 cytochrome P450 56
           singleton, start by similarity
          Length = 513

 Score = 37.4 bits (85), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 78/206 (37%), Gaps = 37/206 (17%)

Query: 318 TNREMSEAIFTFLFASQDASSSLACWIFQIIADRPDVMANIREEQLRVRNNDPNVKLSMD 377
           T+ ++ + +   L A  +    L   +F ++A   +    IREE L V  N+       D
Sbjct: 284 TDEQLKDNLVIILVAGHENPQLLLSTLFYLLAKHQNWQYAIREELLSVDRNE-------D 336

Query: 378 LIDEMKYTNMVVKETLRYRPPV-IMVPYYVKKSFPVVPTYSAPKGSMLIPTLYPALHDPE 436
           +++  K T  +  E LR  PP+  ++     +   + P     K       +Y       
Sbjct: 337 ILNSFKLTAFIY-EALRMFPPLGQIINRRTTRKCQLGPGIIIDKDVYCGYNVYGTGTATS 395

Query: 437 VY-EDPDEFIPERWVEGSAANQAKKNW---------LVFGCGPHVCLGQT---------- 476
           V+ E   +FIPERW  G  +N+   NW           F  G   CLG+           
Sbjct: 396 VWGETAKQFIPERW--GENSNELANNWKKHKYDASMSAFHGGRRSCLGEKLALMEMKYVL 453

Query: 477 -YVMQTFTGLIGKFAMFSDWEHKVTP 501
            YV+  F        +   W+ K+TP
Sbjct: 454 YYVLMNF-----HIELHPQWKEKMTP 474

>AFR661W [3854] [Homologous to ScYGL140C - NSH]
           complement(1642457..1645996) [3540 bp, 1179 aa]
          Length = 1179

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 17/25 (68%)

Query: 237 YLVTAALELVNFPIIIPYTKTWYGK 261
           + VT AL L +FP+ IP T+ WY K
Sbjct: 626 FQVTIALTLASFPMYIPATREWYMK 650

>Scas_653.8
          Length = 752

 Score = 30.8 bits (68), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 25/37 (67%)

Query: 358 IREEQLRVRNNDPNVKLSMDLIDEMKYTNMVVKETLR 394
           +RE+ L++  ++P++K+ M+  DE    NM++  TLR
Sbjct: 184 VREDLLQLLIHNPHIKMKMEYTDEYGRRNMLLNYTLR 220

>KLLA0C19206g 1711813..1713348 weakly similar to sp|O48923 Glycine
           max Cytochrome P450 71D10 (EC 1.14.-.-), hypothetical
           start
          Length = 511

 Score = 30.0 bits (66), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 42/189 (22%), Positives = 74/189 (39%), Gaps = 27/189 (14%)

Query: 311 KLYHR----EFTNREMSEAIFTFLFASQDASSSLACWIFQIIADRPDVMANIREEQLRV- 365
           KLY      +FT     + I   LFA+ + +S++  W    +    +    +R E L+V 
Sbjct: 284 KLYRHVESGKFTFNNWIQTIDEILFANIEVTSTVMAWALVEMGSNIEEQNRLRCEILKVK 343

Query: 366 ---------RNNDPNVKLSMDLIDEMKYTNMVVKETLRYRPPV-IMVPYYVKKSFPVVPT 415
                    +  DP ++  M L D   Y    V ETLR  P +    P    ++  +   
Sbjct: 344 EQSSKDDFNKETDP-MQRYMKLTD--TYLQYCVWETLRMHPLLWFSFPEISSETLFIDGI 400

Query: 416 YSAPKGSMLIPTLYPALHDPEVYEDPD-------EFIPERWVEGSAANQAKKNWLVFGCG 468
             +P   +++   Y   ++  ++   D       +F P R+ E      A  + + FG G
Sbjct: 401 RISPNTPIVVDQ-YQINYNSPIWNPSDKPKDFGKKFAPSRF-ENITLRDALYSQVTFGAG 458

Query: 469 PHVCLGQTY 477
              CLG+ +
Sbjct: 459 SRKCLGRNF 467

>Kwal_26.8323
          Length = 627

 Score = 29.6 bits (65), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 39/71 (54%), Gaps = 3/71 (4%)

Query: 177 SQELLMDKYIEKFIELSKENKYEARVFFHDM--REIMCALSLKAFCGDYITEDQIRKVAD 234
           +QE L   + ++ + + K++  E RVF  ++  R    +L+++  C D IT+ Q+ +V +
Sbjct: 84  TQERLSQSHSKQAVAIHKDSYSELRVFVQNLQARYKTISLNVRNLCNDKITKRQLCEVLE 143

Query: 235 DYYLVTAALEL 245
           +  L  A  EL
Sbjct: 144 E-KLQKATTEL 153

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.135    0.415 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 17,246,797
Number of extensions: 749825
Number of successful extensions: 1959
Number of sequences better than 10.0: 26
Number of HSP's gapped: 1992
Number of HSP's successfully gapped: 26
Length of query: 526
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 420
Effective length of database: 12,926,601
Effective search space: 5429172420
Effective search space used: 5429172420
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 64 (29.3 bits)