Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0D11220g47747018840.0
Scas_709.544705036153e-74
Sklu_2168.34795045936e-71
Kwal_26.81704935165143e-59
ABR052W5095114918e-56
YMR014W (BUD22)5195133736e-39
CAGL0M07678g4731892402e-21
Kwal_56.2355759484730.64
Scas_712.1888255711.2
CAGL0I00462g24966691.4
Sklu_2433.1188455648.6
Kwal_47.1921487651648.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D11220g
         (470 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D11220g 958249..959682 weakly similar to sp|Q04347 Saccharo...   730   0.0  
Scas_709.54                                                           241   3e-74
Sklu_2168.3 YMR014W, Contig c2168 4667-6106                           233   6e-71
Kwal_26.8170                                                          202   3e-59
ABR052W [643] [Homologous to ScYMR014W (BUD22) - SH] complement(...   193   8e-56
YMR014W (BUD22) [3978] chr13 (298867..300426) Protein with possi...   148   6e-39
CAGL0M07678g complement(767857..769278) similar to sp|Q04347 Sac...    97   2e-21
Kwal_56.23557                                                          33   0.64 
Scas_712.18                                                            32   1.2  
CAGL0I00462g complement(33501..34250) similar to tr|Q05905 Sacch...    31   1.4  
Sklu_2433.11 YGL233W, Contig c2433 17844-20498                         29   8.6  
Kwal_47.19214                                                          29   8.9  

>KLLA0D11220g 958249..959682 weakly similar to sp|Q04347
           Saccharomyces cerevisiae YMR014w singleton, start by
           similarity
          Length = 477

 Score =  730 bits (1884), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/470 (77%), Positives = 366/470 (77%)

Query: 1   MGKDNLIFKLDNLEYQIHYMNNEAEQFQPRFKQTLQFFNSKSRKTNKKVTKLLEAADKQK 60
           MGKDNLIFKLDNLEYQIHYMNNEAEQFQPRFKQTLQFFNSKSRKTNKKVTKLLEAADKQK
Sbjct: 1   MGKDNLIFKLDNLEYQIHYMNNEAEQFQPRFKQTLQFFNSKSRKTNKKVTKLLEAADKQK 60

Query: 61  INGEISSLRLKILDQKIHHVLQRLQTHWIKNPLILREPEVAKIGAEQFIKYMSYSKLVKL 120
           INGEISSLRLKILDQKIHHVLQRLQTHWIKNPLILREPEVAKIGAEQFIKYMSYSKLVKL
Sbjct: 61  INGEISSLRLKILDQKIHHVLQRLQTHWIKNPLILREPEVAKIGAEQFIKYMSYSKLVKL 120

Query: 121 TMSLMGGNKTCPEWFREHEFYQISNDKTNELNPSRIYNGVFXXXXXXXXXXXXXXXXXXX 180
           TMSLMGGNKTCPEWFREHEFYQISNDKTNELNPSRIYNGVF                   
Sbjct: 121 TMSLMGGNKTCPEWFREHEFYQISNDKTNELNPSRIYNGVFSKNKLNSLVSKLLNNKNVK 180

Query: 181 DLIQTYENGIHVILNEKDKIQKDXXXXXXXXXXXXXEDTSTDKNIDGVSKTEKGATXXXX 240
           DLIQTYENGIHVILNEKDKIQKD             EDTSTDKNIDGVSKTEKGAT    
Sbjct: 181 DLIQTYENGIHVILNEKDKIQKDTTTASTKQSKTKSEDTSTDKNIDGVSKTEKGATESES 240

Query: 241 XXXXXXXXXXXXAPELDSETEELLSKQYDGLLVGSDEESEPEFQLDPTIDYNQVTXXXXX 300
                       APELDSETEELLSKQYDGLLVGSDEESEPEFQLDPTIDYNQVT     
Sbjct: 241 ESDLLEENSEREAPELDSETEELLSKQYDGLLVGSDEESEPEFQLDPTIDYNQVTDEEDK 300

Query: 301 XXXXXXXXXXXXXXXXXXXXXNKKPKYNLPELMNGYISGDEEEDLDDKVARKQIAAVPVK 360
                                NKKPKYNLPELMNGYISGDEEEDLDDKVARKQIAAVPVK
Sbjct: 301 EEYSADEDDEENSDSDSGEPSNKKPKYNLPELMNGYISGDEEEDLDDKVARKQIAAVPVK 360

Query: 361 KNRRGQRARQKIWEKKYGSQAKHVQRQLEKEHKXXXXXXXXXXXXXXXXXXXXXXXXXXX 420
           KNRRGQRARQKIWEKKYGSQAKHVQRQLEKEHK                           
Sbjct: 361 KNRRGQRARQKIWEKKYGSQAKHVQRQLEKEHKERETRQQEYEQRQAKREAKAAQLAEQQ 420

Query: 421 XXXVSQYNSQSSTSNIPPPPQPVITADKPIHPSWEAKRIAEEKQKNVKFQ 470
              VSQYNSQSSTSNIPPPPQPVITADKPIHPSWEAKRIAEEKQKNVKFQ
Sbjct: 421 RKRVSQYNSQSSTSNIPPPPQPVITADKPIHPSWEAKRIAEEKQKNVKFQ 470

>Scas_709.54
          Length = 470

 Score =  241 bits (615), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 177/503 (35%), Positives = 242/503 (48%), Gaps = 75/503 (14%)

Query: 1   MGKDNLIFKLDNLEYQIHYMNNEAEQFQPRFKQTLQFFNSKSRKTNKKVTKLLEAADKQK 60
           M KDNL+FKLDNLEYQ HY+NN  + F+PR  QT +F+N+K RKT KKV KLL     + 
Sbjct: 1   MPKDNLLFKLDNLEYQQHYLNNTLDSFEPRLNQTRKFYNAKGRKTIKKVEKLLNEIKIED 60

Query: 61  INGEISSLRLKILDQKIHHVLQRLQTHWIKNPLILREPEVAKI----------------G 104
           +  +++ ++L+I D+KIHH     + +  KN + L E E +K+                G
Sbjct: 61  VERQLNEIKLEIFDKKIHH----FENNLTKNLIKLLENENSKLIKNFDKTTLEAIKNQYG 116

Query: 105 AEQFIKYMSYSKLVKLTMS-LMGGNKT---CPEWFREHEFYQISNDKTNELNPSRIYNGV 160
             QF K +  SK +KLT   ++  +K     P+WF +H +++I  DK NE NPSRI+N V
Sbjct: 117 IPQFAKLLCLSKSIKLTTGKIVPKSKKIEDTPQWFVKHNYWEIYQDKNNEFNPSRIWNEV 176

Query: 161 FXX-XXXXXXXXXXXXXXXXXDLIQTYENGIHVIL--NEKDKIQKDXXXXXXXXXXXXXE 217
                                D+IQ++ENG+ V L  N+  K+Q++              
Sbjct: 177 IMKIKKSDALVSLIMNDKKVKDIIQSFENGMDVFLGINKGKKLQREKNGLNKASSSNNEV 236

Query: 218 DTSTDKNIDGVSKTEKGATXXXXXXXXXXXXXXXXAPELDSETEELLSK--------QYD 269
           +   D   +    TE+                    P L  ET +   +        QY+
Sbjct: 237 EMQEDDASEDDELTER--------------------PALRRETRDEDQEIDEDEILNQYE 276

Query: 270 GLLVGS-DEESEPEFQLDPTIDYNQVTXXXXXXXXXXXXXXXXXXXXXXXXXXNKKPKYN 328
           G+L  S DEE E    LD TI+YN+VT                           KKPK  
Sbjct: 277 GMLAASDDEEGEEASGLDKTINYNEVTDEEPSDDEDSESEEPSR----------KKPK-- 324

Query: 329 LPELMNGYISGDEEED--LDDKVARKQIAAVPVKKNRRGQRARQKIWEKKYGSQAKHVQR 386
           LPELM GY SG E  D   +DK+AR+Q++  P +KNRRGQRAR+KIWEKKYGSQAKHVQR
Sbjct: 325 LPELMGGYYSGGESSDDEKEDKIAREQMSNKPQRKNRRGQRARRKIWEKKYGSQAKHVQR 384

Query: 387 QLEKEHKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSQYNSQSSTSNIPPPPQPVITA 446
           ++EKE +                                +  S+   S  P   +P    
Sbjct: 385 EVEKEFEERKQRQIAYEERAAKRAAKEEAFQKMVREHELERESKQGQSKWPKVKEP---- 440

Query: 447 DKPIHPSWEAKRIAEEKQKNVKF 469
            +  HPSW AKR+AEEK+KN KF
Sbjct: 441 -QAEHPSWVAKRVAEEKEKNAKF 462

>Sklu_2168.3 YMR014W, Contig c2168 4667-6106
          Length = 479

 Score =  233 bits (593), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 160/504 (31%), Positives = 237/504 (47%), Gaps = 66/504 (13%)

Query: 1   MGKDNLIFKLDNLEYQIHYMNNEAEQFQPRFKQTLQFFNSKSRKTNKKVTKLLEAADKQK 60
           M K+NLIFKLDNLEYQ HY+NN  + F+PR   T + F++K +KT+KK++KLL  A    
Sbjct: 1   MPKENLIFKLDNLEYQYHYLNNTLDDFKPRLSSTNKLFHAKGKKTSKKISKLLSDATLDS 60

Query: 61  INGEISSLRLKILDQKIHHVLQRLQTHWIKNPLILREPEVAKIGAEQ------------- 107
           ++ ++  LR   L++K++H+ +RL+++  K   + ++ +     AEQ             
Sbjct: 61  VSQQLDDLRQSFLEKKVYHLQKRLESYLEK--ALQQQYDALPKKAEQKENDKKNLKALED 118

Query: 108 ---------FIKYMSYSKLVKLTMSLMGGNKTC----PEWFREHEFYQISNDKTNELNPS 154
                    F + ++ SK+V+L +S +   KT     P+WF   +   +  DK +E NPS
Sbjct: 119 IKSDFTFTKFSQLIAKSKIVRLVISKITPTKTLKENPPQWFESSDILHVYRDKEDECNPS 178

Query: 155 RIYNG-VFXXXXXXXXXXXXXXXXXXXDLIQTYENGIHVIL--NEKDKIQKDXXXXXXXX 211
            ++N  V                    +LI +++ G+ V L  N + K+Q          
Sbjct: 179 NVWNKVVMKIEGCEKLLSVMMNSKKYKELIDSFDRGMDVFLGINREKKLQNKKVEANKKS 238

Query: 212 XXXXXEDTSTDKNIDGVSKTEKGATXXXXXXXXXXXXXXXXAPELDSETEELLSKQYDGL 271
                +D+  D   DGVS  E  A                   E  +  EE L +QY G+
Sbjct: 239 SNALDDDSGEDFTDDGVSDREDDA-------------------EFSTADEEALVQQYKGM 279

Query: 272 LVGSDEESEPE----FQLDPTIDYNQVTXXXXXXXXXXXXXXXXXXXXXXXXXXNKKPKY 327
           L GSDEE + +    + LDP +DYN+VT                          N   K 
Sbjct: 280 LAGSDEEDDADEQQGYHLDPNVDYNEVTDEEPTDNESELEEEEKLEEPPKKKQKN---KA 336

Query: 328 NLPELMNGYISGDEEEDL-DDKVARKQIAAVPVKKNRRGQRARQKIWEKKYGSQAKHVQR 386
            LPELM GY SG  ++++ DD++A++Q++  P +KNRRGQRARQKIWEKKYG  AKHVQR
Sbjct: 337 QLPELMAGYFSGGSDDEIEDDRIAKEQLSNEPKRKNRRGQRARQKIWEKKYGKNAKHVQR 396

Query: 387 QLEKEHKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSQYNSQSSTSNIPPPPQPVITA 446
           Q EK+ +                                +   +          Q     
Sbjct: 397 QHEKDKEEREKRQVEYEERVAKRAANSVRLAEEAREKAQRLEERKR--------QQEEKR 448

Query: 447 DKPIHPSWEAKRIAEEKQKNVKFQ 470
           + PIHPSW+AK+ AEE+ KNVKFQ
Sbjct: 449 NDPIHPSWQAKKQAEERLKNVKFQ 472

>Kwal_26.8170
          Length = 493

 Score =  202 bits (514), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 159/516 (30%), Positives = 233/516 (45%), Gaps = 75/516 (14%)

Query: 1   MGKDNLIFKLDNLEYQIHYMNNEAEQFQPRFKQTLQFFNSKSRKTNKKVTKLLEAADKQK 60
           M K+NLIFKLDNLEYQ H++NN  + FQPR   T + FN+K +K +K++ KLL  ++  +
Sbjct: 1   MPKENLIFKLDNLEYQYHHLNNSLDGFQPRLSGTAKTFNAKGKKASKRIQKLLYESNLTE 60

Query: 61  INGEISSLRLKILDQKIHHV-----------LQRLQTHWIKNP----------LILREPE 99
           ++  + SLR +I+++K +H+           LQ+  +  +KN           L   E  
Sbjct: 61  VSRALDSLRREIVEKKAYHLENKLASLLEKNLQQQYSSLLKNSNEKNKDRLKTLATLEKS 120

Query: 100 VAKIGAEQFI-KYMSYSKLVKLTMSLMGGNKTCPEWFREHEFYQISNDKTNELNPSRIYN 158
               G  + I KY +   LV   +      +  P+W +++E+  I NDK N  NP +++N
Sbjct: 121 YTIPGFSKLIAKYRTCKLLVPKLLFTKALREDPPQWLKDNEYVTIFNDKNNTHNPGKVWN 180

Query: 159 GVFXXXXXXXXXXXXXXXXXX-XDLIQTYENGIHVILNEKDKIQK-----DXXXXXXXXX 212
            V                     +L+  +++ + + +N+K + +      +         
Sbjct: 181 EVIVATEGCERLLSLTMNDKKIKELLSGFDSAMDLFMNKKKEREASQNNTNEQSKPSRAV 240

Query: 213 XXXXEDTSTDKNIDG--VSKTEKGATXXXXXXXXXXXXXXXXAPELDSETEELLSKQYDG 270
               E +S D+N D    S + +G                     L  E E L  KQY+G
Sbjct: 241 PETDERSSEDENGDNDFASSSSEG--------------EDADGSALIDEDEIL--KQYEG 284

Query: 271 LLVGSDEESEPEF--QLDPTIDYNQVTXXXXXXXXXXXXXX-----------XXXXXXXX 317
           +LV SDEE E      L+P I+YN+VT                                 
Sbjct: 285 MLVASDEEGEDLTMPSLNPDINYNEVTDEEPSESENDSDISLSDGEEDVPPLKKQKRSQE 344

Query: 318 XXXXNKKPKYNLPELMNGYISGDEEEDL-DDKVARKQIAAVPVKKNRRGQRARQKIWEKK 376
                 K K NLPELM GY SG  ++++ +D+VA KQ +  P +KNRRGQRARQKIWEKK
Sbjct: 345 REDDQSKVKTNLPELMTGYYSGGSDDEISEDEVAAKQASNEPKRKNRRGQRARQKIWEKK 404

Query: 377 YGSQAKHVQRQLEKEHKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSQYNSQSSTSNI 436
           YG  AKHVQRQ+E E                                    + +++T   
Sbjct: 405 YGHNAKHVQRQVEAE-------------KSERERKKQEYEARVAKRAARAQDREATTRKR 451

Query: 437 PPPPQP--VITADKPIHPSWEAKRIAEEKQKNVKFQ 470
           P  P+       D PIHPSWEAK++AEEKQK  KFQ
Sbjct: 452 PSDPKTWEAPAKDAPIHPSWEAKKMAEEKQKGAKFQ 487

>ABR052W [643] [Homologous to ScYMR014W (BUD22) - SH]
           complement(490427..491956) [1530 bp, 509 aa]
          Length = 509

 Score =  193 bits (491), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 145/511 (28%), Positives = 221/511 (43%), Gaps = 52/511 (10%)

Query: 1   MGKDNLIFKLDNLEYQIHYMNNEAEQFQPRFKQTLQFFNSKSRKTNKKVTKLLEAADKQK 60
           + K NL++KLD+ EYQ H +NN   +F PR   T +++N + +K  ++V KLL       
Sbjct: 3   LNKPNLVYKLDHAEYQYHLLNNTVAEFHPRLGATAKYYNPQGKKAAQRVEKLLAGLTADG 62

Query: 61  INGEISSLRLKILDQKIHHVLQRLQTHWIK----NPLILR------EPEVAKI------- 103
           +  +ISSL+ ++LD K+HHV  +L    +K       +LR      E   +K+       
Sbjct: 63  LLQQISSLKAELLDHKVHHVESKLSHLLVKQLENQATVLRKNPKKDEQRNSKLQVLEGVQ 122

Query: 104 ---GAEQFIKYMSYSKLVKLTMSLMGGNKTC----PEWFREHEFYQISNDKTNELNPSRI 156
              G EQF++ +  SK+VK+ +  +   K      P WF+ H   Q   +K +E NP R+
Sbjct: 123 RGPGFEQFVRLIVRSKVVKIVLGKICPTKALKNDPPAWFQNHRILQQFGNKEDECNPGRV 182

Query: 157 YNGVFXXXXXXXX-XXXXXXXXXXXDLIQTYENGIHVILNEKDKIQKDXXXXXXXXXXXX 215
           +  V                     DL+   E  + ++L  K + +++            
Sbjct: 183 WKEVVQAVAGGEQLVSQLLSTKAARDLLAALEASVDLVLGTKKERRQNSDAAEKTAVAAR 242

Query: 216 XEDTSTDKNIDGVSKTEKGATXXXXXXXXXXXXXXXXAPELDSETEELLSKQYDGLLVGS 275
             +   D +    + ++                    +P +D   E+ L  QY G+L  S
Sbjct: 243 SAEGEDDSSSSDNAASDIDEGAASESEEENSDDEAARSPSVD---EDALVSQYAGMLAAS 299

Query: 276 DEE-SEPE-FQLDPTIDYNQVTXXXXXXXXXXXXXXXXXXXXXX-------XXXXNKKPK 326
           DEE  +P+ + LDP +DYN+VT                                   K K
Sbjct: 300 DEEDDDPDGYHLDPNVDYNEVTDEEPDQSADETIQPDADDSSDSDSSAPPLKKQKTSKTK 359

Query: 327 YNLPELMNGYISGDEEEDLD--DKVARKQIAAVPVKKNRRGQRARQKIWEKKYGSQAKHV 384
             LP LM GY SGD++ D +  D   + +    P +KNRRGQRARQKIWEKKYG  AKH+
Sbjct: 360 VQLPALMAGYYSGDDDSDAEEHDLAGKAEPLEPPKRKNRRGQRARQKIWEKKYGRNAKHI 419

Query: 385 QRQLEKEHKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSQYNSQSSTSNI-PPPPQPV 443
           Q+Q EKE +                              +++       S I    P   
Sbjct: 420 QQQFEKERE--------ERARKQREYEERAAKRPAKEAELARTRPAFKDSAIRAAEPGAA 471

Query: 444 ITADKPI----HPSWEAKRIAEEKQKNVKFQ 470
            +A KP+    HPSWEAK++++EKQK  KFQ
Sbjct: 472 KSAAKPVAQELHPSWEAKKLSQEKQKAAKFQ 502

>YMR014W (BUD22) [3978] chr13 (298867..300426) Protein with possible
           role in bud site polarity, has possible coiled-coil
           domain [1560 bp, 519 aa]
          Length = 519

 Score =  148 bits (373), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 140/513 (27%), Positives = 222/513 (43%), Gaps = 58/513 (11%)

Query: 7   IFKLDNLEYQIHYMNNEAEQFQPRFKQTLQFFNSKSRKTNKKVTKLLEAADKQKINGEIS 66
           I+KLD LEYQ HY+    ++F+PR+ +T + +N   +K  KK+ KLL + + + ++ E+ 
Sbjct: 9   IYKLDQLEYQYHYLTKSLQKFEPRYPKTAKLYNCIGKKNKKKIEKLLNSLELKTLDKELD 68

Query: 67  SLRLKILDQKIHH--------VLQRLQTHWIKNPLILREPE-------------VAKIGA 105
               K+L+ KIH+        + +++Q    KN   +++ +               ++  
Sbjct: 69  ESYSKLLNNKIHYYETHLSKCIKEQIQKISKKNSSKVKDAQKNKSPSIDIEKMLATQLSL 128

Query: 106 EQFIKYMSYSKLVKLTMSLMG-------GNKTCPEWFREHEFYQISNDKTNELNPSRIYN 158
           +    +M+  +L+K+    +        G+     W   +++    NDKT++ NPS I+N
Sbjct: 129 DDLALFMTRFRLIKILHQRIKQKSKKIEGDTNNKTWLNNNDYSGYINDKTSKWNPSNIWN 188

Query: 159 GVFXXX-XXXXXXXXXXXXXXXXDLIQTYENGIHVILNEKDKIQKDXXXXXXXXXXXXXE 217
            V                     +L ++++  I +I        K              +
Sbjct: 189 EVITKLPSCEKLNALIGQSKIVQNLTESFDLSICLIFGFDVSAMKAKKYGAREKTANANQ 248

Query: 218 DTSTDKNIDGVSKTEKGATXXXXXXXXXXXXXXXXAPELDSETEELLSKQYDGLLVGSDE 277
            T ++ + D     EK A                   E  S+ E+LL K+Y+G+L  S +
Sbjct: 249 -THSNIDYDTDDGNEKNAIDSKSNAIGAQTQSNK---ETTSDNEDLLIKEYEGMLGSSGD 304

Query: 278 ESEPEFQLDPTIDYNQVTXXXXXXXXXXXXXXXXXXXXXXXXX-XNKKPK-YNLPELMNG 335
           E E    L+P I+YN+VT                            KKPK +NLPELM G
Sbjct: 305 EGEGGGYLNPNINYNEVTDEEPSEASSDEDDSDERFSDSEENEPRRKKPKLHNLPELMAG 364

Query: 336 YISG-DEEEDLD-----------------DKVARKQIAAVPVKKNRRGQRARQKIWEKKY 377
           Y SG D EE+ D                 D+ AR+Q++  P +KNRRGQRAR+KIWEKKY
Sbjct: 365 YYSGNDTEEESDEDNKNVKGKKKKRDTAEDRTAREQMSNEPKRKNRRGQRARRKIWEKKY 424

Query: 378 GSQAKHVQRQLEKEHKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSQYNSQSSTSNIP 437
           GSQAKHVQR+LEKE +                                    + + +N  
Sbjct: 425 GSQAKHVQRELEKEMEDRKQRQIEYEARVAKREAKAASLEASRSRERED---RRTETNNK 481

Query: 438 PPPQPVITADKPIHPSWEAKRIAEEKQKNVKFQ 470
              +   T ++  HPSW AKR+AEEK +  KF+
Sbjct: 482 KEKESASTGEE--HPSWIAKRLAEEKLQKAKFE 512

>CAGL0M07678g complement(767857..769278) similar to sp|Q04347
           Saccharomyces cerevisiae YMR014w, hypothetical start
          Length = 473

 Score = 97.1 bits (240), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 66/189 (34%), Positives = 108/189 (57%), Gaps = 33/189 (17%)

Query: 1   MGKDNLIFKLDNLEYQIHYMNNEAEQFQPRFKQTLQFFNSKSRKTNKKVTKLLEAADKQK 60
           M K+NL+ KLD LEYQ HY+    E+F+PRF  T +FFN+K +K NKKVTK+LE++DK+K
Sbjct: 1   MSKENLLLKLDRLEYQWHYLQETHEKFEPRFPFTQRFFNAKGKKNNKKVTKILESSDKEK 60

Query: 61  INGEISSLRLKILDQKIHHVLQRLQTHWIKN-------------PLILREPEVAKIGA-- 105
           +  ++  +R++IL++KIH+V + +  +  K              P++  E   AK GA  
Sbjct: 61  VRSDLKEVRVEILNRKIHNVEKHVNNYLFKTIKSIVSNDKSVFQPVL--EAVEAKYGAGD 118

Query: 106 ---EQFIKYMSYSKLVKLTMSLMG-------------GNKTCPEWFREHEFYQISNDKTN 149
                F + ++ SK +K  +S +               +K  P+W  +HE+ ++  DK N
Sbjct: 119 AGLHDFCEIVTKSKAIKFIISKLQKSSANIASANEEVSDKRIPKWAADHEYVKMWTDKNN 178

Query: 150 ELNPSRIYN 158
           + NPS+++N
Sbjct: 179 KYNPSKVWN 187

 Score = 90.1 bits (222), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 76/140 (54%), Gaps = 11/140 (7%)

Query: 332 LMNGYISG--DEEEDLDDKVARKQIAAVPVKKNRRGQRARQKIWEKKYGSQAKHVQRQLE 389
           LM GY+SG  DEE ++DD +A++QI   P KKNRRGQRAR+KIWE+KYGS+AKHVQR++E
Sbjct: 335 LMVGYVSGGSDEEIEVDD-IAKEQIEIKPQKKNRRGQRARRKIWEQKYGSKAKHVQREIE 393

Query: 390 KEHKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSQYNSQSSTSNIPPPPQPVITADKP 449
           KE +                                +Y ++ +                 
Sbjct: 394 KEMEKKRKRQAEYEERVAKRAARAEQN--------EEYQAKKAEIKREKEEHRKKLEKIE 445

Query: 450 IHPSWEAKRIAEEKQKNVKF 469
            HPSW AK++AE+K+KN KF
Sbjct: 446 DHPSWVAKKMAEDKEKNAKF 465

>Kwal_56.23557
          Length = 594

 Score = 32.7 bits (73), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 40/84 (47%), Gaps = 22/84 (26%)

Query: 65  ISSLRLKILDQKIHHV-LQRLQTHWIKNPLILREPEVAKIGAEQFIKYMSYSKLVKLTMS 123
           +S+L+L+ L +    V + RL +      ++L   EVA  G  + ++             
Sbjct: 481 VSALQLRTLLKHASSVPVARLSS-----TVVLCTAEVASAGKPELLR------------- 522

Query: 124 LMGGNKTC-PEWFREHEFYQISND 146
           L GGNKTC P W   H  YQ+++D
Sbjct: 523 LTGGNKTCQPSWI--HSKYQLNSD 544

>Scas_712.18
          Length = 882

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/55 (23%), Positives = 33/55 (60%), Gaps = 1/55 (1%)

Query: 70  LKILDQKIHHVLQRLQTHWIKNPLILREPEVAKIGAEQFIKYMSYSKLVKLTMSL 124
           +K++D K+  +L+ +   W  +  I+++P+++ +   QF++ M  + L+ L  S+
Sbjct: 650 IKLIDSKVADILETVDLDW-NSKEIIQDPDISIVDVAQFLEMMFATTLINLPYSI 703

>CAGL0I00462g complement(33501..34250) similar to tr|Q05905
           Saccharomyces cerevisiae YLR301w, start by similarity
          Length = 249

 Score = 31.2 bits (69), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 32/66 (48%), Gaps = 2/66 (3%)

Query: 46  NKKVTKLLEAADKQKINGEISSLRLKILDQKIHHVLQRLQTHWIKNPLILREPEVAKIGA 105
           N K   +L+A D +KI+G + S  LK++D +    L  +   W +    L +   + +  
Sbjct: 140 NSKDLVILDAGDGRKIDGPVRSTVLKVVDGQDFEGLMIIVGEWAQG--YLADKNKSSVDG 197

Query: 106 EQFIKY 111
             F++Y
Sbjct: 198 LSFVRY 203

>Sklu_2433.11 YGL233W, Contig c2433 17844-20498
          Length = 884

 Score = 29.3 bits (64), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 14/55 (25%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 70  LKILDQKIHHVLQRLQTHWIKNPLILREPEVAKIGAEQFIKYMSYSKLVKLTMSL 124
           ++++D K+  +++ ++  W+    I +EP+++     QF++ M  S LV L  S+
Sbjct: 657 IELIDSKVSDLMEFVELDWVATT-IKQEPDISIRDIAQFLEMMFTSTLVNLPYSV 710

>Kwal_47.19214
          Length = 876

 Score = 29.3 bits (64), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 70  LKILDQKIHHVLQRLQTHWIKNPLILREPEVAKIGAEQFIKYMSYSKLVKL 120
           + ++D K+  +++ ++  W     ILREP+ +     QF++ M  S LV L
Sbjct: 651 IALIDSKVSDLMEFVEFEWASQE-ILREPDYSIKDIAQFLEMMFNSTLVNL 700

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.311    0.130    0.366 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,980,220
Number of extensions: 476968
Number of successful extensions: 1739
Number of sequences better than 10.0: 28
Number of HSP's gapped: 1708
Number of HSP's successfully gapped: 39
Length of query: 470
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 365
Effective length of database: 12,961,219
Effective search space: 4730844935
Effective search space used: 4730844935
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 63 (28.9 bits)