Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0D11198g51550723730.0
Sklu_2168.25004898091e-102
Scas_709.555195007154e-88
Kwal_26.81645004986971e-85
ABR051C4844626123e-73
CAGL0M07700g4873415093e-58
YMR013C (SEC59)5194105098e-58
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D11198g
         (507 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D11198g complement(954239..955786) some similarities with s...   918   0.0  
Sklu_2168.2 YMR013C, Contig c2168 1038-2540 reverse complement        316   e-102
Scas_709.55                                                           280   4e-88
Kwal_26.8164                                                          273   1e-85
ABR051C [642] [Homologous to ScYMR013C (SEC59) - SH] (487498..48...   240   3e-73
CAGL0M07700g <772282..773746 similar to sp|P20048 Saccharomyces ...   200   3e-58
YMR013C (SEC59) [3977] chr13 complement(295178..296737) Dolichol...   200   8e-58

>KLLA0D11198g complement(954239..955786) some similarities with
           sp|P20048 Saccharomyces cerevisiae YMR013c SEC59
           dolichol kinase singleton, hypothetical start
          Length = 515

 Score =  918 bits (2373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/507 (91%), Positives = 462/507 (91%)

Query: 1   MPTSTLAKGATSDLGVGNVYSKENSNVNSGSKGNLSRDSIISEVLDKVFEADRVIQLTIL 60
           MPTSTLAKGATSDLGVGNVYSKENSNVNSGSKGNLSRDSIISEVLDKVFEADRVIQLTIL
Sbjct: 1   MPTSTLAKGATSDLGVGNVYSKENSNVNSGSKGNLSRDSIISEVLDKVFEADRVIQLTIL 60

Query: 61  GLSSHLVYAKYGSEPWFSQQFSMVTSVLMAYVVNLWMSATRTNLGVNTLPTFNTIYLFYM 120
           GLSSHLVYAKYGSEPWFSQQFSMVTSVLMAYVVNLWMSATRTNLGVNTLPTFNTIYLFYM
Sbjct: 61  GLSSHLVYAKYGSEPWFSQQFSMVTSVLMAYVVNLWMSATRTNLGVNTLPTFNTIYLFYM 120

Query: 121 QLLLSTLFVPQYLLLNTVLAFSISDISVFFKIPLQIIFLLMGDDGSANIANDVKALVLNY 180
           QLLLSTLFVPQYLLLNTVLAFSISDISVFFKIPLQIIFLLMGDDGSANIANDVKALVLNY
Sbjct: 121 QLLLSTLFVPQYLLLNTVLAFSISDISVFFKIPLQIIFLLMGDDGSANIANDVKALVLNY 180

Query: 181 FFIFGLYKTSKLKSLDKTECHMFALLCTDILALVESDSIYFQVFQVCFTSFIVLVTVTSA 240
           FFIFGLYKTSKLKSLDKTECHMFALLCTDILALVESDSIYFQVFQVCFTSFIVLVTVTSA
Sbjct: 181 FFIFGLYKTSKLKSLDKTECHMFALLCTDILALVESDSIYFQVFQVCFTSFIVLVTVTSA 240

Query: 241 VSYGLESVGATRWIRTLLLLPMIVVGFSYYIQTNLIINNVPPFTWLIDYIGSSMIRLKIM 300
           VSYGLESVGATRWIRTLLLLPMIVVGFSYYIQTNLIINNVPPFTWLIDYIGSSMIRLKIM
Sbjct: 241 VSYGLESVGATRWIRTLLLLPMIVVGFSYYIQTNLIINNVPPFTWLIDYIGSSMIRLKIM 300

Query: 301 GIWLGSALLLLPSVFALKSNWSLNTSRKVWHFAILPLLIPAIMMDSNFVKIALAGTVNLF 360
           GIWLGSALLLLPSVFALKSNWSLNTSRKVWHFAILPLLIPAIMMDSNFVKIALAGTVNLF
Sbjct: 301 GIWLGSALLLLPSVFALKSNWSLNTSRKVWHFAILPLLIPAIMMDSNFVKIALAGTVNLF 360

Query: 361 LIVEYIRFLHIYPVGHYLDKHLRSFADFRDEKGPXXXXXXXXXXXXXXPFXXXXXXXXXX 420
           LIVEYIRFLHIYPVGHYLDKHLRSFADFRDEKGP              PF          
Sbjct: 361 LIVEYIRFLHIYPVGHYLDKHLRSFADFRDEKGPIIISYLYFIIGISLPFLINGSIIGII 420

Query: 421 XXXXXXXXASIIGKKFGRNRWPNTCKTFEXXXXXXXXXXXXXVIMKVYFNFFTEVSFMNL 480
                   ASIIGKKFGRNRWPNTCKTFE             VIMKVYFNFFTEVSFMNL
Sbjct: 421 SLGVGDSLASIIGKKFGRNRWPNTCKTFEGTFAFIAATGITTVIMKVYFNFFTEVSFMNL 480

Query: 481 VLVCFLAGILEGNSTLNDNLLIPTFML 507
           VLVCFLAGILEGNSTLNDNLLIPTFML
Sbjct: 481 VLVCFLAGILEGNSTLNDNLLIPTFML 507

>Sklu_2168.2 YMR013C, Contig c2168 1038-2540 reverse complement
          Length = 500

 Score =  316 bits (809), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 191/489 (39%), Positives = 287/489 (58%), Gaps = 20/489 (4%)

Query: 36  SRDSIISE-----VLDKVFEADRVIQLTILGLSSHLVYAKYGSEPWFSQQFSMVTSVLMA 90
            R++I+ E       D  F  +R+ QL ILG++ HL   KY ++   S  F    +  +A
Sbjct: 8   ERNAILEENKDYSFADGFFATERIAQLVILGVTIHLCVDKYMNDENDSLLFQSALTSAVA 67

Query: 91  YVVNLWMSATRTNL------GVNT------LPTFNTIYLFYMQLLLSTLFVPQYLLLNTV 138
           +VV   ++  RT +      G N       LP FN IYL Y+  +LS LF  + +L+N+ 
Sbjct: 68  FVVGSLVNY-RTRMVNNGAWGDNVHRLSEFLPDFNVIYLLYLPFMLSLLFARRLVLVNSA 126

Query: 139 LAFSISDISVFFKIPLQIIFLLMGDDGSANIANDVKALVLNYFFIFGLYKTSKLKSLDKT 198
           +AF+ +DI V  K+PLQ++F+L+ ++   + + ++KA+ +N    + L K S LKSLD  
Sbjct: 127 MAFNSTDIPVHLKLPLQLVFVLINEEYYTDRSTNMKAIAINVALCYVLEKISDLKSLDHV 186

Query: 199 ECHMFALLCTDILALVESDSIYFQVFQVCFTSFIVLVTVTSAVSYGLESVGATRWIRTLL 258
           +C++F++L T++L L++S +++FQ+ Q     FIV V+V  A+S+ L    A+ ++R+L+
Sbjct: 187 DCNLFSILLTNVLYLIDSPTVHFQILQKVLYGFIVAVSVNYALSFPLRY--ASTYLRSLI 244

Query: 259 LLPMIVVGFSYYIQTNLIINNVPPFTWLIDYIGSSMIRLKIMGIWLGSALLLLPSVFALK 318
           L     + F   +   L I+   P TWL +YI SS  R+KI+ IWL   L+L+P+V   K
Sbjct: 245 LFSSFSLIFPLTVTRILTIDRKKPLTWLYEYIFSSDTRIKIIFIWLLCLLVLIPNVMIFK 304

Query: 319 SNWSLNTSRKVWHFAILPLLIPAIMMDSNFVKIALAGTVNLFLIVEYIRFLHIYPVGHYL 378
           SN+SLNTSRK+WHF IL LLIP + +D  FVK++L+GTV LFL+VEY+R+L + PVG +L
Sbjct: 305 SNFSLNTSRKIWHFLILFLLIPPLQLDPEFVKVSLSGTVVLFLVVEYLRYLKLEPVGKFL 364

Query: 379 DKHLRSFADFRDEKGPXXXXXXXXXXXXXXPFXXXXXXXXXXXXXXXXXXASIIGKKFGR 438
           D+ LRSF+DFRD++GP              P                   ASI+G K+GR
Sbjct: 365 DEKLRSFSDFRDDRGPIIISYIYLIIGVSAPILINGSLVGVISLGVGDSLASIVGGKWGR 424

Query: 439 NRWPNTCKTFEXXXXXXXXXXXXXVIMKVYFNFFTEVSFMNLVLVCFLAGILEGNSTLND 498
            +WP T KT E             +  +  +N F+ +S  N+VL C ++GILEGNS LND
Sbjct: 425 IKWPGTNKTVEGTLVFILATSAVSLFCQHRYNSFSPISNGNVVLTCIVSGILEGNSVLND 484

Query: 499 NLLIPTFML 507
           N+LIP FML
Sbjct: 485 NILIPPFML 493

>Scas_709.55
          Length = 519

 Score =  280 bits (715), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 171/500 (34%), Positives = 273/500 (54%), Gaps = 18/500 (3%)

Query: 21  SKENSNVNSGSKG--NLSRDSIISEV-LDKVFEA--DRVIQLTILGLSSHLVYAKYGS-- 73
           SK+ S +    K    +  D ++++  L+ +F +  +++IQ+ IL  S  L Y +YG+  
Sbjct: 17  SKDMSQIQEEEKKRKEVDTDPVLNDRWLEDIFSSVPEKLIQIFILASSVFLCYKQYGAVD 76

Query: 74  EPWFS--QQFSMVTSVLMAYVVNLWMSATRTNLGVNTLPTFNTIYLFYMQLLLSTLFVPQ 131
           +  FS  +  + V  +L+++++         +   NTLP F  +YL ++  + S LF  +
Sbjct: 77  DDDFSIFKNEARVAGMLLSFLLR-----KCNDRDANTLPQFEIVYLLFLPFMTSFLFKKE 131

Query: 132 YLLLNTVLAFSISDISVFFKIPLQIIFLLMGDDGSANIANDVKALVLNYFFIFGLYKTSK 191
             + N++LA +  DI ++ KIP+Q +F+    +  A +      ++LN+     L K  +
Sbjct: 132 LTIFNSILALNALDIPLYEKIPMQALFIGFSAESDAELWEYGYGMLLNFSICQTLMKIGQ 191

Query: 192 LKSLDKTECHMFALLCTDILALVESD--SIYFQVFQVCFTSFIVLVTVTSAVSYGLESVG 249
           LKSLD  +C++F+++ T++L +++ +  S+ FQ+ +    +F V V +   +S  L  + 
Sbjct: 192 LKSLDVIDCNLFSIVLTNVLYMIDPELPSLSFQILRGSLIAFFVTVAINYIISSLLTKMK 251

Query: 250 ATRWIRTLLLLPMIVVGFSYYIQTNLIINNVP--PFTWLIDYIGSSMIRLKIMGIWLGSA 307
               I++L L  + V+ F   +   + + ++   P  WL+ Y+  S  R  I+ +WL   
Sbjct: 252 KNPHIKSLSLFSIFVIVFPILMDQLIQLESIDERPSMWLLQYVLGSSARKSILLVWLSFL 311

Query: 308 LLLLPSVFALKSNWSLNTSRKVWHFAILPLLIPAIMMDSNFVKIALAGTVNLFLIVEYIR 367
           L+L+P+V   KSN+SLNTSRK+WHF IL L+     MD  FVKIAL+GT+ LFL VEY+R
Sbjct: 312 LILIPNVLIFKSNFSLNTSRKIWHFLILLLITMPFQMDPLFVKIALSGTIVLFLSVEYLR 371

Query: 368 FLHIYPVGHYLDKHLRSFADFRDEKGPXXXXXXXXXXXXXXPFXXXXXXXXXXXXXXXXX 427
           FL + P G Y+D  LRSFADFRD+KGP              P                  
Sbjct: 372 FLQLEPFGAYIDSKLRSFADFRDDKGPIIISYIYLIIGISTPLLINDSPVGLISLGVGDS 431

Query: 428 XASIIGKKFGRNRWPNTCKTFEXXXXXXXXXXXXXVIMKVYFNFFTEVSFMNLVLVCFLA 487
            ASIIG K+GR  WP T KT E              I+K Y  +F +++F NL+ VC ++
Sbjct: 432 LASIIGGKWGRYHWPGTRKTIEGTLSFIIGTSIVAYILKYYMEYFADITFSNLLWVCTIS 491

Query: 488 GILEGNSTLNDNLLIPTFML 507
           GILEGNS LNDN+LIPT+M+
Sbjct: 492 GILEGNSELNDNILIPTYMM 511

>Kwal_26.8164
          Length = 500

 Score =  273 bits (697), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 169/498 (33%), Positives = 263/498 (52%), Gaps = 23/498 (4%)

Query: 25  SNVNSGSKGNLSRDSIISEVLDKVFEADRVIQLTILGLSSHLVYAKYGSEPWFSQQFSMV 84
           S  ++  +  +++++    + D++   +++ QL +LG + HL   K       S  F   
Sbjct: 2   SKQDAEERQAIAKENEEFSIFDQLMGPEKMAQLLLLGGTVHLAVLKLMVTEKDSALFQAA 61

Query: 85  TSVLMAYVVNLWMSATRTNLGVNT------------LPTFNTIYLFYMQLLLSTLFVPQY 132
            +  +A VV L +S  RT +  N             +P FN +YL Y+  LLS LF    
Sbjct: 62  LAAAVAVVVGLGVS-YRTKIANNGEWGTDLQRISGFVPDFNVLYLLYIPSLLSLLFARDL 120

Query: 133 LLLNTVLAFSISDISVFFKIPLQIIFLLMGDDGSANIANDVKALVLNYFFIFGLYKTSKL 192
            ++N  LAF+ +D  +  ++PLQ IF+LM +D     + ++KA+ +N    F + +  +L
Sbjct: 121 TVVNMALAFNCTDHPLILRLPLQAIFVLMNNDFGDKRSKNLKAIGINCLIEFLIERIGQL 180

Query: 193 KSLDKTECHMFALLCTDILALVESDSIYFQVFQVCFTSFIVLVTVTSAVSYGLESVGATR 252
           KS D+ E ++F++  T++L L+ES S++FQV +     F+      +AV++    +  T 
Sbjct: 181 KSFDRVESNLFSICLTNVLYLLESSSLHFQVLRHVLLGFL------AAVAFNFPLLIITS 234

Query: 253 ----WIRTLLLLPMIVVGFSYYIQTNLIINNVPPFTWLIDYIGSSMIRLKIMGIWLGSAL 308
               ++R+ +L     V F   I     +    P  WL DYI S+ IR++I+  WL   +
Sbjct: 235 RFNPYLRSAILSTSFFVVFPLTILYTFEVEGQNPAIWLFDYITSNDIRVRIIAGWLSCLV 294

Query: 309 LLLPSVFALKSNWSLNTSRKVWHFAILPLLIPAIMMDSNFVKIALAGTVNLFLIVEYIRF 368
           +L+P++   KSN+SLNTSRK+WHF IL L+      D +FVKI+LAGT+ LFL VEY+RF
Sbjct: 295 ILVPNIMIFKSNFSLNTSRKIWHFLILALIAVPFRYDPDFVKISLAGTIVLFLAVEYLRF 354

Query: 369 LHIYPVGHYLDKHLRSFADFRDEKGPXXXXXXXXXXXXXXPFXXXXXXXXXXXXXXXXXX 428
           L + P G  LD  LRSFADFRDE+GP              P                   
Sbjct: 355 LKLAPYGELLDSKLRSFADFRDERGPIIISYIYLIIGVATPILINGSLVGVISLGVGDSL 414

Query: 429 ASIIGKKFGRNRWPNTCKTFEXXXXXXXXXXXXXVIMKVYFNFFTEVSFMNLVLVCFLAG 488
           ASI+G ++GR++WP T KT E             +  K++   F E++   ++L C L+G
Sbjct: 415 ASIVGYRWGRHQWPGTSKTLEGTFAFILSTSICSLCFKLFLGAFQEITSAQVILACILSG 474

Query: 489 ILEGNSTLNDNLLIPTFM 506
           ILEGNS LNDN+LIP +M
Sbjct: 475 ILEGNSVLNDNILIPAYM 492

>ABR051C [642] [Homologous to ScYMR013C (SEC59) - SH]
           (487498..488952) [1455 bp, 484 aa]
          Length = 484

 Score =  240 bits (612), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 145/462 (31%), Positives = 237/462 (51%), Gaps = 18/462 (3%)

Query: 51  ADRVIQLTILGLSSHLVYAKYGSEPWFSQQFSMVTSVLMAYVVNLWMSATRTNLGVNTLP 110
             + +Q  +L ++ HL    +G +      F    SV          +A         +P
Sbjct: 27  GGKAVQAVVLAVTVHLAAEVFGKDEAGRAAFYSALSV---------AAAYGAAAAAGRVP 77

Query: 111 TFNTIYLFYMQLLLSTLFVPQYLLLNTVLAFSISDISVFFKIPLQIIFLLMGDDGSANIA 170
            FN +Y+ Y+ +++S LF  + + +N  +A     + V  ++  Q+  L +         
Sbjct: 78  AFNAVYVVYLPVMVSLLFRRELVPVNCAMALGGMQMPVVLRVLQQLTILYLQPAARGRGF 137

Query: 171 NDVKALVLNYFFIFGLYKT-SKLKSLDKTECHMFALLCTDILALVESDS-IYFQVFQVCF 228
                +      + G ++  S+L+SLD  +C + ++L T++L ++  +S + FQ+ + C 
Sbjct: 138 PGRGGVGGAPGGVVGRWRGWSELRSLDMVDCGLLSILLTNVLFVIGGESSVQFQILRACL 197

Query: 229 TSFIVLVTVTSAV--SYGLESVGATRWIRTLLLLPMIVVGFSYYIQTNLIINNVP-PFTW 285
             F+V V        +YG  +    +++RT +LL +  + F   I   L +++      W
Sbjct: 198 YGFLVAVGANYVFVRAYGRRN----QYVRTAVLLAVFALVFPSVILAFLDLDDTDNALVW 253

Query: 286 LIDYIGSSMIRLKIMGIWLGSALLLLPSVFALKSNWSLNTSRKVWHFAILPLLIPAIMMD 345
           LI YI SS +R++IM  WL    +L+PSVF +KS+ SLNTSRK+WHFA+LPLL+  + ++
Sbjct: 254 LIKYIFSSALRMQIMAGWLVFLGVLIPSVFVMKSHLSLNTSRKIWHFALLPLLVCQMAVE 313

Query: 346 SNFVKIALAGTVNLFLIVEYIRFLHIYPVGHYLDKHLRSFADFRDEKGPXXXXXXXXXXX 405
             F  +A+AGTV +FLIVEY R++++YP G Y++  LR+F DFRDE+GP           
Sbjct: 314 PEFTTVAIAGTVVVFLIVEYFRYMNLYPFGDYINAQLRTFTDFRDEQGPIIVSYLYLILG 373

Query: 406 XXXPFXXXXXXXXXXXXXXXXXXASIIGKKFGRNRWPNTCKTFEXXXXXXXXXXXXXVIM 465
              P                   ASIIG+++G+  WP T KT E             ++ 
Sbjct: 374 VSFPLLINRSLVGVISLGVGDSLASIIGRRYGKYHWPGTNKTVEGTLAFIVASAALCLVC 433

Query: 466 KVYFNFFTEVSFMNLVLVCFLAGILEGNSTLNDNLLIPTFML 507
           +  F  F  V+  N++L C ++GILEGNS LNDN+LIP+FML
Sbjct: 434 QQAFLAFEGVATRNIILACVVSGILEGNSDLNDNILIPSFML 475

>CAGL0M07700g <772282..773746 similar to sp|P20048 Saccharomyces
           cerevisiae YMR013c dolichol kinase, start by similarity
          Length = 487

 Score =  200 bits (509), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 122/341 (35%), Positives = 179/341 (52%), Gaps = 13/341 (3%)

Query: 173 VKALVLNYFFIFGLYKTSKLKSLDKTECHMFALLCTDILALVESDSI-YFQVFQVCFTSF 231
           VK LV NY  +  L    +LK+LD+ +C++F +L TD L +  + +  Y  V +   TS 
Sbjct: 145 VKCLVANYLLVNWLEDIGQLKTLDQIDCNLFGILLTDCLMINNATAPNYLLVLKGAMTSV 204

Query: 232 IVLVTVTSAVSYGLESVGATRWIRT--LLLLPMIV---VGFSYYIQTNLIINNVPPFTWL 286
           ++++ V   ++  + S+  +  +    L+L P++V   + FS    T+       P  WL
Sbjct: 205 MIIIVVNHFLTRLIPSLSNSIVLAGNFLVLFPILVNHLIDFSNEKITS-------PALWL 257

Query: 287 IDYIGSSMIRLKIMGIWLGSALLLLPSVFALKSNWSLNTSRKVWHFAILPLLIPAIMMDS 346
           ID+I  S IR  IM  W+   ++ +P V   KS  SLNTSRK+WHF I  L++    +D 
Sbjct: 258 IDFILESEIRQYIMLSWVIVLVVFIPLVILFKSKISLNTSRKIWHFVIFLLIVEPFHLDP 317

Query: 347 NFVKIALAGTVNLFLIVEYIRFLHIYPVGHYLDKHLRSFADFRDEKGPXXXXXXXXXXXX 406
            FVKI+L G +  FL VEY+R+L I P G +LD  LRSFAD+RD++GP            
Sbjct: 318 EFVKISLCGIIPCFLSVEYLRYLKIEPYGEHLDFFLRSFADYRDQRGPLIVSYIYLITGI 377

Query: 407 XXPFXXXXXXXXXXXXXXXXXXASIIGKKFGRNRWPNTCKTFEXXXXXXXXXXXXXVIMK 466
             P                   ASI+GKK GR  W  T KT E              I++
Sbjct: 378 TIPLLLFESPVGLVSLGVGDSLASIVGKKVGRMHWKGTNKTIEGTVAFIVGTTFISWILQ 437

Query: 467 VYFNFFTEVSFMNLVLVCFLAGILEGNSTLNDNLLIPTFML 507
            YFN+F+ +    ++++C   G+LEGNS LNDN+LIP FM+
Sbjct: 438 RYFNYFSTIDIFKILVICTTGGVLEGNSELNDNILIPLFMV 478

>YMR013C (SEC59) [3977] chr13 complement(295178..296737) Dolichol
           kinase, mutants accumulate incompletely glycosylated
           protein precursors in ER [1560 bp, 519 aa]
          Length = 519

 Score =  200 bits (509), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 135/410 (32%), Positives = 215/410 (52%), Gaps = 15/410 (3%)

Query: 105 GVNTLPTFNTIYLFYMQLLLSTLFVPQYLLLNTVLAFSISD----ISVFFKIPLQIIFLL 160
           G  +LP F+TIY  Y+  ++S LF     ++NT+L  S+ +     +    I LQ+  + 
Sbjct: 110 GYKSLPKFDTIYSLYLPFMVSLLFDTSSTVINTILILSVLNSYRWRTQLVVIILQLCLIF 169

Query: 161 MGDDGSANIANDVKALVLNYFFIFGLYKTSKLKSLDKTECHMFALLCTDILALVESDSIY 220
              +    + N + ++V+N      L    +LKSLD  + ++F++L T+IL + E+ +++
Sbjct: 170 FNFEAGDRLKN-IISIVINSLLSLILKYIGQLKSLDNIDSNLFSILLTNILYVSEAGTVH 228

Query: 221 FQVFQVCFTSFIVLVTVTSAVSYGLESVGATRWIRTLLLLPMIVVGFSYYIQTNLIINNV 280
           F++ +      I+ +T   +++Y L+ V      +  +L     +G   +  T + + + 
Sbjct: 229 FRILK----GIILALTTIISINYVLKKV---MHFKPFMLSISFAIGLPLFANTFIHLEDG 281

Query: 281 P-PFTWLIDYIGSSMIRLKIMGIWLGSALLLLPSVFALKSNWSLNTSRKVWHFAILPLLI 339
             P  WL+ YI  S IR KI+  W    +L +PS+   K + SLNTSRK+WHF I  L+I
Sbjct: 282 ENPLLWLVKYILESTIRQKILFAWSSILILSIPSILIEKDSLSLNTSRKLWHFIIFLLII 341

Query: 340 PAIMMDSNFVKIALAGTVNLFLIVEYIRFLHIYPVGHYLDKHLRSFADFRDEKGPXXXXX 399
           P+  MDSNFVKIAL+GT+ +FL +EYIRF ++ P+G  ++  LR FAD RD  GP     
Sbjct: 342 PSFQMDSNFVKIALSGTIPVFLSIEYIRFQNLPPLGSAIELQLRRFADDRDHSGPLIISY 401

Query: 400 XXXXXXXXXPFXXXXXXXXXXXXXXXXXXASIIGKKFGRNRWPNTCKTFEXXXXXXXXXX 459
                    P                   ASIIGK++GR RW  T KT E          
Sbjct: 402 LYLLFGISTPLLMNNSPMGLIGLGIGDSLASIIGKRYGRIRWKGTQKTLEGTLAFIVTSF 461

Query: 460 XXXVIMKVYFN--FFTEVSFMNLVLVCFLAGILEGNSTLNDNLLIPTFML 507
              +++  +     F  ++ + L+ +C L+G+LEGNS LNDN+LIP FM+
Sbjct: 462 IVCLVLLRFDKAAIFNHLTTLQLLTLCTLSGVLEGNSVLNDNILIPAFMM 511

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.327    0.141    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,844,295
Number of extensions: 526367
Number of successful extensions: 1832
Number of sequences better than 10.0: 17
Number of HSP's gapped: 1854
Number of HSP's successfully gapped: 17
Length of query: 507
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 401
Effective length of database: 12,926,601
Effective search space: 5183567001
Effective search space used: 5183567001
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 64 (29.3 bits)