Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0D11044g53652822310.0
AFR040W54735116520.0
Scas_654.1752335116420.0
YNL154C (YCK2)54633016260.0
Kwal_33.1459650033015990.0
YHR135C (YCK1)53832715970.0
CAGL0G06138g53934815790.0
Scas_697.1252932515500.0
CAGL0J05940g48632615440.0
Scas_627.447533711831e-158
Kwal_47.1731442138411641e-156
YER123W (YCK3)52435111571e-154
ADL053C47134011351e-151
Sklu_2359.348835911351e-151
KLLA0E13563g47334011341e-151
CAGL0K02299g53836211381e-151
KLLA0D03168g5052918081e-102
AFL091W4782918011e-101
Kwal_56.240644752958001e-101
Scas_720.244732917971e-100
CAGL0H03553g4952917981e-100
Sklu_1892.34742917921e-100
YPL204W (HRR25)4942917931e-99
Scas_690.124882896781e-82
YDR490C (PKH1)7662721782e-13
KLLA0C08525g15512231731e-12
KLLA0C12485g9252331667e-12
Scas_618.84272121611e-11
Sklu_2437.1610712551587e-11
AER264C14832331588e-11
Kwal_56.226939843101561e-10
AFR335C10332521533e-10
AAR009W4532131504e-10
Scas_660.209572281506e-10
Scas_502.211162621481e-09
Kwal_23.632515422331481e-09
YJL095W (BCK1)14782751481e-09
CAGL0I07513g10762701481e-09
CAGL0G04609g9651331471e-09
CAGL0L03520g14472261471e-09
AEL284C4792231451e-09
YOL100W (PKH2)10811741462e-09
KLLA0E03487g6472301452e-09
YDR466W (PKH3)8982381452e-09
AFL101C3672281413e-09
KLLA0F16467g3401591386e-09
Sklu_2436.147841251417e-09
YGL158W (RCK1)5122481399e-09
Kwal_26.735514462741391e-08
CAGL0K08514g14892511391e-08
KLLA0B02332g3612141343e-08
AFL188C4722331353e-08
YHR205W (SCH9)8241351353e-08
Scas_613.55172321325e-08
KLLA0F14190g13382481336e-08
AFR377C7262161336e-08
Scas_711.2515152801337e-08
ADR204W3391581308e-08
KLLA0B12716g7162151328e-08
Sklu_2232.23741591308e-08
Kwal_26.778812672161329e-08
Kwal_47.183076211241319e-08
Kwal_56.240593532331291e-07
YOR061W (CKA2)3391591291e-07
CAGL0K06479g9912451301e-07
Kwal_0.964272151281e-07
YCR073C (SSK22)13312381301e-07
CAGL0F09075g7461351291e-07
ABL034W14252201302e-07
CAGL0K03399g7032151292e-07
CAGL0B04301g5421601292e-07
Scas_703.57491351292e-07
CAGL0F04741g4421591282e-07
Kwal_26.76356912141273e-07
ADL389W7111351273e-07
KLLA0B03586g7341351273e-07
CAGL0G02035g3391591243e-07
YPL203W (TPK2)3802331254e-07
Scas_616.1014611281274e-07
KLLA0F13552g12672181274e-07
Sklu_2429.54322151254e-07
YKL101W (HSL1)15182491265e-07
Kwal_33.138463752281235e-07
CAGL0L07326g5062321246e-07
KLLA0D08415g7741391246e-07
ABL028W7221171247e-07
Kwal_56.240913811311228e-07
ABL143C7252231238e-07
Kwal_47.167617441351239e-07
YOL016C (CMK2)4472151229e-07
Sklu_2323.34001231229e-07
Sklu_2430.57331171231e-06
YPL209C (IPL1)3671451211e-06
YFR014C (CMK1)4461781211e-06
CAGL0L11550g10722281221e-06
YPL153C (RAD53)8212381211e-06
YOR233W (KIN4)8002211211e-06
KLLA0D03190g3722281192e-06
Scas_721.1246841171202e-06
Scas_627.73491221192e-06
Scas_593.14d4951541202e-06
CAGL0I05896g7781841202e-06
AFL090W3462291182e-06
YDL214C (PRR2)6991171202e-06
KLLA0F24618g5561351192e-06
ADL315C4342251192e-06
Kwal_33.144347591381202e-06
YBR028C5251471192e-06
Scas_717.696741171202e-06
AFR092W14232231202e-06
CAGL0K07458g7041161192e-06
YMR104C (YPK2)6771321193e-06
YGR052W3692221173e-06
Scas_660.286231611193e-06
CAGL0M08910g6121611174e-06
CAGL0E05720g3581241164e-06
CAGL0M08404g4622281165e-06
YHR102W (KIC1)10802211175e-06
YDR477W (SNF1)6331611165e-06
Scas_700.546982151165e-06
Scas_711.15727721167e-06
CAGL0K04301g3552371147e-06
KLLA0F11143g8131201167e-06
Scas_580.610152281168e-06
Kwal_33.139846491841158e-06
KLLA0C04191g7972391158e-06
CAGL0F00649g5141821149e-06
Scas_648.173401661131e-05
Kwal_26.87967961371141e-05
YKL126W (YPK1)6801171141e-05
KLLA0F01507g4721201131e-05
Kwal_47.182335981601141e-05
Scas_689.25*4092141131e-05
KLLA0F02838g7551001141e-05
KLLA0F23155g4272141131e-05
CAGL0C05005g10762301141e-05
YOR351C (MEK1)4972241131e-05
YKL166C (TPK3)3982281121e-05
AEL083W5361471131e-05
YJL141C (YAK1)8071841131e-05
AFR076W8201951131e-05
Scas_673.20*7582181122e-05
YJL164C (TPK1)3971341112e-05
Scas_655.28001381122e-05
ACR142W8371391122e-05
YNL183C (NPR1)7901381122e-05
ACR249C6431861122e-05
CAGL0K10604g4462141112e-05
CAGL0G09020g3612291102e-05
Scas_720.9416832371122e-05
CAGL0L06820g3661621102e-05
YOR231W (MKK1)5081321102e-05
ACL191C3651601093e-05
Kwal_27.119192092071073e-05
CAGL0I09504g5282301103e-05
CAGL0J03872g6612281103e-05
Kwal_26.87034441621093e-05
KLLA0A03806g6021601103e-05
AEL230W6081601103e-05
Sklu_1843.34861271094e-05
Scas_690.133542331084e-05
YNR031C (SSK2)15792551104e-05
Scas_698.373471581084e-05
KLLA0F01276g5192301085e-05
Scas_651.183711341075e-05
Sklu_2392.68081551085e-05
Scas_651.37931821085e-05
KLLA0E01584g4152371075e-05
Kwal_55.217093401631076e-05
KLLA0C03828g7931271086e-05
YMR139W (RIM11)3701611066e-05
KLLA0A05819g7041841076e-05
AEL115C3861191067e-05
Kwal_0.1555872601077e-05
Kwal_26.87098292261077e-05
KLLA0B09790g2952061058e-05
YNL161W (CBK1)7561511078e-05
CAGL0M02233g7671381078e-05
Sklu_2104.12992071049e-05
AFR035W7191511069e-05
CAGL0G04455g751711069e-05
YBR274W (CHK1)5271091051e-04
KLLA0F22297g6991301051e-04
YPL141C8652301051e-04
ADL283W3061671031e-04
Kwal_23.52908191111051e-04
YLR113W (HOG1)4351611041e-04
ADR058C2952071022e-04
Kwal_33.145547141551042e-04
AEL205W7931141042e-04
Kwal_27.98044731751032e-04
CAGL0J11308g7281381042e-04
Kwal_55.215458652291042e-04
KLLA0D13266g11521731042e-04
CAGL0M03729g8611111032e-04
KLLA0A02497g3621601022e-04
AGR048C4532031022e-04
CAGL0F03245g10362501033e-04
YDL101C (DUN1)5132321023e-04
KLLA0E21780g10162251023e-04
YNL298W (CLA4)8421111023e-04
YDL079C (MRK1)5011651023e-04
KLLA0F12188g5462671023e-04
YDL028C (MPS1)7641931023e-04
KLLA0B07205g4551341013e-04
CAGL0J06072g7731491023e-04
Scas_713.384321611013e-04
Kwal_26.7276646711023e-04
CAGL0M08316g9641911023e-04
Scas_654.127371511023e-04
KLLA0F20053g4442031013e-04
Scas_683.123562251003e-04
YPL031C (PHO85)3052131003e-04
Scas_718.725501671013e-04
Scas_713.216411381014e-04
ACR117W5241271014e-04
Sklu_2385.24342031004e-04
AER223C9022181014e-04
KLLA0D10527g6451861014e-04
Kwal_56.227885151391004e-04
CAGL0K02167g11621901014e-04
Kwal_33.141678381431014e-04
YAR019C (CDC15)9742201014e-04
AFR205C4571851005e-04
KLLA0E14828g310189995e-04
CAGL0M02299g8932251005e-04
Scas_667.18437175995e-04
Scas_721.1325842621005e-04
KLLA0A06776g8001731005e-04
Scas_653.25666227996e-04
ABL011C701233996e-04
CAGL0L12474g302239986e-04
Scas_598.6790112996e-04
KLLA0E06413g1161121996e-04
Kwal_26.9032591204997e-04
YKL048C (ELM1)640143997e-04
ACR196C53098997e-04
Sklu_1851.1683199997e-04
ADR379C492126987e-04
KLLA0C17160g831276997e-04
YPL140C (MKK2)506127988e-04
Scas_477.5703154988e-04
CAGL0J03828g467133988e-04
CAGL0M11748g447161988e-04
CAGL0M08360g766187988e-04
Kwal_14.1273415219979e-04
Scas_201.1*274117969e-04
Sklu_2442.21503261970.001
Scas_640.16505119970.001
Sklu_2211.51175121980.001
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D11044g
         (528 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D11044g complement(942458..944068) gi|730472|sp|P40230|RAG8...   863   0.0  
AFR040W [3232] [Homologous to ScYHR135C (YCK1) - SH; ScYNL154C (...   640   0.0  
Scas_654.17                                                           637   0.0  
YNL154C (YCK2) [4443] chr14 complement(343636..345276) Casein ki...   630   0.0  
Kwal_33.14596                                                         620   0.0  
YHR135C (YCK1) [2422] chr8 complement(372695..374311) Casein kin...   619   0.0  
CAGL0G06138g complement(585585..587204) similar to sp|P23291 Sac...   612   0.0  
Scas_697.12                                                           601   0.0  
CAGL0J05940g 560563..562023 similar to sp|P23291 Saccharomyces c...   599   0.0  
Scas_627.4                                                            460   e-158
Kwal_47.17314                                                         452   e-156
YER123W (YCK3) [1553] chr5 (404809..406383) Casein kinase I isof...   450   e-154
ADL053C [1688] [Homologous to ScYER123W (YCK3) - SH] (589602..59...   441   e-151
Sklu_2359.3 YER123W, Contig c2359 7455-8921 reverse complement        441   e-151
KLLA0E13563g 1193481..1194902 some similarities with sp|P39962 S...   441   e-151
CAGL0K02299g complement(205332..206948) similar to sp|P39962 Sac...   442   e-151
KLLA0D03168g 265761..267278 some similarities with sp|P29295 Sac...   315   e-102
AFL091W [3102] [Homologous to ScYPL204W (HRR25) - SH] complement...   313   e-101
Kwal_56.24064                                                         312   e-101
Scas_720.24                                                           311   e-100
CAGL0H03553g complement(328668..330155) highly similar to sp|P29...   311   e-100
Sklu_1892.3 YPL204W, Contig c1892 5770-7194                           309   e-100
YPL204W (HRR25) [5244] chr16 (164275..165759) Casein kinase I (s...   310   1e-99
Scas_690.12                                                           265   1e-82
YDR490C (PKH1) [1306] chr4 complement(1431956..1434256) Serine/t...    73   2e-13
KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces c...    71   1e-12
KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236 Saccha...    69   7e-12
Scas_618.8                                                             67   1e-11
Sklu_2437.16 YOL100W, Contig c2437 35714-38929 reverse complement      65   7e-11
AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C ...    65   8e-11
Kwal_56.22693                                                          65   1e-10
AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C (...    64   3e-10
AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C (C...    62   4e-10
Scas_660.20                                                            62   6e-10
Scas_502.2                                                             62   1e-09
Kwal_23.6325                                                           62   1e-09
YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine pr...    62   1e-09
CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces c...    62   1e-09
CAGL0G04609g complement(437162..440059) similar to sp|Q12236 Sac...    61   1e-09
CAGL0L03520g complement(401103..405446) similar to sp|Q01389 Sac...    61   1e-09
AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919) [...    60   1e-09
YOL100W (PKH2) [4721] chr15 (129236..132481) Serine/threonine pr...    61   2e-09
KLLA0E03487g complement(323764..325707) similar to sgd|S0002874 ...    60   2e-09
YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine p...    60   2e-09
AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH] (249144..25...    59   3e-09
KLLA0F16467g 1519800..1520822 highly similar to sp|P19454 Saccha...    58   6e-09
Sklu_2436.14 YDR466W, Contig c2436 31299-33653                         59   7e-09
YGL158W (RCK1) [1831] chr7 (207036..208574) Serine/threonine pro...    58   9e-09
Kwal_26.7355                                                           58   1e-08
CAGL0K08514g complement(853314..857783) similar to sp|P34244 Sac...    58   1e-08
KLLA0B02332g complement(206863..207948) similar to sp|P38991 Sac...    56   3e-08
AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..902...    57   3e-08
YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine pro...    57   3e-08
Scas_613.5                                                             55   5e-08
KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyvero...    56   6e-08
AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)...    56   6e-08
Scas_711.25                                                            56   7e-08
ADR204W [1945] [Homologous to ScYOR061W (CKA2) - SH] complement(...    55   8e-08
KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces...    55   8e-08
Sklu_2232.2 YOR061W, Contig c2232 1216-2340 reverse complement         55   8e-08
Kwal_26.7788                                                           55   9e-08
Kwal_47.18307                                                          55   9e-08
Kwal_56.24059                                                          54   1e-07
YOR061W (CKA2) [4869] chr15 (441535..442554) Casein kinase II (P...    54   1e-07
CAGL0K06479g 636296..639271 some similarities with tr|Q03306 Sac...    55   1e-07
Kwal_0.96                                                              54   1e-07
YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase...    55   1e-07
CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces c...    54   1e-07
ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH] complement(3...    55   2e-07
CAGL0K03399g complement(310487..312598) highly similar to sp|P12...    54   2e-07
CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces c...    54   2e-07
Scas_703.5                                                             54   2e-07
CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces c...    54   2e-07
Kwal_26.7635                                                           54   3e-07
ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH] complement(...    54   3e-07
KLLA0B03586g complement(326871..329075) similar to sp|P11792 Sac...    54   3e-07
CAGL0G02035g 179911..180930 highly similar to sp|P19454 Saccharo...    52   3e-07
YPL203W (TPK2) [5245] chr16 (166255..167397) Catalytic subunit o...    53   4e-07
Scas_616.10                                                            54   4e-07
KLLA0F13552g complement(1252906..1256709) gi|33386566|emb|CAD877...    54   4e-07
Sklu_2429.5 YOL016C, Contig c2429 9000-10298 reverse complement        53   4e-07
YKL101W (HSL1) [3161] chr11 (248566..253122) Serine/threonine pr...    53   5e-07
Kwal_33.13846                                                          52   5e-07
CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces c...    52   6e-07
KLLA0D08415g 714473..716797 similar to sp|P22211 Saccharomyces c...    52   6e-07
ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C (Y...    52   7e-07
Kwal_56.24091                                                          52   8e-07
ABL143C [449] [Homologous to ScYNL183C (NPR1) - SH; ScYDL214C (P...    52   8e-07
Kwal_47.16761                                                          52   9e-07
YOL016C (CMK2) [4800] chr15 complement(294777..296120) Calcium/c...    52   9e-07
Sklu_2323.3 YPL209C, Contig c2323 5241-6443                            52   9e-07
Sklu_2430.5 YKL126W, Contig c2430 8144-10345                           52   1e-06
YPL209C (IPL1) [5240] chr16 complement(156489..157592) Serine/th...    51   1e-06
YFR014C (CMK1) [1695] chr6 complement(172529..173869) Calcium/ca...    51   1e-06
CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces...    52   1e-06
YPL153C (RAD53) [5294] chr16 complement(261726..264191) Serine/t...    51   1e-06
YOR233W (KIN4) [5024] chr15 (775846..778248) Serine/threonine pr...    51   1e-06
KLLA0D03190g 267933..269051 highly similar to sp|P06245 Saccharo...    50   2e-06
Scas_721.124                                                           51   2e-06
Scas_627.7                                                             50   2e-06
Scas_593.14d                                                           51   2e-06
CAGL0I05896g 560169..562505 some similarities with sp|P14680 Sac...    51   2e-06
AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH] complement(...    50   2e-06
YDL214C (PRR2) [660] chr4 complement(74447..76546) Serine/threon...    51   2e-06
KLLA0F24618g complement(2288943..2290613) similar to sp|P38070 S...    50   2e-06
ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH] (146098..14...    50   2e-06
Kwal_33.14434                                                          51   2e-06
YBR028C (YBR028C) [220] chr2 complement(294387..295964) Serine/t...    50   2e-06
Scas_717.69                                                            51   2e-06
AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH] complement(...    51   2e-06
CAGL0K07458g complement(736336..738450) similar to sp|P12688 Sac...    50   2e-06
YMR104C (YPK2) [4061] chr13 complement(473419..475452) Serine/th...    50   3e-06
YGR052W (YGR052W) [2015] chr7 (593598..594707) Serine/threonine ...    50   3e-06
Scas_660.28                                                            50   3e-06
CAGL0M08910g complement(887703..889541) highly similar to sp|Q00...    50   4e-06
CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces c...    49   4e-06
CAGL0M08404g complement(836791..838179) some similarities with s...    49   5e-06
YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine pro...    50   5e-06
YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine p...    49   5e-06
Scas_700.54                                                            49   5e-06
Scas_711.15                                                            49   7e-06
CAGL0K04301g 404419..405486 similar to sp|P53233 Saccharomyces c...    49   7e-06
KLLA0F11143g complement(1026129..1028570) similar to sp|P22216 S...    49   7e-06
Scas_580.6                                                             49   8e-06
Kwal_33.13984                                                          49   8e-06
KLLA0C04191g 384198..386591 weakly similar to sp|P27636 Saccharo...    49   8e-06
CAGL0F00649g 71961..73505 similar to sp|P38623 Saccharomyces cer...    49   9e-06
Scas_648.17                                                            48   1e-05
Kwal_26.8796                                                           49   1e-05
YKL126W (YPK1) [3140] chr11 (205353..207395) Serine/threonine pr...    49   1e-05
KLLA0F01507g 144356..145774 some similarities with sp|P47042 Sac...    48   1e-05
Kwal_47.18233                                                          49   1e-05
Scas_689.25*                                                           48   1e-05
KLLA0F02838g 264329..266596 some similarities with sp|P32581 Sac...    49   1e-05
KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces...    48   1e-05
CAGL0C05005g complement(467626..470856) similar to sp|P27636 Sac...    49   1e-05
YOR351C (MEK1) [5128] chr15 complement(995013..996506) Serine/th...    48   1e-05
YKL166C (TPK3) [3104] chr11 complement(134514..135710) Catalytic...    48   1e-05
AEL083W [2423] [Homologous to ScYBR028C - SH] complement(470964....    48   1e-05
YJL141C (YAK1) [2777] chr10 complement(147885..150308) Serine/th...    48   1e-05
AFR076W [3268] [Homologous to ScYJL106W (IME2) - SH] complement(...    48   1e-05
Scas_673.20*                                                           48   2e-05
YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic...    47   2e-05
Scas_655.2                                                             48   2e-05
ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH] complement...    48   2e-05
YNL183C (NPR1) [4417] chr14 complement(293137..295509) Serine/th...    48   2e-05
ACR249C [1296] [Homologous to ScYJL141C (YAK1) - SH] (797020..79...    48   2e-05
CAGL0K10604g complement(1029226..1030566) similar to sp|P27466 S...    47   2e-05
CAGL0G09020g 860266..861351 highly similar to sp|P06245 Saccharo...    47   2e-05
Scas_720.94                                                            48   2e-05
CAGL0L06820g 767038..768138 highly similar to sp|P38615 Saccharo...    47   2e-05
YOR231W (MKK1) [5022] chr15 (772601..774127) Serine/threonine pr...    47   2e-05
ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..2757...    47   3e-05
Kwal_27.11919                                                          46   3e-05
CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces c...    47   3e-05
CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces c...    47   3e-05
Kwal_26.8703                                                           47   3e-05
KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235....    47   3e-05
AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH] complement(...    47   3e-05
Sklu_1843.3 YOR231W, Contig c1843 2632-4092 reverse complement         47   4e-05
Scas_690.13                                                            46   4e-05
YNR031C (SSK2) [4613] chr14 complement(680693..685432) MAP kinas...    47   4e-05
Scas_698.37                                                            46   4e-05
KLLA0F01276g complement(120001..121560) similar to sp|P38147 Sac...    46   5e-05
Scas_651.18                                                            46   5e-05
Sklu_2392.6 YNL161W, Contig c2392 12867-15293 reverse complement       46   5e-05
Scas_651.3                                                             46   5e-05
KLLA0E01584g 149713..150960 highly similar to sp|P39009 Saccharo...    46   5e-05
Kwal_55.21709                                                          46   6e-05
KLLA0C03828g 349187..351568 similar to sp|P54199 Saccharomyces c...    46   6e-05
YMR139W (RIM11) [4096] chr13 (546124..547236) Member of the GSK3...    45   6e-05
KLLA0A05819g 541545..543659 similar to sp|P14680 Saccharomyces c...    46   6e-05
AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C (...    45   7e-05
Kwal_0.155                                                             46   7e-05
Kwal_26.8709                                                           46   7e-05
KLLA0B09790g complement(855327..856214) highly similar to sp|P00...    45   8e-05
YNL161W (CBK1) [4436] chr14 (332597..334867) Serine/threonine pr...    46   8e-05
CAGL0M02233g complement(267332..269635) highly similar to sp|P22...    46   8e-05
Sklu_2104.1 YBR160W, Contig c2104 694-1593                             45   9e-05
AFR035W [3227] [Homologous to ScYNL161W (CBK1) - SH] complement(...    45   9e-05
CAGL0G04455g 426386..428641 similar to sp|P32581 Saccharomyces c...    45   9e-05
YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase, re...    45   1e-04
KLLA0F22297g complement(2083448..2085547) some similarities with...    45   1e-04
YPL141C (YPL141C) [5305] chr16 complement(283463..286060) Serine...    45   1e-04
ADL283W [1458] [Homologous to ScYDL108W (KIN28) - SH] complement...    44   1e-04
Kwal_23.5290                                                           45   1e-04
YLR113W (HOG1) [3526] chr12 (371621..372928) MAP kinase (MAPK), ...    45   1e-04
ADR058C [1799] [Homologous to ScYBR160W (CDC28) - SH] (810941..8...    44   2e-04
Kwal_33.14554                                                          45   2e-04
AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W (...    45   2e-04
Kwal_27.9804                                                           44   2e-04
CAGL0J11308g 1097845..1100031 similar to sp|P22211 Saccharomyces...    45   2e-04
Kwal_55.21545                                                          45   2e-04
KLLA0D13266g complement(1137750..1141208) similar to sp|P32361 S...    45   2e-04
CAGL0M03729g complement(420316..422901) similar to sp|P48562 Sac...    44   2e-04
KLLA0A02497g 218592..219680 highly similar to sp|P14681 Saccharo...    44   2e-04
AGR048C [4358] [Homologous to ScYLR113W (HOG1) - SH] (807470..80...    44   2e-04
CAGL0F03245g complement(316924..320034) similar to sp|P32361 Sac...    44   3e-04
YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kin...    44   3e-04
KLLA0E21780g complement(1936438..1939488) similar to sp|P38692 S...    44   3e-04
YNL298W (CLA4) [4314] chr14 (68913..71441) Serine/threonine prot...    44   3e-04
YDL079C (MRK1) [789] chr4 complement(312951..314044,314337..3147...    44   3e-04
KLLA0F12188g 1122745..1124385 similar to sp|P38623 Saccharomyces...    44   3e-04
YDL028C (MPS1) [834] chr4 complement(400994..403288) Multi-funct...    44   3e-04
KLLA0B07205g complement(624606..625973) some similarities with s...    44   3e-04
CAGL0J06072g complement(572377..574698) similar to sp|P53894 Sac...    44   3e-04
Scas_713.38                                                            44   3e-04
Kwal_26.7276                                                           44   3e-04
CAGL0M08316g 829069..831963 weakly similar to sp|P36003 Saccharo...    44   3e-04
Scas_654.12                                                            44   3e-04
KLLA0F20053g 1867209..1868543 highly similar to sp|P32485 Saccha...    44   3e-04
Scas_683.12                                                            43   3e-04
YPL031C (PHO85) [5407] chr16 complement(492014..492914,493017..4...    43   3e-04
Scas_718.72                                                            44   3e-04
Scas_713.21                                                            44   4e-04
ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C (...    44   4e-04
Sklu_2385.2 YLR113W, Contig c2385 3805-5109 reverse complement         43   4e-04
AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH] (1044971.....    44   4e-04
KLLA0D10527g 892955..894892 similar to sp|P23293 Saccharomyces c...    44   4e-04
Kwal_56.22788                                                          43   4e-04
CAGL0K02167g complement(191468..194956) similar to sp|P38990 Sac...    44   4e-04
Kwal_33.14167                                                          44   4e-04
YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase ...    44   4e-04
AFR205C [3397] [Homologous to ScYKL139W (CTK1) - SH] (805583..80...    43   5e-04
KLLA0E14828g complement(1323743..1324675) gi|27526973|emb|CAD369...    43   5e-04
CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces c...    43   5e-04
Scas_667.18                                                            43   5e-04
Scas_721.132                                                           43   5e-04
KLLA0A06776g 612115..614517 some similarities with sp|P36003 Sac...    43   5e-04
Scas_653.25                                                            43   6e-04
ABL011C [581] [Homologous to ScYLR362W (STE11) - SH] (378259..38...    43   6e-04
CAGL0L12474g complement(1345044..1345952) highly similar to sp|P...    42   6e-04
Scas_598.6                                                             43   6e-04
KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732....    43   6e-04
Kwal_26.9032                                                           43   7e-04
YKL048C (ELM1) [3211] chr11 complement(346859..348781) Serine/th...    43   7e-04
ACR196C [1243] [Homologous to ScYDL159W (STE7) - SH] (692321..69...    43   7e-04
Sklu_1851.1 YJL106W, Contig c1851 2732-4783 reverse complement         43   7e-04
ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH] (1386601..1...    42   7e-04
KLLA0C17160g 1498959..1501454 similar to sp|P53104 Saccharomyces...    43   7e-04
YPL140C (MKK2) [5306] chr16 complement(287513..289033) MAP kinas...    42   8e-04
Scas_477.5                                                             42   8e-04
CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces c...    42   8e-04
CAGL0M11748g 1167306..1168649 highly similar to sp|P32485 Saccha...    42   8e-04
CAGL0M08360g complement(833220..835520) some similarities with s...    42   8e-04
Kwal_14.1273                                                           42   9e-04
Scas_201.1*                                                            42   9e-04
Sklu_2442.21 YLR248W, Contig c2442 39541-41052 reverse complement      42   0.001
Scas_640.16                                                            42   0.001
Sklu_2211.5 YBL105C, Contig c2211 10237-13764                          42   0.001
YDL159W (STE7) [712] chr4 (172482..174029) Serine/threonine/tyro...    42   0.001
Kwal_27.10581                                                          42   0.001
YKL171W (YKL171W) [3100] chr11 (127480..130266) Serine/threonine...    42   0.001
Scas_718.90                                                            42   0.001
CAGL0L06006g complement(670707..673535) similar to sp|P53104 Sac...    42   0.001
Scas_693.17                                                            42   0.001
KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces c...    42   0.001
CAGL0I03498g 297344..298699 similar to sp|P06784 Saccharomyces c...    42   0.001
Scas_707.34                                                            42   0.001
CAGL0D06600g 626571..628748 similar to tr|Q12399 Saccharomyces c...    42   0.001
ACR218W [1265] [Homologous to ScYFL033C (RIM15) - SH] complement...    42   0.001
Kwal_27.9763                                                           42   0.001
KLLA0D07810g complement(669095..671251) gi|401646|sp|P31034|YL44...    42   0.001
YNL020C (ARK1) [4567] chr14 complement(595621..597537) Serine/th...    42   0.001
Sklu_2361.3 YPL150W, Contig c2361 3677-6331                            42   0.001
Kwal_55.20326                                                          42   0.001
ADR293C [2034] [Homologous to ScYHR079C (IRE1) - SH] (1207023..1...    42   0.001
YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase...    42   0.002
Sklu_2417.13 YMR139W, Contig c2417 24824-25915 reverse complement      41   0.002
Kwal_14.1416                                                           41   0.002
YDR523C (SPS1) [1335] chr4 complement(1485554..1487026) Serine/t...    41   0.002
YHR082C (KSP1) [2372] chr8 complement(268460..271549) Serine/thr...    42   0.002
ABR014W [605] [Homologous to ScYHL007C (STE20) - SH] complement(...    42   0.002
AGL242C [4070] [Homologous to ScYPL031C (PHO85) - SH] (246896..2...    41   0.002
Scas_584.8                                                             41   0.002
Scas_721.46                                                            40   0.002
CAGL0D02002g 207419..209080 similar to sp|Q03957 Saccharomyces c...    41   0.002
KLLA0D07304g 623352..624749 some similarities with sp|P32491 Sac...    41   0.002
Kwal_56.23841                                                          41   0.002
AER216C [2718] [Homologous to ScYDL017W (CDC7) - SH] (1032840..1...    41   0.002
CAGL0K01815g 162144..163658 similar to sp|P06243 Saccharomyces c...    41   0.002
CAGL0B02739g complement(262590..264620) similar to sp|P23561 Sac...    41   0.002
CAGL0M09361g complement(928484..931918) highly similar to sp|P24...    41   0.002
Scas_544.6                                                             41   0.002
KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomy...    41   0.002
ACL054W [995] [Homologous to ScYGL180W (APG1) - SH] complement(2...    41   0.003
Scas_584.11                                                            41   0.003
Scas_707.36                                                            41   0.003
YHL007C (STE20) [2279] chr8 complement(95113..97932) Serine/thre...    41   0.003
KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497 Saccha...    41   0.003
YGL179C (TOS3) [1812] chr7 complement(163413..165095) Serine/thr...    40   0.003
Scas_713.7                                                             41   0.003
Scas_568.9*                                                            40   0.003
KLLA0B11946g complement(1048033..1049352) similar to sp|P41808 S...    40   0.003
YJL106W (IME2) [2809] chr10 (221307..223244) Serine/threonine pr...    40   0.003
Scas_715.34                                                            40   0.003
Kwal_23.3590                                                           40   0.003
YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine prot...    40   0.003
KLLA0F09020g 836287..839073 weakly similar to sp|P43565 Saccharo...    40   0.004
Scas_675.2                                                             40   0.004
Kwal_55.22001                                                          40   0.004
YOL128C (YGK3) [4695] chr15 complement(78351..79478) Member of t...    40   0.004
Sklu_2354.4 YNL307C, Contig c2354 4429-5520 reverse complement         40   0.004
KLLA0E07414g complement(672690..673787) highly similar to sp|P21...    40   0.005
AEL173W [2333] [Homologous to ScYJL057C (IKS1) - SH] complement(...    40   0.005
CAGL0H07535g 736241..737137 highly similar to sp|P00546 Saccharo...    39   0.005
Scas_700.34                                                            40   0.005
YBR160W (CDC28) [345] chr2 (560034..560930) Cyclin-dependent pro...    39   0.005
AFR150C [3342] [Homologous to ScYFL029C (CAK1) - SH] (707306..70...    39   0.005
Kwal_27.11542                                                          40   0.005
Kwal_14.1249                                                           39   0.006
Scas_700.35                                                            39   0.006
Kwal_47.17252                                                          40   0.006
KLLA0B13112g complement(1146006..1148198) similar to sp|P23561 S...    40   0.006
Kwal_14.1159                                                           40   0.007
ADL168C [1573] [Homologous to ScYNL307C (MCK1) - SH; ScYOL128C -...    39   0.007
YLR362W (STE11) [3744] chr12 (849865..852018) MAP kinase kinase ...    40   0.007
Scas_703.47                                                            40   0.007
Scas_640.14*                                                           39   0.007
Kwal_26.7861                                                           39   0.008
CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces...    40   0.008
YPL150W (YPL150W) [5297] chr16 (268187..270892) Serine/threonine...    39   0.008
Kwal_56.24584                                                          39   0.008
Sklu_2277.8 YOR267C, Contig c2277 9591-11441 reverse complement        39   0.008
Scas_613.13*                                                           39   0.008
Sklu_1886.2 YDL025C, Contig c1886 2790-4733                            39   0.008
YGR092W (DBF2) [2052] chr7 (668191..669909) Serine/threonine pro...    39   0.009
ADL043C [1698] [Homologous to ScYLL019C (KNS1) - SH] (612091..61...    39   0.009
Kwal_47.17345                                                          39   0.009
Scas_649.30                                                            39   0.010
CAGL0H10318g complement(1006299..1007222) highly similar to sp|P...    39   0.010
Scas_685.24                                                            39   0.010
Scas_619.5*                                                            39   0.011
Sklu_2255.4 YGR040W, Contig c2255 6834-7940 reverse complement         39   0.011
Kwal_33.13112                                                          39   0.011
ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH] (157357..160...    39   0.011
KLLA0C03938g complement(358851..360632) some similarities with s...    39   0.012
Scas_671.16                                                            39   0.012
CAGL0K11275g 1093797..1095374 similar to tr|Q03785 Saccharomyces...    39   0.013
Scas_700.28                                                            39   0.013
CAGL0E01683g complement(166584..167711) highly similar to sp|P21...    38   0.013
CAGL0J04972g 472984..474003 some similarities with tr|Q12100 Sac...    38   0.013
Scas_635.1                                                             38   0.013
CAGL0K01617g complement(142479..144803) similar to sp|P54199 Sac...    39   0.013
Kwal_55.20189                                                          39   0.013
CAGL0G05720g complement(547617..549833) similar to sp|P22211 Sac...    39   0.013
CAGL0M10153g complement(1010688..1013291) some similarities with...    39   0.013
CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces c...    39   0.014
Scas_689.22                                                            39   0.014
Kwal_14.2554                                                           38   0.015
YLL019C (KNS1) [3399] chr12 complement(105685..107898) Serine/th...    39   0.015
Sklu_2366.5 YBR274W, Contig c2366 12866-14266 reverse complement       38   0.016
ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..68...    39   0.016
AAL029W [158] [Homologous to ScYLR248W (RCK2) - SH; ScYGL158W (R...    38   0.016
KLLA0D12100g complement(1031728..1033161) some similarities with...    38   0.016
Scas_716.33                                                            38   0.016
YMR216C (SKY1) [4172] chr13 complement(698810..701038) Serine/th...    38   0.016
Scas_623.11                                                            38   0.017
YGR040W (KSS1) [2006] chr7 (575400..576506) Serine/threonine pro...    38   0.017
KLLA0D11990g join(complement(1023928..1023944), gi|2499590|sp|Q9...    38   0.017
CAGL0I06248g 600351..602792 similar to sp|P38970 Saccharomyces c...    38   0.017
KLLA0C14278g 1240990..1242615 similar to sp|P28708 Saccharomyces...    38   0.017
Scas_707.3                                                             38   0.018
Kwal_14.2497                                                           38   0.018
AEL179W [2327] [Homologous to NOHBY] complement(302948..303817) ...    37   0.018
Scas_618.15                                                            38   0.019
ADR300C [2042] [Homologous to ScYHR082C (KSP1) - SH] (1222346..1...    38   0.019
YFL033C (RIM15) [1651] chr6 complement(69113..74425) Serine/thre...    38   0.020
YDL017W (CDC7) [843] chr4 (424206..425729) Protein kinase that a...    38   0.020
CAGL0J05082g 481179..483140 similar to sp|P47042 Saccharomyces c...    38   0.020
Scas_705.23                                                            38   0.020
Kwal_33.14192                                                          38   0.021
Kwal_55.21900                                                          38   0.022
Kwal_27.11803                                                          37   0.022
Kwal_26.7552                                                           38   0.022
Scas_677.18                                                            38   0.023
Kwal_56.23717                                                          38   0.023
Kwal_17.2687                                                           37   0.023
YJL165C (HAL5) [2756] chr10 complement(106887..109454) Serine/th...    38   0.024
KLLA0E12177g 1080245..1081612 gi|4096112|gb|AAC99804.1 Kluyverom...    37   0.024
AEL120W [2386] [Homologous to ScYKL171W - SH] complement(396394....    38   0.024
AER232C [2734] [Homologous to ScYHR030C - SH; ScYKL161C (SLT2) -...    38   0.025
CAGL0J03432g 327428..329296 similar to sp|P53974 Saccharomyces c...    37   0.026
KLLA0F23507g complement(2198603..2200066) similar to sp|P24719 S...    37   0.027
YPR161C (SGV1) [5576] chr16 complement(864443..866416) Serine/th...    37   0.027
ABL055C [537] [Homologous to ScYKL116C (PRR1) - SH] (295497..297...    37   0.027
Sklu_2226.7 YIL095W, Contig c2226 8986-11373                           37   0.028
YDL025C (YDL025C) [836] chr4 complement(405341..407203) Serine/t...    37   0.029
KLLA0F17006g complement(1561859..1563106) gi|3127831|emb|CAA6115...    37   0.030
Sklu_1477.2 YKL116C, Contig c1477 684-2414 reverse complement          37   0.030
Scas_336.1                                                             37   0.031
CAGL0B04147g 402798..404498 highly similar to sp|P22204 Saccharo...    37   0.033
Sklu_2186.4 YHR030C, Contig c2186 5713-7278 reverse complement         37   0.035
Kwal_27.11777                                                          37   0.037
CAGL0L05632g 610481..612514 similar to sp|P08018 Saccharomyces c...    37   0.038
Kwal_23.6458                                                           37   0.038
YPR111W (DBF20) [5532] chr16 (747302..748996) Cell cycle protein...    37   0.039
CAGL0H01837g complement(176352..178736) tr|Q9C1R8 Candida glabra...    37   0.040
YOL113W (SKM1) [4709] chr15 (104325..106292) Serine/threonine pr...    37   0.040
Scas_633.29                                                            37   0.041
KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces...    37   0.043
Scas_668.22                                                            37   0.045
YOR267C (HRK1) [5054] chr15 complement(822585..824864) Serine/th...    37   0.046
Sklu_1995.2 YLR362W, Contig c1995 1578-3767                            37   0.046
KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces cer...    37   0.047
KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces c...    37   0.048
YFL029C (CAK1) [1654] chr6 complement(78053..79159) Cdk-activati...    37   0.048
ADR033W [1774] [Homologous to ScYGR092W (DBF2) - SH; ScYPR111W (...    37   0.049
Scas_695.33                                                            37   0.051
AER195C [2697] [Homologous to ScYCR008W (SAT4) - SH] (1005431..1...    37   0.052
Sklu_1603.2 YPR054W, Contig c1603 1858-3324 reverse complement         37   0.053
CAGL0K11550g 1118142..1119758 similar to sp|P28708 Saccharomyces...    37   0.054
ADR167W [1909] [Homologous to ScYNR047W - SH; ScYCR091W (KIN82) ...    37   0.059
YGL180W (ATG1) [1811] chr7 (160069..162762) Serine/threonine pro...    37   0.061
CAGL0F03311g complement(327599..330736) similar to sp|P38691 Sac...    37   0.061
KLLA0E11979g complement(1060048..1061892) some similarities with...    36   0.064
Sklu_2419.9 YMR001C, Contig c2419 14049-16136                          36   0.064
Scas_653.33                                                            36   0.071
YBR059C (AKL1) [250] chr2 complement(356821..360147) Serine/thre...    36   0.074
Kwal_47.17868                                                          36   0.074
AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH] (1769897..1...    36   0.074
CAGL0D01694g complement(176981..178279) similar to sp|P41808 Sac...    36   0.076
Sklu_2066.2 YJL128C, Contig c2066 5081-7000                            36   0.077
CAGL0M02519g complement(290723..292993) highly similar to tr|Q03...    36   0.077
KLLA0B11902g 1041657..1043144 gi|7385125|gb|AAF61706.1|AF226711_...    36   0.081
Kwal_26.7682                                                           36   0.082
AAL083W [104] [Homologous to ScYDR283C (GCN2) - SH] complement(1...    36   0.084
Scas_720.103                                                           36   0.085
CAGL0K02673g complement(240509..243256) similar to sp|Q03497 Sac...    36   0.085
Scas_721.61                                                            36   0.091
Kwal_23.5668                                                           36   0.092
YIL095W (PRK1) [2580] chr9 (183934..186366) Serine/threonine pro...    36   0.092
ADR174C [1916] [Homologous to ScYOR267C - SH] (1008798..1010813)...    36   0.095
YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine pro...    36   0.098
ADR317C [2058] [Homologous to ScYDL028C (MPS1) - SH] (1263082..1...    36   0.098
Sklu_2389.4 YJL057C, Contig c2389 7783-9576                            36   0.10 
Scas_610.7                                                             36   0.10 
KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1 Kluyvero...    36   0.10 
CAGL0D02244g complement(229504..230967) similar to sp|P24719 Sac...    35   0.10 
CAGL0K05709g complement(555903..559214) similar to sp|Q12263 Sac...    36   0.11 
YDL108W (KIN28) [761] chr4 (267698..267725,267807..268699) Cycli...    35   0.11 
Scas_692.24                                                            35   0.11 
CAGL0M13541g 1332296..1334164 similar to sp|Q03533 Saccharomyces...    35   0.12 
Kwal_33.14081                                                          35   0.12 
ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH] complement(...    35   0.12 
AFR019W [3211] [Homologous to ScYBL016W (FUS3) - SH] complement(...    35   0.12 
AGR334W [4645] [Homologous to ScYMR291W - SH] complement(1354612...    35   0.13 
KLLA0C16577g complement(1451181..1452695) some similarities with...    35   0.13 
ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -...    35   0.14 
Sklu_2419.10 , Contig c2419 14439-16135                                35   0.14 
Scas_651.19                                                            35   0.14 
KLLA0D09328g complement(788565..791705) some similarities with s...    35   0.15 
YIL035C (CKA1) [2632] chr9 complement(287789..288907) Casein kin...    35   0.16 
KLLA0E17127g complement(1515721..1518279) similar to sp|P38691 S...    35   0.16 
Scas_493.2                                                             35   0.16 
Sklu_2401.9 YGR092W, Contig c2401 17788-19521                          35   0.17 
KLLA0F18612g 1711131..1713575 some similarities with sp|P38080 S...    35   0.17 
YJL128C (PBS2) [2790] chr10 complement(178015..180021) MAP kinas...    35   0.17 
Kwal_0.307                                                             35   0.17 
Scas_568.13                                                            35   0.18 
YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protei...    35   0.18 
Scas_673.34*                                                           35   0.18 
Kwal_23.3992                                                           35   0.19 
KLLA0C04345g 397899..399326 similar to sp|P06243 Saccharomyces c...    35   0.19 
YKL139W (CTK1) [3128] chr11 (182963..184549) C-terminal domain (...    35   0.19 
CAGL0C02893g complement(286017..287966) similar to tr|Q08732 Sac...    35   0.22 
AEL185C [2321] [Homologous to ScYBR274W (CHK1) - SH] (291129..29...    35   0.22 
Scas_710.28                                                            34   0.22 
Kwal_23.5576                                                           34   0.23 
KLLA0E10527g 929989..931104 similar to sp|P16892 Saccharomyces c...    34   0.23 
Scas_707.7                                                             34   0.24 
CAGL0C03509g complement(350846..353533) similar to sp|P53739 Sac...    34   0.25 
Scas_683.6                                                             34   0.25 
YLR248W (RCK2) [3644] chr12 (634254..636086) Calcium/calmodulin-...    34   0.28 
CAGL0F00913g 97023..100643 similar to sp|P31374 Saccharomyces ce...    34   0.29 
Kwal_47.17263                                                          34   0.29 
YDR507C (GIN4) [1321] chr4 complement(1462346..1465774) Serine/t...    34   0.29 
ADL102C [1639] [Homologous to ScYIL035C (CKA1) - SH] (503670..50...    34   0.30 
Kwal_23.4276                                                           34   0.30 
Kwal_26.8941                                                           34   0.30 
YOL045W (PSK2) [4773] chr15 (243495..246800) Serine/threonine pr...    34   0.31 
Scas_548.6                                                             34   0.32 
Kwal_56.22476                                                          34   0.32 
YNL307C (MCK1) [4306] chr14 complement(56446..57573) Member of t...    34   0.33 
CAGL0K04169g 383738..384934 similar to sp|P14681 Saccharomyces c...    34   0.33 
Scas_629.16                                                            34   0.34 
Scas_602.11                                                            34   0.35 
Scas_689.24                                                            34   0.35 
YBL016W (FUS3) [179] chr2 (192416..193477) Serine/threonine prot...    33   0.35 
YDR283C (GCN2) [1112] chr4 complement(1025062..1030041) Serine/t...    34   0.37 
Kwal_27.10004                                                          34   0.38 
YKL198C (PTK1) [3074] chr11 complement(68274..70223) Protein con...    34   0.39 
YHR030C (SLT2) [2317] chr8 complement(168882..170336) Serine/thr...    33   0.39 
KLLA0C10802g complement(926916..931934) similar to sp|P15442 Sac...    34   0.39 
YGR188C (BUB1) [2139] chr7 complement(872047..875112) Serine/thr...    34   0.40 
YDR247W (VHS1) [1081] chr4 (956005..957390) Serine/threonine pro...    33   0.41 
CAGL0H01199g 110610..115556 highly similar to sp|P15442 Saccharo...    34   0.42 
KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062 Sacch...    34   0.42 
Kwal_26.7154                                                           34   0.43 
CAGL0G03047g 282299..283918 highly similar to sp|P22204 Saccharo...    33   0.44 

>KLLA0D11044g complement(942458..944068)
           gi|730472|sp|P40230|RAG8_KLULA Kluyveromyces lactis
           CASEIN KINASE I HOMOLOG RAG8, start by similarity
          Length = 536

 Score =  863 bits (2231), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/528 (82%), Positives = 434/528 (82%)

Query: 1   MSITAGPKVTTTAALVNTDRKMNNHHSTQVLHGSGQHGMQPSXXXXXXXXXXXXXXXQXX 60
           MSITAGPKVTTTAALVNTDRKMNNHHSTQVLHGSGQHGMQPS               Q  
Sbjct: 1   MSITAGPKVTTTAALVNTDRKMNNHHSTQVLHGSGQHGMQPSGNNVLNGLANGATGLQSS 60

Query: 61  XXXXXXXXXXXIVGLHYKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLKDE 120
                      IVGLHYKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLKDE
Sbjct: 61  ASSTSTRDDSTIVGLHYKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLKDE 120

Query: 121 YRTYKILSGSEGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAIQM 180
           YRTYKILSGSEGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAIQM
Sbjct: 121 YRTYKILSGSEGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAIQM 180

Query: 181 ITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREK 240
           ITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREK
Sbjct: 181 ITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREK 240

Query: 241 KSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKYEKIGE 300
           KSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKYEKIGE
Sbjct: 241 KSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKYEKIGE 300

Query: 301 KKRSTNVYDLSQGLPVQFGRYLEIVRNLGFEETPDYEGYRKLLLSVLDELGQKLDGEYDW 360
           KKRSTNVYDLSQGLPVQFGRYLEIVRNLGFEETPDYEGYRKLLLSVLDELGQKLDGEYDW
Sbjct: 301 KKRSTNVYDLSQGLPVQFGRYLEIVRNLGFEETPDYEGYRKLLLSVLDELGQKLDGEYDW 360

Query: 361 MKLNGGRGWDLAINKKPNLHGYGHPTPPNEKSKRHRNKFNQVPLAVNNLNGSNVPLQSHS 420
           MKLNGGRGWDLAINKKPNLHGYGHPTPPNEKSKRHRNKFNQVPLAVNNLNGSNVPLQSHS
Sbjct: 361 MKLNGGRGWDLAINKKPNLHGYGHPTPPNEKSKRHRNKFNQVPLAVNNLNGSNVPLQSHS 420

Query: 421 PLPGGTDLTQGVSNAPXXXXXXXXXXXXXXXXXXRLDPMSYEXXXXXXXXXXXXXXXXXX 480
           PLPGGTDLTQGVSNAP                  RLDPMSYE                  
Sbjct: 421 PLPGGTDLTQGVSNAPQQPQQIMSQQQYQQHTQQRLDPMSYEAYKQQVQQRYAQQPQPTQ 480

Query: 481 XXXXXXXNNDTXXXXXXXXXXXXXXXXXXXXXXXNGKVQVADSNSEKG 528
                  NNDT                       NGKVQVADSNSEKG
Sbjct: 481 QKAQKSPNNDTSQQQFSQNRQQQPQYQFQQNQPQNGKVQVADSNSEKG 528

>AFR040W [3232] [Homologous to ScYHR135C (YCK1) - SH; ScYNL154C
           (YCK2) - SH] complement(505602..507245) [1644 bp, 547
           aa]
          Length = 547

 Score =  640 bits (1652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/351 (86%), Positives = 322/351 (91%), Gaps = 1/351 (0%)

Query: 72  IVGLHYKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLKDEYRTYKILSGSE 131
           IVGLH+KIGKKIGEGSFGVLFEG NMIN VPVAIKFEPRKT+APQLKDEYRTYKIL+G+ 
Sbjct: 64  IVGLHFKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLKDEYRTYKILAGTS 123

Query: 132 GIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELHDHD 191
           G+PQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFS+KTVV VA+QMITLIE+LH HD
Sbjct: 124 GVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHD 183

Query: 192 LIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMS 251
           LIYRDIKPDNFLIGRP+QPDAN VHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMS
Sbjct: 184 LIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMS 243

Query: 252 INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKYEKIGEKKRSTNVYDLS 311
           INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKA NNK KYEKIGEKKRSTNVYDLS
Sbjct: 244 INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRSTNVYDLS 303

Query: 312 QGLPVQFGRYLEIVRNLGFEETPDYEGYRKLLLSVLDELGQKLDGEYDWMKLNGGRGWDL 371
           QGLPVQFGRYLEIVRNLGFEETPDY+GYRKLLLS L+ELG + DGEYDWMKLNGGRGWDL
Sbjct: 304 QGLPVQFGRYLEIVRNLGFEETPDYDGYRKLLLSTLEELGLEYDGEYDWMKLNGGRGWDL 363

Query: 372 AINKKPNLHGYGHPTPPNEKSKRHRNKFNQVPLAVNNLNGSNVPLQSHSPL 422
            INKKPNLHGYGHP PPNEK +RHR+K+ Q P A   ++    P    S L
Sbjct: 364 TINKKPNLHGYGHPNPPNEKGRRHRSKYPQ-PSAPQQMSSPQDPRYGSSQL 413

>Scas_654.17
          Length = 523

 Score =  637 bits (1642), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/351 (85%), Positives = 319/351 (90%), Gaps = 4/351 (1%)

Query: 72  IVGLHYKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLKDEYRTYKILSGSE 131
           IVGLHYKIGKKIGEGSFGVLFEG NMIN +PVAIKFEPRKT+APQLKDEYRTYKIL+G+ 
Sbjct: 65  IVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILTGTP 124

Query: 132 GIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELHDHD 191
           G+PQAYYFGQEGLHNILVIDLLGPSLEDLFDWC R+FS+KTVV VA+QMITLIE+LH HD
Sbjct: 125 GVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHAHD 184

Query: 192 LIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMS 251
           LIYRDIKPDNFL+GRP   DAN +HLIDFGMAK YRDPKTKQHIPYREKKSLSGTARYMS
Sbjct: 185 LIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMS 244

Query: 252 INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKYEKIGEKKRSTNVYDLS 311
           INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKA NNK KYEKIGEKKR+TNVYDL+
Sbjct: 245 INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTNVYDLA 304

Query: 312 QGLPVQFGRYLEIVRNLGFEETPDYEGYRKLLLSVLDELGQKLDGEYDWMKLNGGRGWDL 371
           QGLP+QFGRYLEIVRNL FEETPDYEGYR LLLS LD+LGQ  DGEYDWMKLNGGRGWDL
Sbjct: 305 QGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSALDDLGQSADGEYDWMKLNGGRGWDL 364

Query: 372 AINKKPNLHGYGHPTPPNEKSKRHRNKFNQVPLAVNNLNGSNVPLQSHSPL 422
           AINKKPNLHGYGHP PPNEKSKRHRNK N   +A     G+    Q++SPL
Sbjct: 365 AINKKPNLHGYGHPNPPNEKSKRHRNKLNAAGVA----GGNPQQRQTNSPL 411

>YNL154C (YCK2) [4443] chr14 complement(343636..345276) Casein
           kinase I isoform [1641 bp, 546 aa]
          Length = 546

 Score =  630 bits (1626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/330 (89%), Positives = 312/330 (94%)

Query: 72  IVGLHYKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLKDEYRTYKILSGSE 131
           IVGLHYKIGKKIGEGSFGVLFEG NMIN +PVAIKFEPRKT+APQLKDEYRTYKIL+G+ 
Sbjct: 71  IVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILAGTP 130

Query: 132 GIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELHDHD 191
           GIPQ YYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFS+KTVV VA+QMITLIE+LH HD
Sbjct: 131 GIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHD 190

Query: 192 LIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMS 251
           LIYRDIKPDNFLIGRP QPDAN VHLIDFGMAK YRDPKTKQHIPYREKKSLSGTARYMS
Sbjct: 191 LIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMS 250

Query: 252 INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKYEKIGEKKRSTNVYDLS 311
           INTHLGREQSRRDDMEA+GHVFFYFLRGQLPWQGLKA NNK KYEKIGEKKR TNVYDL+
Sbjct: 251 INTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRLTNVYDLA 310

Query: 312 QGLPVQFGRYLEIVRNLGFEETPDYEGYRKLLLSVLDELGQKLDGEYDWMKLNGGRGWDL 371
           QGLP+QFGRYLEIVRNL FEETPDYEGYR LLLSVLD+LG+  DG+YDWMKLNGGRGWDL
Sbjct: 311 QGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSVLDDLGETADGQYDWMKLNGGRGWDL 370

Query: 372 AINKKPNLHGYGHPTPPNEKSKRHRNKFNQ 401
           +INKKPNLHGYGHP PPNEKSKRHR+K +Q
Sbjct: 371 SINKKPNLHGYGHPNPPNEKSKRHRSKNHQ 400

>Kwal_33.14596
          Length = 500

 Score =  620 bits (1599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/330 (87%), Positives = 309/330 (93%)

Query: 72  IVGLHYKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLKDEYRTYKILSGSE 131
           IVGLHY+IGKKIGEGSFGVLFEG NMIN VPVAIKFEPRK++APQLKDEYRTYKIL+G+ 
Sbjct: 27  IVGLHYRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKILAGTA 86

Query: 132 GIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELHDHD 191
           GIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFS+KTVV VA+QMITLIE+LH HD
Sbjct: 87  GIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHTHD 146

Query: 192 LIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMS 251
           LIYRDIKPDNFLIGRP  PD N VHLIDFGMAK YRDPKTKQHIPYREKKSLSGTARYMS
Sbjct: 147 LIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMS 206

Query: 252 INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKYEKIGEKKRSTNVYDLS 311
           INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKA NNK KYEKIGEKKR TNVYDL+
Sbjct: 207 INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRVTNVYDLA 266

Query: 312 QGLPVQFGRYLEIVRNLGFEETPDYEGYRKLLLSVLDELGQKLDGEYDWMKLNGGRGWDL 371
           QGLPVQFGRYLE+VR+L FEETPDYEGYRKL LS+LD++  + DGEYDWMKLNGGRGWDL
Sbjct: 267 QGLPVQFGRYLEVVRSLAFEETPDYEGYRKLFLSILDDMDNQADGEYDWMKLNGGRGWDL 326

Query: 372 AINKKPNLHGYGHPTPPNEKSKRHRNKFNQ 401
            INKKPNLHGYGHP PPN+K++RHR+K+ Q
Sbjct: 327 NINKKPNLHGYGHPNPPNDKNRRHRSKYAQ 356

>YHR135C (YCK1) [2422] chr8 complement(372695..374311) Casein kinase
           I isoform [1617 bp, 538 aa]
          Length = 538

 Score =  619 bits (1597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/327 (88%), Positives = 307/327 (93%)

Query: 72  IVGLHYKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLKDEYRTYKILSGSE 131
           IVGLHYKIGKKIGEGSFGVLFEG NMIN VPVAIKFEPRKT+APQL+DEY+TYKIL+G+ 
Sbjct: 64  IVGLHYKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKILNGTP 123

Query: 132 GIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELHDHD 191
            IP AYYFGQEGLHNILVIDLLGPSLEDLFDWCGR+FS+KTVV VA+QMITLIE+LH HD
Sbjct: 124 NIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHD 183

Query: 192 LIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMS 251
           LIYRDIKPDNFLIGRP QPDAN +HLIDFGMAK YRDPKTKQHIPYREKKSLSGTARYMS
Sbjct: 184 LIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMS 243

Query: 252 INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKYEKIGEKKRSTNVYDLS 311
           INTHLGREQSRRDDMEALGHVFFYFLRG LPWQGLKA NNK KYEKIGEKKRSTNVYDL+
Sbjct: 244 INTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKIGEKKRSTNVYDLA 303

Query: 312 QGLPVQFGRYLEIVRNLGFEETPDYEGYRKLLLSVLDELGQKLDGEYDWMKLNGGRGWDL 371
           QGLPVQFGRYLEIVR+L FEE PDYEGYRKLLLSVLD+LG+  DG+YDWMKLN GRGWDL
Sbjct: 304 QGLPVQFGRYLEIVRSLSFEECPDYEGYRKLLLSVLDDLGETADGQYDWMKLNDGRGWDL 363

Query: 372 AINKKPNLHGYGHPTPPNEKSKRHRNK 398
            INKKPNLHGYGHP PPNEKS++HRNK
Sbjct: 364 NINKKPNLHGYGHPNPPNEKSRKHRNK 390

>CAGL0G06138g complement(585585..587204) similar to sp|P23291
           Saccharomyces cerevisiae YHR135c YCK1, start by
           similarity
          Length = 539

 Score =  612 bits (1579), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/348 (82%), Positives = 309/348 (88%), Gaps = 1/348 (0%)

Query: 72  IVGLHYKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLKDEYRTYKILSGSE 131
           IVGLHYKIGKKIGEGSFGVLFEG NMIN +PVAIKFEPRKT+APQLKDEYRTYKI++G+ 
Sbjct: 56  IVGLHYKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKDEYRTYKIMAGTP 115

Query: 132 GIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELHDHD 191
            +PQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGR+FS+KTVV VA+QMITLIE+LH HD
Sbjct: 116 NVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHD 175

Query: 192 LIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMS 251
           LIYRDIKPDNFLIGRP QPD N +HLIDFGMAK YRDPKTKQHIPYRE+KSLSGTARYMS
Sbjct: 176 LIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLSGTARYMS 235

Query: 252 INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKYEKIGEKKRSTNVYDLS 311
           INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKA NNK KYEKIGEKKR+TNVYDLS
Sbjct: 236 INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTNVYDLS 295

Query: 312 QGLPVQFGRYLEIVRNLGFEETPDYEGYRKLLLSVLDELGQKLDGEYDWMKLNGGRGWDL 371
            G PVQFGRYLEIVR+L FEETPDY+GYRKLLLSVLD++    DG YDWMKLNGGRGWDL
Sbjct: 296 NGYPVQFGRYLEIVRSLSFEETPDYQGYRKLLLSVLDDMNDSADGTYDWMKLNGGRGWDL 355

Query: 372 AINKKPNLHGYGHPTPPNEKSKRHRNKFNQVPLAVNNLNGSNVPLQSH 419
            INKKPNLHGYGHP PPN+K +RH+NK       +        P Q+H
Sbjct: 356 TINKKPNLHGYGHPNPPNDK-RRHKNKMTNPLQQLAGQQQGQYPDQTH 402

>Scas_697.12
          Length = 529

 Score =  601 bits (1550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/325 (88%), Positives = 304/325 (93%)

Query: 72  IVGLHYKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLKDEYRTYKILSGSE 131
           IVGLHY+IGKKIGEGSFGVLFEG+NMIN  PVAIKFEPRKT+APQLKDEYRTYKIL+G+ 
Sbjct: 43  IVGLHYRIGKKIGEGSFGVLFEGINMINGTPVAIKFEPRKTEAPQLKDEYRTYKILAGTP 102

Query: 132 GIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELHDHD 191
            IP AYYFGQEGLHNILVIDLLGPSLEDLFDWC RRFS+KTVV VA+QMITLIE+LH +D
Sbjct: 103 NIPLAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRRFSVKTVVQVAVQMITLIEDLHAND 162

Query: 192 LIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMS 251
           LIYRDIKPDNFLIGRP QPD N +HLIDFGMAK YRDPKTKQHIPYREKKSLSGTARYMS
Sbjct: 163 LIYRDIKPDNFLIGRPGQPDENFIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMS 222

Query: 252 INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKYEKIGEKKRSTNVYDLS 311
           INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKA NNK KYE+IGEKKR+TNVYDL+
Sbjct: 223 INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYERIGEKKRTTNVYDLA 282

Query: 312 QGLPVQFGRYLEIVRNLGFEETPDYEGYRKLLLSVLDELGQKLDGEYDWMKLNGGRGWDL 371
           QGLPVQF RYLE+VRNL FEETPDY GYR+LLLS LD+LGQ  DGEYDWMKLNGG+GWDL
Sbjct: 283 QGLPVQFARYLEVVRNLSFEETPDYRGYRELLLSSLDDLGQSADGEYDWMKLNGGKGWDL 342

Query: 372 AINKKPNLHGYGHPTPPNEKSKRHR 396
            INKKPNLHGYGHPTPPNEKS+RHR
Sbjct: 343 NINKKPNLHGYGHPTPPNEKSRRHR 367

>CAGL0J05940g 560563..562023 similar to sp|P23291 Saccharomyces
           cerevisiae YHR135c YCK1 or sp|P23292 Saccharomyces
           cerevisiae YNL154c YCK2, hypothetical start
          Length = 486

 Score =  599 bits (1544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/326 (84%), Positives = 303/326 (92%)

Query: 72  IVGLHYKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLKDEYRTYKILSGSE 131
           I GLHY+IGKKIGEGSFGVLFEG N+IN +PVA+KFEPRKT+APQLKDEYRTYKIL+G+ 
Sbjct: 36  IAGLHYQIGKKIGEGSFGVLFEGTNIINGMPVAVKFEPRKTEAPQLKDEYRTYKILAGTP 95

Query: 132 GIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELHDHD 191
           G+PQAYYFGQEGLHNILV+DLLGPSLEDLFDWCGR+FS KTVV VA+QMITLIE+LH HD
Sbjct: 96  GVPQAYYFGQEGLHNILVMDLLGPSLEDLFDWCGRQFSPKTVVQVAVQMITLIEDLHAHD 155

Query: 192 LIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMS 251
           LIYRDIKPDNFL+GRP QPD N +HLIDFGMAK YRDPKTKQHIPYREKKSLSGTARYMS
Sbjct: 156 LIYRDIKPDNFLVGRPGQPDENNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMS 215

Query: 252 INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKYEKIGEKKRSTNVYDLS 311
           INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKA NNK KYE+IGEKKR+T+VYDL+
Sbjct: 216 INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYERIGEKKRTTDVYDLA 275

Query: 312 QGLPVQFGRYLEIVRNLGFEETPDYEGYRKLLLSVLDELGQKLDGEYDWMKLNGGRGWDL 371
            G PVQF RYLEIVRNLGF+ETPDYEGYRKLL S LD++G+ +DG+YDWM+LNGGRGWDL
Sbjct: 276 NGYPVQFARYLEIVRNLGFDETPDYEGYRKLLASALDDIGETMDGKYDWMELNGGRGWDL 335

Query: 372 AINKKPNLHGYGHPTPPNEKSKRHRN 397
            INKKPNLHGYGHP PP +KS R+RN
Sbjct: 336 TINKKPNLHGYGHPNPPGDKSHRNRN 361

>Scas_627.4
          Length = 475

 Score =  460 bits (1183), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 217/337 (64%), Positives = 262/337 (77%), Gaps = 18/337 (5%)

Query: 72  IVGLHYKIGKKIGEGSFGVLFEGVNMI---NNVPVAIKFEPRKTDAPQLKDEYRTYKILS 128
           IVG+HY +G KIGEGSFGV+FEG N++   +N PVAIKFEPR +DAPQL+DE+R+YKIL+
Sbjct: 10  IVGIHYAVGPKIGEGSFGVIFEGENLLKDASNEPVAIKFEPRHSDAPQLRDEFRSYKILN 69

Query: 129 GSEGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELH 188
              GIP  YYFGQEG+HNIL+IDLLGPSLEDLF+WCGRRFSIKT   +A QMI  I+++H
Sbjct: 70  NCTGIPHVYYFGQEGMHNILIIDLLGPSLEDLFEWCGRRFSIKTTCMIAKQMIRRIKDIH 129

Query: 189 DHDLIYRDIKPDNFLIGRPNQ-------------PDANMVHLIDFGMAKLYRDPKTKQHI 235
           +HDLIYRDIKPDNFLI +  +              D N+++L+DFGMAK +RDP++KQHI
Sbjct: 130 NHDLIYRDIKPDNFLISQYQRIGSNEKCINSNAHADPNLIYLVDFGMAKQFRDPRSKQHI 189

Query: 236 PYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKY 295
           PYRE+KSLSGTARYMSINTH GREQSRRDD+E+LGHVFFYFLRG LPWQGLKAANNKLKY
Sbjct: 190 PYRERKSLSGTARYMSINTHFGREQSRRDDLESLGHVFFYFLRGSLPWQGLKAANNKLKY 249

Query: 296 EKIGEKKRSTNVYDL--SQGLPVQFGRYLEIVRNLGFEETPDYEGYRKLLLSVLDELGQK 353
           EKIG  K+  N  DL  +  +P QF  YL+  R+L FE+ PDY+    L+   L+EL   
Sbjct: 250 EKIGLTKQKLNPDDLLMNNHIPKQFATYLKYARSLKFEQDPDYDYLVSLMDDTLNELNLV 309

Query: 354 LDGEYDWMKLNGGRGWDLAINKKPNLHGYGHPTPPNE 390
            DG YDWM LN G+GWD+ INK+ NLHGYG+P P N+
Sbjct: 310 DDGHYDWMDLNDGKGWDIKINKRTNLHGYGNPNPRNQ 346

>Kwal_47.17314
          Length = 421

 Score =  452 bits (1164), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 223/384 (58%), Positives = 278/384 (72%), Gaps = 34/384 (8%)

Query: 72  IVGLHYKIGKKIGEGSFGVLFEGVNMINNV--PVAIKFEPRKTDAPQLKDEYRTYKILSG 129
           IVG+HY +G KIGEGSFGV+FEG N++NN   PVAIKFEPR+T+APQL+DE+R YKIL+G
Sbjct: 8   IVGIHYAVGPKIGEGSFGVIFEGENVLNNSSSPVAIKFEPRRTEAPQLRDEFRAYKILNG 67

Query: 130 SEGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELHD 189
            EGIP+A+YFGQEG+HN+L+IDLLGPSLEDLF+WCGRRFS+KT   +A QMI  ++ +H 
Sbjct: 68  LEGIPKAFYFGQEGMHNVLIIDLLGPSLEDLFEWCGRRFSVKTTCLLAKQMIRRVQSIHQ 127

Query: 190 HDLIYRDIKPDNFLIGR-----PN-----------QPDANMVHLIDFGMAKLYRDPKTKQ 233
            DLIYRDIKPDNFLI       PN             + N+V+++DFGMAK YRDPKTKQ
Sbjct: 128 RDLIYRDIKPDNFLIAEYQRELPNGQLVKNCATSAHGNPNLVYVVDFGMAKQYRDPKTKQ 187

Query: 234 HIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKL 293
           HIPY+E+KSLSGTARYMSINTH GREQSRRDD+E+LGHVFFYFLRG LPWQGLK AN KL
Sbjct: 188 HIPYKERKSLSGTARYMSINTHFGREQSRRDDLESLGHVFFYFLRGFLPWQGLKVANTKL 247

Query: 294 KYEKIGEKKRSTNVYD-LSQGLPVQFGRYLEIVRNLGFEETPDYEGYRKLLLSVLDELGQ 352
           KYEKIG  K+     D L + +P QF  YL   R+L FEE PDY+    L+   L E G 
Sbjct: 248 KYEKIGLTKQKVRPEDLLERNIPTQFATYLTYCRSLRFEEEPDYDFLVSLMTQALQERGY 307

Query: 353 KLDGEYDWMKLNGGRGWDLAINKKPNLHGYGHPTPPNEKSKR------HRNKFNQVPL-- 404
           + D  YDW+ LN G+GW++ +N++ NLHGYG+PTP   ++ R      HR+ +++     
Sbjct: 308 EEDDHYDWLDLNQGQGWNIFVNRRANLHGYGNPTPKTSQAARKSAPRAHRDSYSKAQRLR 367

Query: 405 ------AVNNLNGSNVPLQSHSPL 422
                 AVN   G NV +QS++ +
Sbjct: 368 TQMTNQAVNRDKGGNV-IQSYNSM 390

>YER123W (YCK3) [1553] chr5 (404809..406383) Casein kinase I
           isoform, plasma membrane-bound [1575 bp, 524 aa]
          Length = 524

 Score =  450 bits (1157), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 214/351 (60%), Positives = 257/351 (73%), Gaps = 35/351 (9%)

Query: 72  IVGLHYKIGKKIGEGSFGVLFEGVNMIN-----------------NVPVAIKFEPRKTDA 114
           IVG+HY +G KIGEGSFGV+FEG N+++                 N PVAIKFEPR +DA
Sbjct: 9   IVGIHYAVGPKIGEGSFGVIFEGENILHSCQAQTGSKRDSSIIMANEPVAIKFEPRHSDA 68

Query: 115 PQLKDEYRTYKILSGSEGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVV 174
           PQL+DE+R Y+IL+G  GIP AYYFGQEG+HNIL+IDLLGPSLEDLF+WCGR+FS+KT  
Sbjct: 69  PQLRDEFRAYRILNGCVGIPHAYYFGQEGMHNILIIDLLGPSLEDLFEWCGRKFSVKTTC 128

Query: 175 HVAIQMITLIEELHDHDLIYRDIKPDNFLIGR----------------PNQPDANMVHLI 218
            VA QMI  +  +HDHDLIYRDIKPDNFLI +                 +  D N+++++
Sbjct: 129 MVAKQMIDRVRAIHDHDLIYRDIKPDNFLISQYQRISPEGKVIKSCASSSNNDPNLIYMV 188

Query: 219 DFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLR 278
           DFGMAK YRDP+TKQHIPYRE+KSLSGTARYMSINTH GREQSRRDD+E+LGHVFFYFLR
Sbjct: 189 DFGMAKQYRDPRTKQHIPYRERKSLSGTARYMSINTHFGREQSRRDDLESLGHVFFYFLR 248

Query: 279 GQLPWQGLKAANNKLKYEKIGEKKRSTNVYD--LSQGLPVQFGRYLEIVRNLGFEETPDY 336
           G LPWQGLKA NNKLKYEKIG  K+  N  D  L+  +P QF  YL+  R+L F+E PDY
Sbjct: 249 GSLPWQGLKAPNNKLKYEKIGMTKQKLNPDDLLLNNAIPYQFATYLKYARSLKFDEDPDY 308

Query: 337 EGYRKLLLSVLDELGQKLDGEYDWMKLNGGRGWDLAINKKPNLHGYGHPTP 387
           +    L+   L     K DG YDWM LNGG+GW++ IN++ NLHGYG+P P
Sbjct: 309 DYLISLMDDALRLNDLKDDGHYDWMDLNGGKGWNIKINRRANLHGYGNPNP 359

>ADL053C [1688] [Homologous to ScYER123W (YCK3) - SH]
           (589602..591017) [1416 bp, 471 aa]
          Length = 471

 Score =  441 bits (1135), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 210/340 (61%), Positives = 257/340 (75%), Gaps = 22/340 (6%)

Query: 72  IVGLHYKIGKKIGEGSFGVLFEGVNMIN-----NVPVAIKFEPRKTDAPQLKDEYRTYKI 126
           +VG+HY +G KIGEGSFG++FEG NM+        PVAIKFEPR++DAPQL+DE+R Y+I
Sbjct: 9   VVGIHYAVGPKIGEGSFGIIFEGENMMEGGDAGRRPVAIKFEPRRSDAPQLRDEFRAYRI 68

Query: 127 LSGSEGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEE 186
           L+G  GIP+AYYFGQEG+HNIL+IDLLGPSLEDLF+WCGRRFS+KT   +A QMI  +  
Sbjct: 69  LNGVRGIPRAYYFGQEGVHNILIIDLLGPSLEDLFEWCGRRFSVKTTCMLAKQMIERVRA 128

Query: 187 LHDHDLIYRDIKPDNFLIGRPNQP----------------DANMVHLIDFGMAKLYRDPK 230
           +H  DLIYRDIKPDNFLI    +                 DAN+++++DFGMAK YRDPK
Sbjct: 129 IHGRDLIYRDIKPDNFLISEFQREVAAGEVVRGCAATAGGDANLIYVVDFGMAKQYRDPK 188

Query: 231 TKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAAN 290
           TKQHIPYRE+KSLSGTARYMSINTH GREQSRRDD+E+LGHVFFYFLRG LPWQGLKA N
Sbjct: 189 TKQHIPYRERKSLSGTARYMSINTHFGREQSRRDDLESLGHVFFYFLRGSLPWQGLKAPN 248

Query: 291 NKLKYEKIGEKKRSTNVYDL-SQGLPVQFGRYLEIVRNLGFEETPDYEGYRKLLLSVLDE 349
           NK KYEKIG  K+     +L S+ +PVQF  YL+  R+L F+E PDY+    L+ SV+ +
Sbjct: 249 NKAKYEKIGLTKQKLKPEELISENIPVQFAEYLKYCRSLRFDEEPDYDYLISLMDSVMHD 308

Query: 350 LGQKLDGEYDWMKLNGGRGWDLAINKKPNLHGYGHPTPPN 389
           L  + +  YDWM LN   GW++A+NK+ NLHGYG+P P N
Sbjct: 309 LNIEDNQHYDWMDLNNHTGWNIAVNKRANLHGYGNPHPRN 348

>Sklu_2359.3 YER123W, Contig c2359 7455-8921 reverse complement
          Length = 488

 Score =  441 bits (1135), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 214/359 (59%), Positives = 261/359 (72%), Gaps = 37/359 (10%)

Query: 72  IVGLHYKIGKKIGEGSFGVLFEGVNMINNV--------------------PVAIKFEPRK 111
           +VG+HY +G KIGEGSFGV+FEG N++N+                     PVAIKFEPR+
Sbjct: 9   VVGIHYAVGPKIGEGSFGVIFEGENILNSNNNNSSNNSSSASTGTANPVDPVAIKFEPRR 68

Query: 112 TDAPQLKDEYRTYKILSGSEGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSIK 171
           +DAPQL+DE+R Y+IL+G  GIP AYYFGQEG+HN+L+IDLLGPSLEDLF+WCG RFS+K
Sbjct: 69  SDAPQLRDEFRAYRILNGITGIPHAYYFGQEGMHNVLIIDLLGPSLEDLFEWCGHRFSVK 128

Query: 172 TVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGR----------------PNQPDANMV 215
           T   VA QMI  +  +H  DLIYRDIKPDNFLI                   +  D N++
Sbjct: 129 TTCMVAKQMIDRVRSIHQRDLIYRDIKPDNFLISEYQRELPTGQILRSCSSSSNGDPNLI 188

Query: 216 HLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFY 275
           +++DFGMAK YRDPKTKQHIPYRE+KSLSGTARYMSINTH GREQSRRDD+E+LGHVFFY
Sbjct: 189 YVVDFGMAKQYRDPKTKQHIPYRERKSLSGTARYMSINTHFGREQSRRDDLESLGHVFFY 248

Query: 276 FLRGQLPWQGLKAANNKLKYEKIG-EKKRSTNVYDLSQGLPVQFGRYLEIVRNLGFEETP 334
           FLRG LPWQGLKA NNKLKYEKIG  K+R +    LS G+P QF  YL+  RNL F+E P
Sbjct: 249 FLRGSLPWQGLKAPNNKLKYEKIGTTKQRLSPEKLLSDGIPEQFATYLKYCRNLKFDEDP 308

Query: 335 DYEGYRKLLLSVLDELGQKLDGEYDWMKLNGGRGWDLAINKKPNLHGYGHPTPPNEKSK 393
           DY+    L+   L+  G   DG YDWM LN G+GW++ +N++ NLHGYG+PTP ++K+K
Sbjct: 309 DYDYLISLMDEALNTSGSVEDGHYDWMDLNQGQGWNIRVNRRANLHGYGNPTPRDQKAK 367

>KLLA0E13563g 1193481..1194902 some similarities with sp|P39962
           Saccharomyces cerevisiae YER123w YCK3 casein kinase,
           isoform 3, hypothetical start
          Length = 473

 Score =  441 bits (1134), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 206/340 (60%), Positives = 256/340 (75%), Gaps = 20/340 (5%)

Query: 72  IVGLHYKIGKKIGEGSFGVLFEGVNMIN---NVPVAIKFEPRKTDAPQLKDEYRTYKILS 128
           +VG+HY +G KIGEGSFG++FEG N++N     PVAIKFEPR++D+PQL+DE+R Y+IL+
Sbjct: 9   VVGIHYAVGPKIGEGSFGIIFEGENILNGGSKNPVAIKFEPRRSDSPQLRDEFRAYRILN 68

Query: 129 GSEGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELH 188
              GIP AYYF QEG+HNIL+IDLLGPSLEDLF+WC R+FS+KT   +A QMI  +  +H
Sbjct: 69  DVRGIPHAYYFSQEGIHNILIIDLLGPSLEDLFEWCSRKFSVKTTAMLAKQMIDRVRSIH 128

Query: 189 DHDLIYRDIKPDNFLIGRPNQP----------------DANMVHLIDFGMAKLYRDPKTK 232
           +HDLIYRDIKPDNFLI    +                 DAN+++++DFGMAK +RDP TK
Sbjct: 129 EHDLIYRDIKPDNFLISEFQRELSDGSVVKSCATSSGGDANLIYVVDFGMAKQFRDPNTK 188

Query: 233 QHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNK 292
           QHIPYRE+KSLSGTARYMSINTH GREQSRRDD+E+LGHVFFYFLRG LPWQGLKA NNK
Sbjct: 189 QHIPYRERKSLSGTARYMSINTHFGREQSRRDDLESLGHVFFYFLRGSLPWQGLKALNNK 248

Query: 293 LKYEKIGEKKRSTNVYD-LSQGLPVQFGRYLEIVRNLGFEETPDYEGYRKLLLSVLDELG 351
            KYEKIG  K+     D L+  +P QF  YL   R+L F++ PDY+    L+  ++ E G
Sbjct: 249 AKYEKIGLTKQRLKPTDLLTPEIPKQFAEYLSYCRSLRFDQDPDYDYLISLMTQIMQENG 308

Query: 352 QKLDGEYDWMKLNGGRGWDLAINKKPNLHGYGHPTPPNEK 391
            + DG YDWM LNGG+GW++ +NK+ NLHGYG+PTP N K
Sbjct: 309 YEEDGHYDWMDLNGGQGWNIKVNKRVNLHGYGNPTPRNTK 348

>CAGL0K02299g complement(205332..206948) similar to sp|P39962
           Saccharomyces cerevisiae YER123w Casein kinase I,
           hypothetical start
          Length = 538

 Score =  442 bits (1138), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 214/362 (59%), Positives = 257/362 (70%), Gaps = 46/362 (12%)

Query: 72  IVGLHYKIGKKIGEGSFGVLFEGVNMINN---------------------------VPVA 104
           +VG+HY +G KIGEGSFGV+FEG N++N+                            PVA
Sbjct: 17  VVGMHYAVGPKIGEGSFGVIFEGQNILNSSDGRQGHGSGSGSAHGSGNGNGNSLAGFPVA 76

Query: 105 IKFEPRKTDAPQLKDEYRTYKILSGSEGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWC 164
           IKFEPR +DAPQL+DE+R Y+IL+GS+GIP AYYFGQEG+HN+L+IDLLGPSLEDLF+WC
Sbjct: 77  IKFEPRHSDAPQLRDEFRAYRILNGSKGIPHAYYFGQEGMHNVLIIDLLGPSLEDLFEWC 136

Query: 165 GRRFSIKTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQP-------------- 210
           GR+FSIKT   +A QMI  +  +HDHDLIYRDIKPDNFLI    +               
Sbjct: 137 GRKFSIKTTCMLAKQMIERVRIIHDHDLIYRDIKPDNFLISEFQKASNNNGECVKYCAQS 196

Query: 211 ---DANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDME 267
              D N+++++DFGMAK YRDP+TKQHIPYRE+KSLSGTARYMSINTH GREQSRRDD+E
Sbjct: 197 AGGDPNLIYMVDFGMAKQYRDPRTKQHIPYRERKSLSGTARYMSINTHFGREQSRRDDLE 256

Query: 268 ALGHVFFYFLRGQLPWQGLKAANNKLKYEKIGEKKRSTNVYD--LSQGLPVQFGRYLEIV 325
           +LGHVFFYFLRG LPWQGLKA NNKLKYEKIG  K+  N  +  LS  +P QF  YL+  
Sbjct: 257 SLGHVFFYFLRGSLPWQGLKAPNNKLKYEKIGLTKQKLNPDELLLSNQIPSQFATYLKYT 316

Query: 326 RNLGFEETPDYEGYRKLLLSVLDELGQKLDGEYDWMKLNGGRGWDLAINKKPNLHGYGHP 385
           R+L F+E PDY+    L+  VL   G K DG YDWM LN G GWD+ +NK+ NLHGYG+ 
Sbjct: 317 RSLKFDEDPDYDYLISLMDGVLLSKGYKDDGHYDWMDLNNGAGWDIRVNKRANLHGYGNA 376

Query: 386 TP 387
            P
Sbjct: 377 QP 378

>KLLA0D03168g 265761..267278 some similarities with sp|P29295
           Saccharomyces cerevisiae YPL204w HRR25 casein kinase I,
           ser/thr/tyr protein kinase, hypothetical start
          Length = 505

 Score =  315 bits (808), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 154/291 (52%), Positives = 202/291 (69%), Gaps = 2/291 (0%)

Query: 73  VGLHYKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLKDEYRTYKILSGSEG 132
           VG  ++IG+KIG GSFG ++ G N+I+   VAIK EP +T  PQL  E R YK LSG  G
Sbjct: 5   VGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLEPIRTKHPQLDYESRVYKYLSGGIG 64

Query: 133 IPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELHDHDL 192
           IP   +FG+EG +N +VIDLLGPSLEDLF++C R+FS KTV+ +A+QMI  I+ +H    
Sbjct: 65  IPFIRWFGKEGEYNAMVIDLLGPSLEDLFNYCHRKFSFKTVIMLALQMICRIQYIHGRSF 124

Query: 193 IYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSI 252
           I+RDIKPDNFL+G   +   + VH+IDFG++K YRD ++  HIPYRE K+L+GTARY S+
Sbjct: 125 IHRDIKPDNFLMGVGRR--GSTVHVIDFGLSKKYRDFRSHNHIPYRENKNLTGTARYASV 182

Query: 253 NTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKYEKIGEKKRSTNVYDLSQ 312
           NTHLG EQSRRDD+E+LG+V  YF +G LPWQGL+A   + KY++I EKK    V  L Q
Sbjct: 183 NTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLRATTKRQKYDRIMEKKLCITVEQLCQ 242

Query: 313 GLPVQFGRYLEIVRNLGFEETPDYEGYRKLLLSVLDELGQKLDGEYDWMKL 363
           GLP++F  Y+   RNL F+E PDY    +L   +  +L    D  +DW  L
Sbjct: 243 GLPMEFVEYMRYCRNLRFDERPDYMYLARLFKDLFIKLEYHNDHLFDWTML 293

>AFL091W [3102] [Homologous to ScYPL204W (HRR25) - SH]
           complement(272431..273867) [1437 bp, 478 aa]
          Length = 478

 Score =  313 bits (801), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 153/291 (52%), Positives = 203/291 (69%), Gaps = 2/291 (0%)

Query: 73  VGLHYKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLKDEYRTYKILSGSEG 132
           VG  ++IG+KIG GSFG ++ G N+I+   VAIK EP +T  PQL  E R YK LSG  G
Sbjct: 5   VGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLEPIRTKHPQLDYESRVYKYLSGGIG 64

Query: 133 IPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELHDHDL 192
           IP   +FG+EG +N +VIDLLGPSLEDLF++C R+FS+KTV+ +A+QMI  I+ +H    
Sbjct: 65  IPFIRWFGREGDYNAMVIDLLGPSLEDLFNYCHRKFSLKTVMMLALQMICRIQYIHGRSF 124

Query: 193 IYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSI 252
           I+RDIKPDNFL+G   +   + VH+IDFG++K +RD +T  HIPYRE K+L+GTARY S+
Sbjct: 125 IHRDIKPDNFLMGVGRR--GSTVHVIDFGLSKKFRDFRTHNHIPYRENKNLTGTARYASV 182

Query: 253 NTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKYEKIGEKKRSTNVYDLSQ 312
           NTHLG EQSRRDD+E+LG+V  YF +G LPWQGL+A   + KY++I EKK   +V  L  
Sbjct: 183 NTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLRATTKRQKYDRIMEKKLCISVEQLCV 242

Query: 313 GLPVQFGRYLEIVRNLGFEETPDYEGYRKLLLSVLDELGQKLDGEYDWMKL 363
           GLP++F  Y+   RNL F+E PDY    +L   +  +L    D  +DW  L
Sbjct: 243 GLPIEFVEYMRYCRNLRFDERPDYMYVARLFKDLSIKLEYHNDHLFDWTML 293

>Kwal_56.24064
          Length = 475

 Score =  312 bits (800), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 158/295 (53%), Positives = 202/295 (68%), Gaps = 10/295 (3%)

Query: 73  VGLHYKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLKDEYRTYKILSGSEG 132
           VG  Y+IG+KIG GSFG ++ G N+I+   VAIK E  ++  PQL  E R YK LSG  G
Sbjct: 5   VGRKYRIGRKIGSGSFGDIYHGTNLISGEEVAIKLESIRSRHPQLDYESRVYKYLSGGIG 64

Query: 133 IPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELHDHDL 192
           IP   +FG+EG +N +VIDLLGPSLEDLF++C R+FS KTV+ +A+QMI  I+ +H    
Sbjct: 65  IPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRKFSFKTVIMLALQMICRIQYIHGRSF 124

Query: 193 IYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSI 252
           I+RDIKPDNFL+G   +   + VH+IDFG++K YRD  T  HIPYRE K+L+GTARY S+
Sbjct: 125 IHRDIKPDNFLMGVGRR--GSTVHVIDFGLSKKYRDFSTHHHIPYRENKNLTGTARYASV 182

Query: 253 NTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKYEKIGEKKRSTNVYDLSQ 312
           NTHLG EQSRRDD+E+LG+V  YF +G LPWQGLKA   + KY++I EKK   NV  L  
Sbjct: 183 NTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLKATTKRQKYDRIMEKKLCINVEQLCA 242

Query: 313 GLPVQFGRYLEIVRNLGFEETPDYEGYRKLLLSVLDELGQKLDGE----YDWMKL 363
           GLP++F  Y+   RNL F+E PDY      L  +  +LG KLD      +DW  L
Sbjct: 243 GLPMEFVEYMRYCRNLRFDERPDY----LYLARLFKDLGIKLDYHNDHLFDWTML 293

>Scas_720.24
          Length = 473

 Score =  311 bits (797), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 152/291 (52%), Positives = 201/291 (69%), Gaps = 2/291 (0%)

Query: 73  VGLHYKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLKDEYRTYKILSGSEG 132
           VG  ++IG+KIG GSFG ++ G N+I+   VAIK E  ++  PQL  E R YK LSG  G
Sbjct: 5   VGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLESIRSRHPQLDYESRVYKYLSGGVG 64

Query: 133 IPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELHDHDL 192
           IP   +FG+EG +N +VIDLLGPSLEDLF++C R+F+ KTV+ +A+QMI  ++ +H    
Sbjct: 65  IPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRKFTFKTVIMLALQMICRVQYIHGRSF 124

Query: 193 IYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSI 252
           I+RDIKPDNFL+G   +   + VH+IDFG++K YRD  T +HIPYRE KSL+GTARY S+
Sbjct: 125 IHRDIKPDNFLMGTGRR--GSTVHVIDFGLSKKYRDFNTHRHIPYRENKSLTGTARYASV 182

Query: 253 NTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKYEKIGEKKRSTNVYDLSQ 312
           NTHLG EQSRRDD+E+LG++  YF +G LPWQGLKA   K KY++I EKK   +V  L  
Sbjct: 183 NTHLGIEQSRRDDLESLGYMLVYFCKGSLPWQGLKATTKKQKYDRILEKKLCISVETLCA 242

Query: 313 GLPVQFGRYLEIVRNLGFEETPDYEGYRKLLLSVLDELGQKLDGEYDWMKL 363
           GLP++F  Y+   RNL F+E PDY    +L   +  +L    D  +DW  L
Sbjct: 243 GLPIEFADYMNYCRNLKFDERPDYLYLARLFKDLSIKLEYHNDHLFDWTML 293

>CAGL0H03553g complement(328668..330155) highly similar to sp|P29295
           Saccharomyces cerevisiae YPL204w HRR25, start by
           similarity
          Length = 495

 Score =  311 bits (798), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 153/291 (52%), Positives = 201/291 (69%), Gaps = 2/291 (0%)

Query: 73  VGLHYKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLKDEYRTYKILSGSEG 132
           VG  ++IG+KIG GSFG ++ G N+I+   VAIK E  ++  PQL  E R YK LSG  G
Sbjct: 5   VGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLESIRSRHPQLDYESRVYKYLSGGVG 64

Query: 133 IPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELHDHDL 192
           IP   +FG+EG +N +VIDLLGPSLEDLF++C R+FS KTV+ +A+QMI  ++ +H    
Sbjct: 65  IPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRKFSFKTVIMLALQMICRVQYIHGRSF 124

Query: 193 IYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSI 252
           I+RDIKPDNFL+G   +   + VH+IDFG++K YRD  T +HIPYRE KSL+GTARY S+
Sbjct: 125 IHRDIKPDNFLMGVGRR--GSTVHVIDFGLSKKYRDFNTHRHIPYRENKSLTGTARYASV 182

Query: 253 NTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKYEKIGEKKRSTNVYDLSQ 312
           NTHLG EQSRRDD+E+LG++  YF +G LPWQGLKA   K KY++I EKK   +V  L  
Sbjct: 183 NTHLGIEQSRRDDLESLGYMLIYFCKGSLPWQGLKATTKKQKYDRILEKKLCISVETLCA 242

Query: 313 GLPVQFGRYLEIVRNLGFEETPDYEGYRKLLLSVLDELGQKLDGEYDWMKL 363
           GLP++F  Y+   RNL F+E PDY    +L   +  +L    D  +DW  L
Sbjct: 243 GLPLEFSEYMNYCRNLKFDERPDYLYLARLFKDLSIKLEYHNDHLFDWTML 293

>Sklu_1892.3 YPL204W, Contig c1892 5770-7194
          Length = 474

 Score =  309 bits (792), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 153/291 (52%), Positives = 200/291 (68%), Gaps = 2/291 (0%)

Query: 73  VGLHYKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLKDEYRTYKILSGSEG 132
           VG  ++IG+KIG GSFG ++ G N+I+   VAIK E  ++  PQL  E R YK LSG  G
Sbjct: 5   VGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLESIRSRHPQLDYESRVYKYLSGGIG 64

Query: 133 IPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELHDHDL 192
           IP   +FG+EG +N +VIDLLGPSLEDLF++C R+FS KTV+ +A+QMI  I+ +H    
Sbjct: 65  IPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRKFSFKTVIMLALQMICRIQYIHGRSF 124

Query: 193 IYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSI 252
           I+RDIKPDNFL+G   +   + VH+IDFG++K YRD  T  HIPYRE K+L+GTARY S+
Sbjct: 125 IHRDIKPDNFLMGVGRR--GSTVHVIDFGLSKKYRDFSTHHHIPYRENKNLTGTARYASL 182

Query: 253 NTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKYEKIGEKKRSTNVYDLSQ 312
           NTHLG EQSRRDD+E+LG+V  YF +G LPWQGLKA   + KY++I EKK   +V  L  
Sbjct: 183 NTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLKATTKRQKYDRIMEKKLCISVEQLCA 242

Query: 313 GLPVQFGRYLEIVRNLGFEETPDYEGYRKLLLSVLDELGQKLDGEYDWMKL 363
           GLP++F  Y+   RNL F+E PDY    +L   +  +L    D  +DW  L
Sbjct: 243 GLPMEFVEYMRYCRNLRFDERPDYLYLARLFKDLSIKLEYHNDHLFDWTML 293

>YPL204W (HRR25) [5244] chr16 (164275..165759) Casein kinase I
           (serine/threonine/tyrosine protein kinase) involved in
           DNA repair and meiosis [1485 bp, 494 aa]
          Length = 494

 Score =  310 bits (793), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 153/291 (52%), Positives = 201/291 (69%), Gaps = 2/291 (0%)

Query: 73  VGLHYKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLKDEYRTYKILSGSEG 132
           VG  ++IG+KIG GSFG ++ G N+I+   VAIK E  ++  PQL  E R Y+ LSG  G
Sbjct: 5   VGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLESIRSRHPQLDYESRVYRYLSGGVG 64

Query: 133 IPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELHDHDL 192
           IP   +FG+EG +N +VIDLLGPSLEDLF++C RRFS KTV+ +A+QM   I+ +H    
Sbjct: 65  IPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRRFSFKTVIMLALQMFCRIQYIHGRSF 124

Query: 193 IYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSI 252
           I+RDIKPDNFL+G   +   + VH+IDFG++K YRD  T +HIPYRE KSL+GTARY S+
Sbjct: 125 IHRDIKPDNFLMGVGRR--GSTVHVIDFGLSKKYRDFNTHRHIPYRENKSLTGTARYASV 182

Query: 253 NTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKYEKIGEKKRSTNVYDLSQ 312
           NTHLG EQSRRDD+E+LG+V  YF +G LPWQGLKA   K KY++I EKK + +V  L  
Sbjct: 183 NTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLKATTKKQKYDRIMEKKLNVSVETLCS 242

Query: 313 GLPVQFGRYLEIVRNLGFEETPDYEGYRKLLLSVLDELGQKLDGEYDWMKL 363
           GLP++F  Y+   +NL F+E PDY    +L   +  +L    D  +DW  L
Sbjct: 243 GLPLEFQEYMAYCKNLKFDEKPDYLFLARLFKDLSIKLEYHNDHLFDWTML 293

>Scas_690.12
          Length = 488

 Score =  265 bits (678), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 134/289 (46%), Positives = 192/289 (66%), Gaps = 3/289 (1%)

Query: 73  VGLHYKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLKDEYRTYKILS-GSE 131
           VG  Y++G++IG GSFG ++ G+++I+   +AIK E  +T  PQL+ E R Y  +S GS 
Sbjct: 5   VGKRYRVGRRIGGGSFGEIYHGIDLISGEEIAIKLESSETRHPQLEYESRVYNFVSDGSM 64

Query: 132 GIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELHDHD 191
           GIP    F +   ++ LV+DLLGPSLEDLF++C R FS KT+  +A QMI  +  +H   
Sbjct: 65  GIPNIRMFERGFGYSALVMDLLGPSLEDLFNYCHRSFSYKTIFMLAWQMIARVAYVHGKS 124

Query: 192 LIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMS 251
            ++RDIKP+NFL+G   +  AN+V+LIDFG++K YRD  + +H P +  KSL GTARY S
Sbjct: 125 FLHRDIKPENFLLGTGRR--ANIVNLIDFGLSKKYRDFNSHRHNPRKTHKSLVGTARYAS 182

Query: 252 INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKYEKIGEKKRSTNVYDLS 311
           +NTH G EQSRRDD+E+LG+V  YF +G LPWQGL+A   K KY++I ++K       L 
Sbjct: 183 VNTHFGIEQSRRDDLESLGYVLVYFAKGHLPWQGLRATTKKQKYDRILQRKLCITTDILC 242

Query: 312 QGLPVQFGRYLEIVRNLGFEETPDYEGYRKLLLSVLDELGQKLDGEYDW 360
           +GLP QF  Y+  VR+L +++ PDY    +L  ++ ++L    D  +DW
Sbjct: 243 EGLPSQFVAYMGYVRSLQYDQRPDYVYLEQLFKNLSEQLNYTNDYLFDW 291

>YDR490C (PKH1) [1306] chr4 complement(1431956..1434256)
           Serine/threonine protein kinase, functions similarly to
           mammalian 3-phosphoinositide-dependent protein kinase,
           phosphorylates and activates Ypk1p, required for
           endocytosis [2301 bp, 766 aa]
          Length = 766

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 75/272 (27%), Positives = 125/272 (45%), Gaps = 49/272 (18%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLKDEYRTYKILS-----GSE 131
           +K G+++G+GS+  +       +    A+K   ++    Q K +Y T + L+     G++
Sbjct: 125 FKFGEQLGDGSYSSVVLATARDSGKKYAVKVLSKEYLIRQKKVKYVTVEKLALQKLNGTK 184

Query: 132 GIPQAYYFGQEGLHNILVI------DLLG--PSLEDLFDWCGRRFSIKTVVHVAIQMITL 183
           GI + ++  Q+      ++      D LG       L + C R +        A Q+I  
Sbjct: 185 GIFKLFFTFQDEASLYFLLEYAPHGDFLGLIKKYGSLNETCARYY--------ASQIIDA 236

Query: 184 IEELHDHDLIYRDIKPDNFLIGRPNQPDANM-VHLIDFGMAKLY-RDPK-TKQHIP---- 236
           ++ LH+  +I+RDIKP+N L+      D NM V L DFG AK+   +P  T    P    
Sbjct: 237 VDSLHNIGIIHRDIKPENILL------DKNMKVKLTDFGTAKILPEEPSNTADGKPYFDL 290

Query: 237 YREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKYE 296
           Y + KS  GTA Y+S           R D+ A G + +  L G+ P+   KAAN  L ++
Sbjct: 291 YAKSKSFVGTAEYVSPELLNDNYTDSRCDIWAFGCILYQMLAGKPPF---KAANEYLTFQ 347

Query: 297 KIGEKKRSTNVYDLSQGLPVQFGRYLEIVRNL 328
           K+ + +     Y  + G P       +IV++L
Sbjct: 348 KVMKIQ-----YAFTAGFP-------QIVKDL 367

>KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces
            cerevisiae YNR031c SSK2 MAP kinase kinase kinase of the
            high osmolarity signal transduction pathway, start by
            similarity
          Length = 1551

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 68/223 (30%), Positives = 105/223 (47%), Gaps = 31/223 (13%)

Query: 83   IGEGSFGVLFEGVNMINNVPVAIKFEPRKTDA-------PQLKDEYRTYKILSGSEGIPQ 135
            IG GSFG ++  VN+     +A+K E +  DA       P LK+E R  +IL+    +  
Sbjct: 1265 IGSGSFGTVYSAVNLDTGDILAVK-EIKIQDAKSMKQIFPSLKEEMRVMEILNHPNIVQ- 1322

Query: 136  AYYFGQEGLH----NILVIDLLGPSLEDLFDWCGRRFSIKTVVHV-AIQMITLIEELHDH 190
              Y+G E +H    NI +    G SL  L +    R   + V  V  +Q++  +  LH  
Sbjct: 1323 --YYGVE-VHRDKVNIFMEFCEGSSLASLLE--HGRIEDEMVTQVYTLQLLEGLACLHQS 1377

Query: 191  DLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKS-----LSG 245
             +++RDIKP+N L+ R       ++  +DFG AKL     +K+       KS     + G
Sbjct: 1378 GVVHRDIKPENILLDR-----NGVIKYVDFGAAKLIAKNGSKRISLDANNKSTGGKDMIG 1432

Query: 246  TARYMSINTHLGREQSR--RDDMEALGHVFFYFLRGQLPWQGL 286
            T  YM+  T  G+   +   DD+ +LG V    + G+ PW  L
Sbjct: 1433 TPMYMAPETVTGQGHGKFGSDDIWSLGCVVLEMVTGRRPWANL 1475

>KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, start by
           similarity
          Length = 925

 Score = 68.6 bits (166), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 63/233 (27%), Positives = 110/233 (47%), Gaps = 23/233 (9%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLKDEY-----RTYKILSGSE 131
           +K G+ +G+GS+  +    ++ +N   A+K   ++    Q K +Y      T + L  ++
Sbjct: 155 FKFGETLGDGSYSTVLLATSIESNKKYAVKILNKEYLIKQKKVKYVNIEKNTLQRLKNTK 214

Query: 132 GIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSI--KTVVHVAIQMITLIEELHD 189
           GI   Y+  Q+      +++   P+  DL     +  S+  K   + A Q+I  +  +HD
Sbjct: 215 GIISLYFTFQDESSLYFLLEY-APN-GDLLSLMRKHGSVNEKCTQYYAAQIIDALGFMHD 272

Query: 190 HDLIYRDIKPDNFLIGRPNQPDANM-VHLIDFGMAKLYRDPKTKQHIPY---REKKSLSG 245
             +I+RD+KP+N L+      D +M V L DFG A+L  D  ++  + Y       S  G
Sbjct: 273 KGVIHRDLKPENILL------DVDMKVKLTDFGTARLL-DSTSEDDLKYDLLTRSNSFVG 325

Query: 246 TARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKYEKI 298
           TA Y+S           R D+ A G + F  + G+ P+   KA N  L ++K+
Sbjct: 326 TAEYVSPELLNDNYVDFRCDIWAFGCILFQMIAGKPPF---KANNEYLTFQKV 375

>Scas_618.8
          Length = 427

 Score = 66.6 bits (161), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 61/212 (28%), Positives = 102/212 (48%), Gaps = 22/212 (10%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIK------FEPRKTDAPQLKDEYRTYKILSGS 130
           Y+ GK +G GSFGV+ E     NN  VAIK       E  +     L DE    K L   
Sbjct: 27  YEFGKTLGAGSFGVVREATKKSNNEEVAIKILLKKALEGNQVQLQMLYDELTILKKLHHP 86

Query: 131 EGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGR--RFSIKTVVHVAIQMITLIEELH 188
             +    +F  E    I ++  L    E LFD   +  RFS    V + IQ+++ +E +H
Sbjct: 87  NIVEFKNWF--ETDDKIYIVTQLATGGE-LFDRIIKKGRFSEDDAVKILIQILSAVEYIH 143

Query: 189 DHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTA- 247
             D+++RD+KP+N L+    + D+ +V + DFG+AK   + K  + + ++   SL   A 
Sbjct: 144 SRDIVHRDLKPEN-LLYLTEKEDSELV-IADFGIAK---ELKKGEQLIFKAAGSLGYVAP 198

Query: 248 RYMSINTHLGREQSRRDDMEALGHVFFYFLRG 279
             ++++ H      +  D+ ++G + +  L G
Sbjct: 199 EVLTVDGH-----GKPCDIWSIGVITYTLLSG 225

>Sklu_2437.16 YOL100W, Contig c2437 35714-38929 reverse complement
          Length = 1071

 Score = 65.5 bits (158), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 65/255 (25%), Positives = 119/255 (46%), Gaps = 38/255 (14%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIK-----FEPRKTDAPQLKDEYRTYKILSGSE 131
           +K G+ +G+GS+  +    +  +    A+K     +  R+     +  E  T + L+ S 
Sbjct: 182 FKFGEILGDGSYSTVMLATSNDSGKKYAVKVLNKEYLIRQKKVKYVNIEKNTLQRLNNSR 241

Query: 132 GIPQAYYFGQE--GLHNILVIDLLGPSLE------DLFDWCGRRFSIKTVVHVAIQMITL 183
           G+ + Y+  Q+   L+ +L     G  L        L + C R +          QM+  
Sbjct: 242 GVIKLYFTFQDEASLYFLLEYAPNGDFLSVMKKFGSLNEECCRYY--------GAQMLDA 293

Query: 184 IEELHDHDLIYRDIKPDNFLIGRPNQPDANM-VHLIDFGMAKLY-RDPKTKQHIPYREKK 241
           I+ +H + +++RDIKP+N L+      D +M V L DFG AKL  RD K+  ++  ++ +
Sbjct: 294 IDFIHKNGVVHRDIKPENILL------DEHMKVKLTDFGTAKLLDRDEKSGYNL-LKKSR 346

Query: 242 SLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKYEKIGEK 301
           S  GTA Y+S         + + D+ A G + +  + G+ P+   KA N  L ++K+ + 
Sbjct: 347 SFVGTAEYVSPELLNDNCVNYKCDIWAFGCILYQMIAGKPPF---KATNEYLTFQKVMKV 403

Query: 302 KRSTNVYDLSQGLPV 316
           +     Y  + G P+
Sbjct: 404 Q-----YAFTAGFPL 413

>AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C
            (SSK2) - SH] (1120017..1124468) [4452 bp, 1483 aa]
          Length = 1483

 Score = 65.5 bits (158), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 70/233 (30%), Positives = 109/233 (46%), Gaps = 34/233 (14%)

Query: 73   VGLHYKIGKKIGEGSFGVLFEGVNMINNVPVA---IKFEPRKTDA---PQLKDEYRTYKI 126
            V + ++    IG GSFG ++  VN+     +A   IKF  RKT     P ++DE    ++
Sbjct: 1187 VSIKWQKRSFIGGGSFGSVYSAVNLDTGDILAVKEIKFNDRKTIKQVFPSIRDEMTVLEM 1246

Query: 127  LSGSEGIPQAYYFGQEGLH----NILVIDLLGPSLEDLFDWCGRRFSIKTVVHV-AIQMI 181
            L+    +    Y+G E +H    NI +    G SL  L      R   + V  V ++QM+
Sbjct: 1247 LNHPNVVQ---YYGVE-VHRDRVNIFMEYCEGGSLASLL--AHGRIEDEMVTQVYSLQML 1300

Query: 182  TLIEELHDHDLIYRDIKPDNFLIGRPNQPDAN-MVHLIDFGMAKLYRDPKTK-----QHI 235
              +  LH+  + +RDIKP+N L+      D N ++  +DFG AK+     +K     QH+
Sbjct: 1301 EGLAYLHESGVDHRDIKPENILL------DFNGIIKYVDFGAAKVLASNGSKKLNLEQHM 1354

Query: 236  PYREKKSLSGTARYMSINTHLGREQSR--RDDMEALGHVFFYFLRGQLPWQGL 286
               E + + GT  YMS     G    +   DD+ +LG V    + G+ PW  L
Sbjct: 1355 ---EGEKMIGTPMYMSPEAISGTGYGKFGSDDIWSLGCVILEMVTGRRPWANL 1404

>Kwal_56.22693
          Length = 984

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 73/310 (23%), Positives = 136/310 (43%), Gaps = 52/310 (16%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIK-----FEPRKTDAPQLKDEYRTYKILSGSE 131
           ++ G+ +G+GS+  +    +  +    A+K     +  R+     +  E  T + L+   
Sbjct: 158 FRFGEVLGDGSYSTVMLARSNDSGKKYAVKVLNKEYLIRQKKVKYVNIEKNTLQRLNDGR 217

Query: 132 GIPQAYYFGQE--GLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELHD 189
           G+ + Y+  Q+   L+ +L     G  L  +  +     S +  V+ + Q++  I+ LH 
Sbjct: 218 GVIKLYFTFQDEASLYFLLEYAPNGDFLSVIKKFGS--LSQECAVYYSAQILDAIDYLHH 275

Query: 190 HDLIYRDIKPDNFLIGRPNQPDANM-VHLIDFGMAKLYRDPKTKQHIPYREK-KSLSGTA 247
             +++RDIKP+N L+      D +M V L DFG A++    +T Q     E+ KS  GTA
Sbjct: 276 KGIVHRDIKPENILL------DKDMKVKLTDFGTARILEKDETTQTFNLLERSKSFVGTA 329

Query: 248 RYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKYEKIGEKKRSTNV 307
            Y+S           + D+ A G + F  + G+ P+   KA N  L ++K+ + +     
Sbjct: 330 EYVSPELLNDNYVDYKCDIWAFGCILFQMIAGKPPF---KATNEYLTFQKVMKVQ----- 381

Query: 308 YDLSQGLPVQFGRYLEIVRNLGFEETPDYEGYRKLLLSVLDELGQKLDGE-------YDW 360
           Y  + G P+       ++R+L           +K+L+   +   Q+LD         +  
Sbjct: 382 YAFTAGFPL-------VIRDL----------IKKILVKSPE---QRLDASQIKKHHFFKD 421

Query: 361 MKLNGGRGWD 370
           +  N G  WD
Sbjct: 422 VNFNDGSVWD 431

>AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C
           (PKH1) - SH] (1046762..1049863) [3102 bp, 1033 aa]
          Length = 1033

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 66/252 (26%), Positives = 113/252 (44%), Gaps = 29/252 (11%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLKDEY-----RTYKILSGSE 131
           +K G+ +G+GS+  +     + +    A K   ++    Q K +Y      T + L+ S 
Sbjct: 200 FKFGEALGDGSYSTVVLATCIESGKKYAAKILNKEYLIKQKKVKYVNIEKNTLQRLNSSR 259

Query: 132 --GIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRF---SIKTVVHVAIQMITLIEE 186
             G+ + Y+  Q+   N+  +    P+ +  F    +RF   S +   +   Q++  I  
Sbjct: 260 VPGVIKLYFTFQDEA-NLYFLLEYAPNGD--FLSVMKRFGTLSEECTKYYGAQILDAIHH 316

Query: 187 LHDHDLIYRDIKPDNFLIGRPNQPDANM-VHLIDFGMAKLY-RDPKTKQHIPYREKKSLS 244
           LH   +I+RD+KP+N L+      D  M + L DFG AKL  R+ + K +      KS  
Sbjct: 317 LHKQGIIHRDVKPENILL------DKTMKIKLTDFGTAKLIGREDENKPYDLNTRSKSFV 370

Query: 245 GTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKYEKIGEKKRS 304
           GTA Y+S           R D+ A G + F  + G+ P+   KA N  L ++K+   +  
Sbjct: 371 GTAEYVSPELLNDNYVDSRCDIWAFGCILFQMVAGKPPF---KATNEYLTFQKVMRVQ-- 425

Query: 305 TNVYDLSQGLPV 316
              Y  + G P+
Sbjct: 426 ---YAFTAGFPM 434

>AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C
           (CMK1) - SH] complement(358947..360308) [1362 bp, 453
           aa]
          Length = 453

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 54/213 (25%), Positives = 99/213 (46%), Gaps = 18/213 (8%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKT----DAPQLKDEYRTYKILSGSEG 132
           Y  GK +G G+FGV+ +  N   N  VAIK   ++     +   L DE    + L     
Sbjct: 56  YIFGKTLGAGAFGVVRQARNSKQNQNVAIKILLKRALKGNELQMLYDELSILQKLDHPNI 115

Query: 133 IPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRR--FSIKTVVHVAIQMITLIEELHDH 190
           +    +F  E      ++  L    E LFD   ++  F+    V + +QM+T +E +H  
Sbjct: 116 VKFKDWF--ESREKFYIVTQLATGGE-LFDRILKKGKFTETDAVKIVVQMLTAVEYMHSQ 172

Query: 191 DLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYM 250
           ++++RD+KP+N L   P+  D + + + DFG+AK      ++  + +R     +G+  Y+
Sbjct: 173 NVVHRDLKPENVLYLDPS--DESQLVISDFGIAK---QLSSESQLIHRA----AGSMGYV 223

Query: 251 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 283
           +          +  D+ +LG + +  L G  P+
Sbjct: 224 APEVLTTSGHGKPCDIWSLGVITYTLLCGYSPF 256

>Scas_660.20
          Length = 957

 Score = 62.4 bits (150), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 63/228 (27%), Positives = 108/228 (47%), Gaps = 23/228 (10%)

Query: 81  KKIGEGSFGVLFEGVNMINNVPV-AIKFEPRKTDAPQLKDEY-----RTYKILSGSE--G 132
           +++G GS+  +++ ++  N   + AIK   +     + K +Y      T  +L+ +   G
Sbjct: 15  EELGHGSYSTVYKAIDKRNTKRIFAIKVCSKAHIIKESKVKYVTIEKNTLNLLAKAHHPG 74

Query: 133 IPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELHDHD 191
           I + YY   +  +   V+D L G  L  L     + FS     H  +Q++  +E +H   
Sbjct: 75  IVKLYYTFHDEENLYYVLDYLPGGELLSLLHKM-KTFSEVWSKHFTVQLVDTLEFIHSQG 133

Query: 192 LIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMS 251
           +I+RD+KP+N L+ R    D  ++ + DFG A          +   +   S  GTA Y+S
Sbjct: 134 VIHRDLKPENVLLDR----DGKLM-ITDFGAAYTTTAGNNDAN---KSSSSFVGTAEYVS 185

Query: 252 INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLK-YEKI 298
               L  + S   D+ ALG + F F+ G  P++G     N+LK +EKI
Sbjct: 186 PELLLHNQCSFSSDVWALGCMIFQFVTGSPPFRG----ENELKTFEKI 229

>Scas_502.2
          Length = 1116

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 64/262 (24%), Positives = 117/262 (44%), Gaps = 34/262 (12%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIK-----FEPRKTDAPQLKDEYRTYKILSGSE 131
           +K G+ +G+G++  +    +  +    A+K     +  R+     +  E    + L+ S 
Sbjct: 174 FKFGEMLGDGAYSTVMLATSNDSGKKYAVKVLNKEYLIRQKKVKYVNIEKLALQRLNNSR 233

Query: 132 GIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSI--KTVVHVAIQMITLIEELHD 189
            I + ++  Q+      +++   P+  DL     +  S+  +   +   Q+I  I+ +H 
Sbjct: 234 SIIRLFFTFQDEASLYFLLEY-APN-GDLLSLMKKFGSLNEECCCYYGAQIIDAIKFMHS 291

Query: 190 HDLIYRDIKPDNFLIGRPNQPDANM-VHLIDFGMAKLY--RDPKTKQHIPYREKKSLSGT 246
             +I+RDIKP+N L+      D +M V + DFG AK+   + P T   +  R  KS  GT
Sbjct: 292 KGIIHRDIKPENILL------DKDMKVKITDFGTAKILDNKPPGTSYDLLTRS-KSFVGT 344

Query: 247 ARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKYEKIGEKKRSTN 306
           A Y+S           R D+ A G + F  + G+ P+   KA N  L ++K+ + +    
Sbjct: 345 AEYVSPELLNDNYTDARSDIWAFGCIVFQMIAGKPPF---KATNEYLTFQKVMKVQ---- 397

Query: 307 VYDLSQGLPVQFGRYLEIVRNL 328
            Y  + G P        +VR+L
Sbjct: 398 -YAFTAGFPT-------VVRDL 411

>Kwal_23.6325
          Length = 1542

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 65/233 (27%), Positives = 110/233 (47%), Gaps = 31/233 (13%)

Query: 73   VGLHYKIGKKIGEGSFGVLFEGVNMINNVPVA---IKFEPRKTDA---PQLKDEYRTYKI 126
            V + ++  + +G G+FG +F  VN+     +A   IK + RK+     P +K+E    ++
Sbjct: 1245 VSIRWQKRQFVGGGAFGTVFSAVNLDTGEILAVKEIKIQDRKSMKQVFPAIKEEMSVLEM 1304

Query: 127  LSGSEGIPQAYYFGQEGLH----NILVIDLLGPSLEDLFDWCGRRFSIKTVVHV-AIQMI 181
            L+    +    Y+G E +H    N+ +    G SL  L +    R   + V  + A+QM+
Sbjct: 1305 LNHPNVVQ---YYGVE-VHRDKVNLFMEYCEGGSLAQLLE--HGRIEDEMVTQIYALQML 1358

Query: 182  TLIEELHDHDLIYRDIKPDNFLIGRPNQPDAN-MVHLIDFGMAKLYRDPKTKQHIPYREK 240
              +  LH   +++RDIKP+N L+      D N ++  +DFG A+      TK      E 
Sbjct: 1359 EGLAYLHQSSVVHRDIKPENILL------DFNGVIKYVDFGAARSLAANGTKAPNVGAEG 1412

Query: 241  K-----SLSGTARYMSINTHLGREQSR--RDDMEALGHVFFYFLRGQLPWQGL 286
            K     S+ GT  YMS  +  G ++ +    D+ +LG V    + G+ PW  L
Sbjct: 1413 KADGVNSMMGTPMYMSPESITGAKKGKFGSGDIWSLGCVILEMVTGRRPWFNL 1465

>YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine protein
            kinase of the MEKK family involved in the cell wall
            integrity (low-osmolarity) and nutrient sensing pathways
            [4437 bp, 1478 aa]
          Length = 1478

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 66/275 (24%), Positives = 120/275 (43%), Gaps = 43/275 (15%)

Query: 80   GKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLKDEYRTYKILSGSEGIPQ---- 135
            G+ IG+GSFG ++  +N+     +A+K    + + P+   +     ILS  E +      
Sbjct: 1178 GEMIGKGSFGAVYLCLNVTTGEMMAVK----QVEVPKYSSQNEA--ILSTVEALRSEVST 1231

Query: 136  ---------AYYFGQEGLHNILVIDL---LGPSLEDLFDWCGRRFSIKTVVHVAIQMITL 183
                       Y G E  +NI  + L    G S+  L    GR F    + H+  Q++  
Sbjct: 1232 LKDLDHLNIVQYLGFENKNNIYSLFLEYVAGGSVGSLIRMYGR-FDEPLIKHLTTQVLKG 1290

Query: 184  IEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSL 243
            +  LH   +++RD+K DN L+ +       +  + DFG+++  +D  +   +  R     
Sbjct: 1291 LAYLHSKGILHRDMKADNLLLDQ-----DGICKISDFGISRKSKDIYSNSDMTMR----- 1340

Query: 244  SGTARYMS---INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKYEKIGE 300
             GT  +M+   ++T  G   S + D+ +LG +      G+ PW  L+         KIG+
Sbjct: 1341 -GTVFWMAPEMVDTKQG--YSAKVDIWSLGCIVLEMFAGKRPWSNLEVVAAMF---KIGK 1394

Query: 301  KKRSTNVYDLSQGLPVQFGR-YLEIVRNLGFEETP 334
             K +  + + +  L  Q GR +L+    +  E+ P
Sbjct: 1395 SKSAPPIPEDTLPLISQIGRNFLDACFEINPEKRP 1429

>CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces
           cerevisiae YOL100w PKH2, start by similarity
          Length = 1076

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 70/270 (25%), Positives = 116/270 (42%), Gaps = 47/270 (17%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLKDEY-----RTYKILSGSE 131
           +K G+ +G+G++  +       +    A+K   ++    Q K +Y        + L+ S 
Sbjct: 182 FKFGEMVGDGAYSTVMLATAKDSGKKYAVKVLNKEYLIKQKKVKYVNIEKNALQRLNNSR 241

Query: 132 GIPQAYYFGQE--GLHNILVIDLLGPSLE------DLFDWCGRRFSIKTVVHVAIQMITL 183
           GI + ++  Q+   L+ +L     G  L        L + C R +S         Q+I  
Sbjct: 242 GIVKLFFTFQDESSLYFLLEYAPNGDFLSVMKKYGSLSEDCTRYYSA--------QIIDG 293

Query: 184 IEELHDHDLIYRDIKPDNFLIGRPNQPDANM-VHLIDFGMAKLYRDPKTKQHIP----YR 238
           I+ LH   +I+RDIKP+N L+      D +M V + DFG AK+       +  P      
Sbjct: 294 IKYLHSKGIIHRDIKPENILL------DKDMKVKITDFGTAKILEPKNEDEDNPEFNLLT 347

Query: 239 EKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKYEKI 298
             KS  GTA Y+S           R D+ A G + F  + G+ P+   KA N  L ++K+
Sbjct: 348 RSKSFVGTAEYVSPELLNDSYVDARCDIWAFGCMVFQMIAGKPPF---KATNEYLTFQKV 404

Query: 299 GEKKRSTNVYDLSQGLPVQFGRYLEIVRNL 328
            + +     Y  + G PV       +VR+L
Sbjct: 405 MKVQ-----YAFTAGFPV-------VVRDL 422

>CAGL0G04609g complement(437162..440059) similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, hypothetical
           start
          Length = 965

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 65/133 (48%), Gaps = 14/133 (10%)

Query: 171 KTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANM-VHLIDFGMAKLYRDP 229
           +  ++ + Q+I  I  +H H +I+RDIKP+N L+      D NM + L DFG AKL +  
Sbjct: 218 ECTIYYSAQIIDAIGSMHSHGIIHRDIKPENILL------DGNMKIKLTDFGTAKLLQKK 271

Query: 230 KTKQHIPY----REKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQG 285
             K   P+        S  GTA Y+S           + D+ A G + +  + G+ P+  
Sbjct: 272 SDKNGKPHYNLLTRSSSFVGTAEYVSPELLSDNYTDYKCDIWAFGCLVYQMIAGKPPF-- 329

Query: 286 LKAANNKLKYEKI 298
            KA N  L ++K+
Sbjct: 330 -KATNEYLTFQKV 341

>CAGL0L03520g complement(401103..405446) similar to sp|Q01389
            Saccharomyces cerevisiae YJL095w BCK1, start by
            similarity
          Length = 1447

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 57/226 (25%), Positives = 104/226 (46%), Gaps = 33/226 (14%)

Query: 80   GKKIGEGSFGVLFEGVNMINNVPVAIK----------FEPRKTDAPQLKDEYRTYKILSG 129
            G+ IG+GSFG ++  +N+     +A+K           E  K     LK E  T K L  
Sbjct: 1154 GEMIGKGSFGAVYLSLNITTGEMMAVKQVEVPKYGTQNELVKDMVEALKSEVATLKDL-- 1211

Query: 130  SEGIPQAYYFGQE---GLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEE 186
             + +    Y G E    ++++ +  + G S+  L    GR F  K + H+  Q+++ ++ 
Sbjct: 1212 -DHLNIVQYLGSEIRGNIYSLFLEYVAGGSVGSLIRLYGR-FDEKLIRHLNTQVLSGLKY 1269

Query: 187  LHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGT 246
            LH   +++RD+K DN L+      +  +  + DFG++K  ++  +   +  R      GT
Sbjct: 1270 LHSKGILHRDMKADNLLLD-----EDGICKISDFGISKKSKNIYSNSDMTMR------GT 1318

Query: 247  ARYMS---INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAA 289
              +M+   ++T  G   S + D+ +LG V      G+ PW  L+  
Sbjct: 1319 VFWMAPEMVDTKQG--YSAKVDIWSLGCVVLEMFAGKRPWSNLEVV 1362

>AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919)
           [1440 bp, 479 aa]
          Length = 479

 Score = 60.5 bits (145), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 57/223 (25%), Positives = 96/223 (43%), Gaps = 32/223 (14%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQ--------LKDEYRTYKILS 128
           YK+G+ I  GSF V+    +      VA+K+  +  D P+        + +EY   + L 
Sbjct: 7   YKVGRLIQSGSFSVVHHAQDCQTGQDVALKYVRKPHDNPEQLQKVAALVHNEYAILRRLG 66

Query: 129 GSEGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCG---RRFSIKTVVH-VAIQMITLI 184
               I Q   F ++    + V++    +  DL+D+      R +++   H    Q+ + I
Sbjct: 67  THRNICQLLDFYEDADTYVFVLEYC--AYGDLYDFIKAIRERPTMRINFHSFLFQLCSAI 124

Query: 185 EELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLS 244
              H  D+ +RDIKP+N L+      D   V L DFG+++          I    K    
Sbjct: 125 SYCHSKDVSHRDIKPENVLMD-----DRGQVKLTDFGLSQ----------IGSVSKDYCI 169

Query: 245 GTARYMSINTHLGRE--QSRRDDMEALGHVFFYFLRGQLPWQG 285
           GT +Y++  T L RE   +   D  +LG   F  + G  P++ 
Sbjct: 170 GTEKYLAPETFL-REYHNTFATDYWSLGITIFCLMFGSCPFES 211

>YOL100W (PKH2) [4721] chr15 (129236..132481) Serine/threonine
           protein kinase with similarity to mammalian
           3-phosphoinositide-dependent protein kinase,
           phosphorylates and activates Ypk2p, required for
           endocytosis [3246 bp, 1081 aa]
          Length = 1081

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 52/174 (29%), Positives = 77/174 (44%), Gaps = 34/174 (19%)

Query: 160 LFDWCGRRFSIKTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANM-VHLI 218
           L + C R +        A Q+I  I+ LH + +I+RDIKP+N L+      D  M + L 
Sbjct: 275 LDETCARYY--------AAQIIDAIDYLHSNGIIHRDIKPENILL------DGEMKIKLT 320

Query: 219 DFGMAKLYRDPKTKQHIP----YREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFF 274
           DFG AKL          P        KS  GTA Y+S           R D+ A G + F
Sbjct: 321 DFGTAKLLNPTNNSVSKPEYDLSTRSKSFVGTAEYVSPELLNDSFTDYRCDIWAFGCILF 380

Query: 275 YFLRGQLPWQGLKAANNKLKYEKIGEKKRSTNVYDLSQGLPVQFGRYLEIVRNL 328
             + G+ P+   KA N  L ++K+ + +     Y  + G P+       I+R+L
Sbjct: 381 QMIAGKPPF---KATNEYLTFQKVMKVQ-----YAFTPGFPL-------IIRDL 419

>KLLA0E03487g complement(323764..325707) similar to sgd|S0002874
           Saccharomyces cerevisiae YDR466w, start by similarity
          Length = 647

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 57/230 (24%), Positives = 100/230 (43%), Gaps = 22/230 (9%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLKDEY-----RTYKILS--G 129
           +   +++G GS+  +++ V+       AIK   +K    + K +Y      T  +L+   
Sbjct: 10  FSFKERLGHGSYSTVYKAVDRSTGQLFAIKVCSKKHIISENKVKYVTIEKNTLNLLAHGN 69

Query: 130 SEGIPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELH 188
             GI + YY   +  +   V+D   G  L  L    GR F+     H   Q+I  +E +H
Sbjct: 70  HPGIIKLYYTFHDSENLYFVLDFAPGGELLQLLQTQGR-FNEAWTKHFMCQLIDALEYIH 128

Query: 189 DHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTAR 248
              +++RD+KP+N L+    +     + + DFG+A                  S  GTA 
Sbjct: 129 GCKVVHRDLKPENLLLSSEGK-----LMITDFGVASNLAATDN-----LSSTSSFVGTAE 178

Query: 249 YMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKYEKI 298
           Y+S    L  + +   D+ A+G + + F +G  P++G    N    +EKI
Sbjct: 179 YVSPELLLQNKSNFCSDIWAVGCMLYQFTQGTPPFRG---ENELAAFEKI 225

>YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine
           protein kinase of unknown function [2697 bp, 898 aa]
          Length = 898

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 66/238 (27%), Positives = 109/238 (45%), Gaps = 30/238 (12%)

Query: 81  KKIGEGSFGVLFEGVNMIN-NVPVAIKFEPRKTDAPQLKDEY-----RTYKILSGS--EG 132
           +++G GS+  +F+ ++  + N   AIK   +K    + K +Y      T  +L+     G
Sbjct: 15  EELGHGSYSTVFKALDKKSPNKIYAIKVCSKKHIIKEAKVKYVTIEKNTMNLLAQKHHAG 74

Query: 133 IPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELHDHD 191
           I + YY   +  +   V+D   G  L  L    G    I T  H   Q+I  +E +H H 
Sbjct: 75  IIKLYYTFHDEENLYFVLDFAPGGELLSLLHKMGTFNDIWTR-HFTAQLIDALEFIHSHG 133

Query: 192 LIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPY----------REKK 241
           +I+RD+KP+N L+ R    D  ++ + DFG A       +     +          +   
Sbjct: 134 IIHRDLKPENVLLDR----DGRLM-ITDFGAAATIDPSLSGDSAKFNSDSNGSKDNQNCA 188

Query: 242 SLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLK-YEKI 298
           S  GTA Y+S    L  +     D+ ALG + + F++GQ P++G     N+LK +EKI
Sbjct: 189 SFVGTAEYVSPELLLYNQCGYGSDIWALGCMIYQFVQGQPPFRG----ENELKTFEKI 242

>AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH]
           (249144..250247) [1104 bp, 367 aa]
          Length = 367

 Score = 58.9 bits (141), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 60/228 (26%), Positives = 109/228 (47%), Gaps = 24/228 (10%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIK-FEPRKTDAPQLKDEYRTYKILSGSEGIP- 134
           ++IGK +G+G FG ++   ++ +    A+K  E +      ++ ++R    +  S   P 
Sbjct: 109 FEIGKVLGKGKFGRVYCVRHIESGFVCALKAMEKKDIIQYNIEKQFRREVEIQSSLRHPN 168

Query: 135 --QAY-YFGQEGLHNILVIDLLGPSLEDLFDWCGR-RFSIKTVVHVAIQMITLIEELHDH 190
             Q Y YF  E    +L+  L+   L       GR  F+     +   QM   ++ +H+ 
Sbjct: 169 LTQLYGYFHDEKRVYLLMEYLVNGELYKHLK--GRSHFNDVVASYYVYQMADALDYMHER 226

Query: 191 DLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYM 250
           ++++RDIKP+N +IG       N + L DFG + +   PK  +      +K+L GT  Y+
Sbjct: 227 NILHRDIKPENIIIGF-----NNTIKLTDFGWSVI--TPKGSK------RKTLCGTVDYL 273

Query: 251 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKYEKI 298
           S      RE + + D+ ALG + +  L G  P++     + +L Y++I
Sbjct: 274 SPELIRSREYNEKVDVWALGVLTYELLVGSPPFE---EESKELTYKRI 318

>KLLA0F16467g 1519800..1520822 highly similar to sp|P19454
           Saccharomyces cerevisiae YOR061w CKA2 casein kinase II
           alpha chain, start by similarity
          Length = 340

 Score = 57.8 bits (138), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 82/159 (51%), Gaps = 22/159 (13%)

Query: 76  HYKIGKKIGEGSFGVLFEGVNMINNVPVAIK-FEPRKTDAPQLKDEYRTYKILSGSEGIP 134
           +Y++ KKIG G +  +F+G +++N++P  IK  +P K     +K  YR  K+L+   G P
Sbjct: 50  NYEVIKKIGRGKYSEVFKGKSVLNDIPCVIKVLKPVK-----MKKIYRELKVLTNLTGGP 104

Query: 135 QAYYFGQEGLHNIL------VIDLLGPSLEDL-FDWCGRRFSIKTVVHVAIQMITLIEEL 187
                   GL +I+      +  L+   ++++ F      F++        Q++T ++  
Sbjct: 105 NII-----GLLDIVQDPGSKIPALIFEEVKNVDFRTLYPSFTLSDTQFYFTQLLTALDYC 159

Query: 188 HDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLY 226
           H   +++RD+KP N +I     P+   + LID+G+A+ Y
Sbjct: 160 HSMGIMHRDVKPQNVMI----DPNERKLRLIDWGLAEFY 194

>Sklu_2436.14 YDR466W, Contig c2436 31299-33653
          Length = 784

 Score = 58.9 bits (141), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 63/125 (50%), Gaps = 9/125 (7%)

Query: 175 HVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQH 234
           H   Q++ ++E +H   +I+RD+KP+N L+ +    D  ++ + DFG A +     T   
Sbjct: 121 HFMCQLVDVVEYIHSKGVIHRDLKPENVLLSK----DGRLM-VTDFGAASVVTTDGTSSD 175

Query: 235 IPYREK-KSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKL 293
               E+  S  GTA Y+S    L  +     D+ ALG + + F++G  P++G    N   
Sbjct: 176 NSVSERAASFVGTAEYVSPELLLNNQCFFSSDIWALGCILYQFMQGSPPFRG---ENELQ 232

Query: 294 KYEKI 298
            +EKI
Sbjct: 233 TFEKI 237

>YGL158W (RCK1) [1831] chr7 (207036..208574) Serine/threonine
           protein kinase with similarity to Cmk1p, Cmk2p, and
           Cmk3p [1539 bp, 512 aa]
          Length = 512

 Score = 58.2 bits (139), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 65/248 (26%), Positives = 109/248 (43%), Gaps = 51/248 (20%)

Query: 76  HYKIGKKIGEGSFGVLFE--GVNMINNVPVAIKFEPRK---TDA-------------PQL 117
           +YK+  KIGEG+F  +F+  G+N  +  PVAIK   +K   +DA              ++
Sbjct: 120 NYKLLNKIGEGAFSRVFKAVGINTDDQAPVAIKAIIKKGISSDAILKGNDRIQGSSRKKV 179

Query: 118 KDEYRTYKILSGSEGIPQAYYFGQEGL-HNILVIDLLGPSLEDLFDWCGR--RFSIKTVV 174
            +E   +K++S +      +   QE   +  LV +L+     ++FD   +   FS     
Sbjct: 180 LNEVAIHKLVSKNNPHCTKFIAFQESANYYYLVTELVTGG--EIFDRIVQLTCFSEDLAR 237

Query: 175 HVAIQMITLIEELHDHDLIYRDIKPDNFLI---------GRPNQPD----------ANMV 215
           HV  Q+   I+ +H   +++RD+KP+N L          G   + D            +V
Sbjct: 238 HVITQVAIAIKHMHYMGIVHRDVKPENLLFEPIPFYGLDGDMQKEDEFTLGVGGGGIGLV 297

Query: 216 HLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFY 275
            L+DFG+AK  R+            K+  GT  Y++      +  S + DM ++G V F 
Sbjct: 298 KLMDFGLAKKLRN---------NTAKTPCGTIEYVASEVFTSKRYSMKVDMWSIGCVLFT 348

Query: 276 FLRGQLPW 283
            L G  P+
Sbjct: 349 LLCGYPPF 356

>Kwal_26.7355
          Length = 1446

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 62/274 (22%), Positives = 124/274 (45%), Gaps = 41/274 (14%)

Query: 80   GKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQ--------------LKDEYRTYK 125
            G+ IG+GSFG +F G+N+     +A+K    + + P+              L+ E  T K
Sbjct: 1149 GEMIGKGSFGSVFLGLNVTTGEMIAVK----QVEVPRYGSQDETTLSVLEALRSEVATLK 1204

Query: 126  ILSGSEGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAIQMITLIE 185
             L  +  +    +  +  ++++ +  + G S+  L    G +F    +  +A+Q++  + 
Sbjct: 1205 DLDHTNIVQYLGFENKNYVYSLFLEYVAGGSVGSLIRLYG-KFDENLIRFLAVQVLRGLS 1263

Query: 186  ELHDHDLIYRDIKPDNFLIGRPNQPDAN-MVHLIDFGMAKLYRDPKTKQHIPYREKKSLS 244
             LH   +++RD+K DN L+      D + +  + DFG++      K   +I      ++ 
Sbjct: 1264 YLHSKKILHRDMKADNLLL------DVDGICKISDFGIS------KKSNNIYSNSDMTMR 1311

Query: 245  GTARYMS---INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKYEKIGEK 301
            GT  +M+   ++T  G   S + D+ +LG V      G+ PW  L+         KIG+ 
Sbjct: 1312 GTVFWMAPEMVDTKQG--YSAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAMF---KIGKF 1366

Query: 302  KRSTNVYDLSQGLPVQFGR-YLEIVRNLGFEETP 334
            K +  + + +Q +    G+ +L+    +  E+ P
Sbjct: 1367 KSAPPIPEDTQKIISAEGKEFLDACFEINPEKRP 1400

>CAGL0K08514g complement(853314..857783) similar to sp|P34244
           Saccharomyces cerevisiae YKL101w
           serine/threonine-protein kinase, hypothetical start
          Length = 1489

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 57/251 (22%), Positives = 106/251 (42%), Gaps = 60/251 (23%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLKDEY--------------- 121
           +K+GK +G+GS G +    N+ N    AIK  P++T   +++D+                
Sbjct: 93  WKLGKTLGKGSSGRVRLAKNIENGTLAAIKIVPKRTYNRRMRDQKMKTAGGVSSGTDSKD 152

Query: 122 ---RTYKILSGSEGIPQAYYFGQEGLHNILVIDLLG-PSLE------------------- 158
              R   I +G++     Y   +E    I+++ L+  P++                    
Sbjct: 153 SSNREDPIKNGTDSALNPYGIERE----IVIMKLISHPNVMGLLEVWENKSELYLVLEYV 208

Query: 159 ---DLFDWCGRR--FSIKTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDAN 213
              +LFD+   +   S    VH   Q+I  +   H  ++ +RD+KP+N L+ + N+    
Sbjct: 209 DGGELFDYLVSKGKLSEPEAVHYFTQIIQGVSYCHSFNICHRDLKPENLLLDKKNK---- 264

Query: 214 MVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSINTHLGRE-QSRRDDMEALGHV 272
           ++ + DFGMA L         +P +  ++  G+  Y S    +G+       D+ + G +
Sbjct: 265 VIKIADFGMAAL--------ELPNKLLETSCGSPHYASPEIVMGKPYHGGPSDVWSCGII 316

Query: 273 FFYFLRGQLPW 283
            F  L G LP+
Sbjct: 317 LFALLTGHLPF 327

>KLLA0B02332g complement(206863..207948) similar to sp|P38991
           Saccharomyces cerevisiae YPL209c IPL1 ser/thr protein
           kinase, start by similarity
          Length = 361

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 51/214 (23%), Positives = 102/214 (47%), Gaps = 21/214 (9%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIK-FEPRKTDAPQLKDEYRTYKILSGS---EG 132
           ++IGK +G+G FG ++   +    +  A+K  E ++     ++ ++R    + GS   + 
Sbjct: 100 FEIGKILGKGKFGKVYCVKHRETGLICALKAMEKKEIVQYTIQKQFRREVEIQGSFKHKN 159

Query: 133 IPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVV--HVAIQMITLIEELHDH 190
           + Q Y F  +     L+++ +     +L+ +      +   +  +   QM   ++ +H  
Sbjct: 160 LTQLYGFFYDEKRVYLLMEYV--YYGELYKFLKNNGPLNETLASYFVYQMANALDYMHSK 217

Query: 191 DLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYM 250
           ++++RDIKP+N LIG       N + L DFG +    D +        ++K+L GT  Y+
Sbjct: 218 NILHRDIKPENILIGF-----NNTIKLTDFGWSVYNEDGQ--------KRKTLCGTIDYL 264

Query: 251 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 284
           S      RE + + D+ ALG + +  L G  P++
Sbjct: 265 SPELIKSREYNNKVDVWALGVLTYELLVGSPPFE 298

>AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..90211)
           [1419 bp, 472 aa]
          Length = 472

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 60/233 (25%), Positives = 103/233 (44%), Gaps = 35/233 (15%)

Query: 76  HYKIGKKIGEGSFGVLFEGVNMINNVPVAIK-FEPRKTDAPQLKDEYRT-YKILSG--SE 131
            Y  GK++G G + ++ E +N I    VA+K F P+K D  +   ++R   KIL G   E
Sbjct: 154 RYIPGKELGSGHYAIVKEAINKITGQSVAVKIFHPQKNDDAKKTRQFREETKILMGLNHE 213

Query: 132 GIPQAYY-----FGQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAI--QMITLI 184
            I +          +  +   LV++ +     +LFD   R+  +      A+  Q++  +
Sbjct: 214 NIVKLLERFVEPLSKSQVQTYLVLEKIQDG--ELFDKIVRKTKLHQDETRALFKQILAGL 271

Query: 185 EELHDHDLIYRDIKPDNFL--IGRPNQPDAN------------MVHLIDFGMAKLYRDPK 230
           + LHD ++I+RDIKP+N L  I R   PD               V + DFG+AK   +  
Sbjct: 272 KYLHDRNIIHRDIKPENILLSIRRRTSPDQVQLGPWDEDELDITVKIADFGLAKFTGE-- 329

Query: 231 TKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 283
                  +   +L GT  Y++         + + D+ + G + +  L G  P+
Sbjct: 330 ------MQFTTTLCGTPSYVAAEVLTKTGYTSKVDLWSAGVLLYVCLCGFPPF 376

>YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway that is probably
           parallel to cAMP pathway, affects life span [2475 bp,
           824 aa]
          Length = 824

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 40/135 (29%), Positives = 63/135 (46%), Gaps = 20/135 (14%)

Query: 167 RFSIKTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDAN-MVHLIDFGMAKL 225
           RFS         +++  +E LHD+D++YRD+KP+N L+      DAN  + L DFG++K 
Sbjct: 509 RFSEDRAKFYIAELVLALEHLHDNDIVYRDLKPENILL------DANGNIALCDFGLSKA 562

Query: 226 YRDPKTKQHIPYREKKSLSGTARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPWQ 284
               +T          +  GT  Y++    L     ++  D  +LG + F    G   W 
Sbjct: 563 DLKDRT---------NTFCGTTEYLAPELLLDETGYTKMVDFWSLGVLIFEMCCG---WS 610

Query: 285 GLKAANNKLKYEKIG 299
              A NN+  Y+KI 
Sbjct: 611 PFFAENNQKMYQKIA 625

>Scas_613.5
          Length = 517

 Score = 55.5 bits (132), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 54/232 (23%), Positives = 102/232 (43%), Gaps = 35/232 (15%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIK-FEPRKTD----APQLKDEYRTYKILSGSE 131
           Y +GK +G G +  + EG+N +    VA+K F P++ D    + Q ++E      +    
Sbjct: 204 YVLGKDLGSGHYATVKEGINKVTGQTVAVKIFHPQQNDDEKKSKQFREETNILMRIHHPN 263

Query: 132 GIPQAYYF----GQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAI--QMITLIE 185
            +    +F     +  +   LV+D +     +LF+   ++  ++     AI  Q++  ++
Sbjct: 264 IVNLLDFFIEPVSKSQIQKYLVLDKIDDG--ELFERIVKKTCLRQDETKAIFNQILMGLK 321

Query: 186 ELHDHDLIYRDIKPDNFL--IGRPNQPDAN------------MVHLIDFGMAKLYRDPKT 231
            LH  ++I+RDIKP+N L  I R   P+               V + DFG+AK   +   
Sbjct: 322 HLHQQNIIHRDIKPENILLNITRRTNPEQKQLGPWDEDEIDIQVKIADFGLAKFTGE--- 378

Query: 232 KQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 283
                 +   +L GT  Y++      +  + + DM + G + +  L G  P+
Sbjct: 379 -----MQFTNTLCGTPSYVAPEVLTKKGYTSKVDMWSAGVILYVCLCGFPPF 425

>KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyveromyces
            lactis MAP kinase kinase kinase, start by similarity
          Length = 1338

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 57/248 (22%), Positives = 112/248 (45%), Gaps = 30/248 (12%)

Query: 80   GKKIGEGSFGVLFEGVNMINNVPVAIK------FEPRKTDA----PQLKDEYRTYKILSG 129
            G+ IG+GSFG ++  +N+     +A+K      F  +   A      LK E  T K L+ 
Sbjct: 1041 GEIIGKGSFGAVYLALNVTTGEMLAVKQVTVPEFSSQDESAISMVEALKSEVSTLKDLNH 1100

Query: 130  SEGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELHD 189
               +    +  + G++++ +  + G S+  L    GR F  + + H+  Q++  +  LH 
Sbjct: 1101 VNIVQYLGFEEKNGIYSLFLEYVAGGSVGSLIRMYGR-FDDQLIRHLTKQVLEGLAYLHS 1159

Query: 190  HDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARY 249
              +++RD+K DN L+      +  +  + DFG++      +   +I      ++ GT  +
Sbjct: 1160 KGILHRDMKADNLLLD-----NDGVCKISDFGIS------RKSNNIYSNSDMTMRGTVFW 1208

Query: 250  MS---INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKYEKIGEKKRSTN 306
            M+   ++T  G   S + D+ +LG V      G+ PW   +         +IG+ K +  
Sbjct: 1209 MAPEMVDTAHG--YSAKVDIWSLGCVVLEMFAGKRPWSNFEVVAAMF---QIGKSKTAPP 1263

Query: 307  VYDLSQGL 314
            + D ++ L
Sbjct: 1264 IPDDTKDL 1271

>AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)
           [2181 bp, 726 aa]
          Length = 726

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 57/216 (26%), Positives = 99/216 (45%), Gaps = 21/216 (9%)

Query: 81  KKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLKDEYRTYK-----IL--SGSEGI 133
           +++G GS+  ++  V   +    AIK   ++    + K +Y T +     +L  +   GI
Sbjct: 14  EELGHGSYSTVYRVVERSSQHQYAIKICSKRHIIGENKVKYVTIEKNTLNLLGQANHPGI 73

Query: 134 PQAYY--FGQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELHDHD 191
            + YY    QE L+ ++ +   G  L+ L     R FS     H   Q++  +E +H   
Sbjct: 74  IKLYYTFHDQENLYFVMDLAPGGELLQLLRR--QRVFSEAWARHYMCQLVDTVEYIHSMG 131

Query: 192 LIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLY--RDPKTKQHIPYREKKSLSGTARY 249
           +I+RD+KP+N L+ +  +     + + DFG A      D  +    P     S  GTA Y
Sbjct: 132 VIHRDLKPENVLLDKEGR-----LMIADFGAAYTVGQSDAGSDGDKP---ATSFVGTAEY 183

Query: 250 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQG 285
           +S    L  +     D+ ALG + + FL+G  P++G
Sbjct: 184 VSPELLLENKSYYSSDVWALGCMLYQFLQGTPPFRG 219

>Scas_711.25
          Length = 1515

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 65/280 (23%), Positives = 121/280 (43%), Gaps = 35/280 (12%)

Query: 80   GKKIGEGSFGVLFEGVNMINNVPVAIKF----------EPRKTDAPQLKDEYRTYKILSG 129
            G+ IG+GSFG ++  +N+     +A+K           E   +    L+ E  T K L  
Sbjct: 1217 GEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQDEAIISTVEALRSEVSTLKDLDH 1276

Query: 130  SEGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELHD 189
               +    +  ++ ++++ +  + G S+  L    GR F    + H+  Q++  +  LH 
Sbjct: 1277 LNIVQYLGFENKDNIYSLFLEYVAGGSVGSLIRMYGR-FDEPLIRHLNTQVLRGLAYLHS 1335

Query: 190  HDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARY 249
              +++RD+K DN L+ +       +  + DFG+++  +D  +   +  R      GT  +
Sbjct: 1336 RGILHRDMKADNLLLDQ-----DGVCKISDFGISRKSKDIYSNSDMTMR------GTVFW 1384

Query: 250  MS---INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKYEKIGEKKRSTN 306
            M+   ++T  G   S + D+ +LG +      G+ PW   +         KIG+ K +  
Sbjct: 1385 MAPEMVDTKQG--YSAKVDIWSLGCIVLEMFAGKRPWSNYEVVAAMF---KIGKSKSAPP 1439

Query: 307  VYDLSQGLPVQFGR-YLEIVRNLGFEETPDYEGYRKLLLS 345
            +   +  L  Q GR +L+      FE  PD       LLS
Sbjct: 1440 IPPDTLPLISQNGRDFLDAC----FEIDPDNRPTADNLLS 1475

>ADR204W [1945] [Homologous to ScYOR061W (CKA2) - SH]
           complement(1062595..1063614) [1020 bp, 339 aa]
          Length = 339

 Score = 54.7 bits (130), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 44/158 (27%), Positives = 77/158 (48%), Gaps = 22/158 (13%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIK-FEPRKTDAPQLKDEYRTYKILSGSEGIPQ 135
           Y+I  KIG G +  +F G +++N+ P  IK  +P K     +K  YR  KIL+   G P 
Sbjct: 50  YEIINKIGRGKYSEVFRGKSIVNDHPCVIKVLKPVK-----MKKIYRELKILTNLTGGPN 104

Query: 136 AYYFGQEGLHNIL------VIDLLGPSLEDL-FDWCGRRFSIKTVVHVAIQMITLIEELH 188
                  GL +I+      +  L+   ++++ F      F++    H   Q++  ++  H
Sbjct: 105 II-----GLLDIVQDPGSKIPALIFEEVKNVEFRTLYPAFTLSDTQHYFKQLLIALDYCH 159

Query: 189 DHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLY 226
              +++RD+KP N +I     P    + LID+G+A+ Y
Sbjct: 160 SMGIMHRDVKPQNVMI----DPTERKLRLIDWGLAEFY 193

>KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces
           cerevisiae YKL126w YPK1 ser/thr-specific protein kinase,
           start by similarity
          Length = 716

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 54/215 (25%), Positives = 90/215 (41%), Gaps = 24/215 (11%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIK-----FEPRKTDAPQLKDEYRTYKILSGSE 131
           + + K IG+GSFG + +      N   A+K     +   K++      E      +    
Sbjct: 382 FDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPF 441

Query: 132 GIPQAYYF-GQEGLHNILVIDLLGPSLEDLFDWCGR--RFSIKTVVHVAIQMITLIEELH 188
            +P  + F   E L+ +L     G    +LF    R  RF +        +++  +E LH
Sbjct: 442 IVPLKFSFQSSEKLYLVLAFINGG----ELFYHLQREGRFDLSRSRFYTAELLCALEALH 497

Query: 189 DHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTAR 248
           D D+IYRD+KP+N L+          + L DFG+ KL    + K         +  GT  
Sbjct: 498 DFDIIYRDLKPENILLDYQGH-----IALCDFGLCKLNMKDQEKT-------TTFCGTPE 545

Query: 249 YMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 283
           Y++    LG+  ++  D   LG + +  L G  P+
Sbjct: 546 YLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPY 580

>Sklu_2232.2 YOR061W, Contig c2232 1216-2340 reverse complement
          Length = 374

 Score = 54.7 bits (130), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 77/159 (48%), Gaps = 22/159 (13%)

Query: 76  HYKIGKKIGEGSFGVLFEGVNMINNVPVAIK-FEPRKTDAPQLKDEYRTYKILSGSEGIP 134
           +Y+I  KIG G +  +F G +++N+    IK  +P K     +K  YR  KIL+   G P
Sbjct: 85  NYEIVNKIGRGKYSEVFRGKSIVNDQACVIKVLKPVK-----MKKIYRELKILTNLSGGP 139

Query: 135 QAYYFGQEGLHNIL------VIDLLGPSLEDL-FDWCGRRFSIKTVVHVAIQMITLIEEL 187
                   GL +I+      +  L+   + ++ F      F++  + +   Q++  +E  
Sbjct: 140 NVI-----GLLDIVQDPGSKIPALIFEEVRNVDFRTLYPTFTLSDIQYYFTQLLIALEYC 194

Query: 188 HDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLY 226
           H   +++RD+KP N +I     P    + LID+G+A+ Y
Sbjct: 195 HSMGIMHRDVKPQNVMI----DPTERKLRLIDWGLAEFY 229

>Kwal_26.7788
          Length = 1267

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 54/216 (25%), Positives = 94/216 (43%), Gaps = 24/216 (11%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQ------LKDEYRTYKILSGS 130
           +K+GK +G+GS G +    NM      AIK  P+   +        ++ E    K++S  
Sbjct: 58  WKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPKTKSSRTGSLPYGIEREIIIMKLISHP 117

Query: 131 EGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSI--KTVVHVAIQMITLIEELH 188
             +   Y   +  L   LV++ +     +LFD+   R  +  K  +H   Q+I      H
Sbjct: 118 -NVMGLYEVWENKLELFLVLEYVDGG--ELFDYLVSRGRLPEKEAIHYFRQIIEGTAYCH 174

Query: 189 DHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTAR 248
             ++ +RD+KP+N L+ + N+     + + DFGMA L    K  +        +  G+  
Sbjct: 175 GFNICHRDLKPENLLLDKKNK----RIKIADFGMAALQTSNKLLE--------TSCGSPH 222

Query: 249 YMSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPW 283
           Y S    +G+       D+ + G + F  L G LP+
Sbjct: 223 YASPEIVMGKNYNGGPSDVWSCGIILFALLTGHLPF 258

>Kwal_47.18307
          Length = 621

 Score = 55.1 bits (131), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 61/124 (49%), Gaps = 11/124 (8%)

Query: 175 HVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQH 234
           H+  Q++  ++ +H   +I+RD+KP+N L+ +  +     V + DFG A    D K +  
Sbjct: 116 HITAQLVDTVDYMHSKGVIHRDLKPENVLLSQEGR-----VVITDFGAACTAADRKFENT 170

Query: 235 IPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLK 294
              +   S  GTA Y+S    L  +     D+ ALG + +   +G+ P++G    N    
Sbjct: 171 ---KRTASFVGTAEYVSPELLLHSQCGFSSDIWALGCIIYQLNQGKPPFRG---ENELQT 224

Query: 295 YEKI 298
           +EKI
Sbjct: 225 FEKI 228

>Kwal_56.24059
          Length = 353

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 66/233 (28%), Positives = 103/233 (44%), Gaps = 28/233 (12%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLK------DEYRTYKILSGS 130
           ++I + +G GSFG +    ++ N    AIK   +K    ++K      DE R  K++   
Sbjct: 43  FQILRTLGTGSFGRVHLVRSVHNGRYYAIKVL-KKEQVIRMKQIEHTNDERRMLKLVDHP 101

Query: 131 EGIPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELHD 189
             I     F Q+  +  +V+D + G  L  L     +RF        A ++I  +E LH 
Sbjct: 102 FLIRMWGTF-QDSRNLFMVMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVILALEYLHS 159

Query: 190 HDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARY 249
           HD+IYRD+KP+N L+ R        + + DFG AK   D  T          +L GT  Y
Sbjct: 160 HDIIYRDLKPENILLDRNGH-----IKITDFGFAKEV-DTVT---------WTLCGTPDY 204

Query: 250 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKYEKIGEKK 302
           ++      +  ++  D  +LG + F  L G  P+     A     YEKI + K
Sbjct: 205 IAPEVIATKPYNKSVDWWSLGILIFEMLAGYTPFYD---ATPMKTYEKILQGK 254

>YOR061W (CKA2) [4869] chr15 (441535..442554) Casein kinase II
           (Protein kinase CK2), catalytic (alpha-prime) subunit
           [1020 bp, 339 aa]
          Length = 339

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 77/159 (48%), Gaps = 22/159 (13%)

Query: 76  HYKIGKKIGEGSFGVLFEGVNMINNVPVAIK-FEPRKTDAPQLKDEYRTYKILSGSEGIP 134
           +Y+I  KIG G +  +F G  ++NN    IK  +P K     +K  YR  KIL+   G P
Sbjct: 49  NYEIINKIGRGKYSEVFSGRCIVNNQKCVIKVLKPVK-----MKKIYRELKILTNLTGGP 103

Query: 135 QAYYFGQEGLHNIL------VIDLLGPSLEDL-FDWCGRRFSIKTVVHVAIQMITLIEEL 187
                   GL++I+      +  L+   ++++ F      F +  + +   Q++  ++  
Sbjct: 104 NVV-----GLYDIVQDADSKIPALIFEEIKNVDFRTLYPTFKLPDIQYYFTQLLIALDYC 158

Query: 188 HDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLY 226
           H   +++RD+KP N +I     P    + LID+G+A+ Y
Sbjct: 159 HSMGIMHRDVKPQNVMI----DPTERKLRLIDWGLAEFY 193

>CAGL0K06479g 636296..639271 some similarities with tr|Q03306
           Saccharomyces cerevisiae YDR466w, start by similarity
          Length = 991

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 64/245 (26%), Positives = 112/245 (45%), Gaps = 37/245 (15%)

Query: 81  KKIGEGSFGVLFEGVNMINNV-PVAIKFEPRKTDAPQLKDEYRTYK------ILSGSE-G 132
           +++G GS+  +++ ++  +   P AIK   ++    + K +Y T +      +  G+  G
Sbjct: 15  EELGHGSYSTVYKALDKKDLKKPYAIKVCSKRHIIKEAKVKYVTIEKNTLNLLARGNHPG 74

Query: 133 IPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELHDHD 191
           I + YY   +  +   V+D   G  L  L    G  F+     H A Q++  +E +H   
Sbjct: 75  IVKLYYTFHDEENLYFVLDYASGGELLSLLHKMGT-FTDSWAKHFAAQLVDTLEFMHARG 133

Query: 192 LIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQH--------IP------- 236
           +I+RD+KP+N L+ +       ++ + DFG A    +   K +        IP       
Sbjct: 134 VIHRDLKPENVLLSK-----EGILMITDFGAAATQNNFSDKDNTRSNANEGIPKDDVPSS 188

Query: 237 --YREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLK 294
               E  S  GTA Y+S    L  + S   D+ ALG + + F++G  P++G     N+LK
Sbjct: 189 GDKTECSSFVGTAEYVSPELLLYNKCSFGSDIWALGCMVYQFIQGFPPFRG----ENELK 244

Query: 295 -YEKI 298
            +EKI
Sbjct: 245 TFEKI 249

>Kwal_0.96
          Length = 427

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 55/215 (25%), Positives = 95/215 (44%), Gaps = 20/215 (9%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRK------TDAPQLKDEYRTYKILSGS 130
           Y  GK +G GSFGV+ +   + +   VAIK   +K       +   L DE    + L   
Sbjct: 46  YIFGKTLGAGSFGVVRQARQVSSGENVAIKILLKKALKGKDVELQMLYDELSILQKLDHP 105

Query: 131 EGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGR--RFSIKTVVHVAIQMITLIEELH 188
             +    +F  E      ++  L    E LFD   +  +F+ +  V +  Q++  +E LH
Sbjct: 106 NIVKFKDWF--ESKDKFYIVTQLATGGE-LFDRILKQGKFTEEDAVRIVYQILKAVEYLH 162

Query: 189 DHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTAR 248
             ++++RD+KP+N L       D+ +V L DFG+AK  ++     H         +G+  
Sbjct: 163 SRNIVHRDLKPENLLY-LTEAADSQLV-LGDFGIAKELKNDDELIH-------KAAGSMG 213

Query: 249 YMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 283
           Y++          +  D+ +LG V +  L G  P+
Sbjct: 214 YVAPEVVTTSGHGKPCDIWSLGVVTYTLLCGYSPF 248

>YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase
            kinase kinase (MAPKKK) with strong similarity to Ssk2p,
            participates in the high-osmolarity signal transduction
            pathway [3996 bp, 1331 aa]
          Length = 1331

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 61/238 (25%), Positives = 103/238 (43%), Gaps = 36/238 (15%)

Query: 73   VGLHYKIGKKIGEGSFGVLFEGVNMINNVPVAIK------FEPRKTDAPQLKDEYRTYKI 126
            V + ++    IG G+FG ++  +N+ N   +A+K          K   P +K+E    ++
Sbjct: 1030 VSMRWQKRSFIGGGTFGQVYSAINLENGEILAVKEIKIHDTTTMKKIFPLIKEEMTVLEM 1089

Query: 127  LSGSEGIPQAYYFGQEGLH----NILVIDLLGPSLEDLFDWCGRRFSIKTVVHV-AIQMI 181
            L+    +    Y+G E +H    NI +    G SL  L D    R   + V  V   +++
Sbjct: 1090 LNHPNIVQ---YYGVE-VHRDKVNIFMEYCEGGSLASLLD--HGRIEDEMVTQVYTFELL 1143

Query: 182  TLIEELHDHDLIYRDIKPDNFLIGRPNQPDAN-MVHLIDFGMAKLYRDPKTKQH------ 234
              +  LH   +++RDIKP+N L+      D N ++  +DFG A+     +T+        
Sbjct: 1144 EGLAYLHQSGVVHRDIKPENILL------DFNGIIKYVDFGTARTVVGSRTRTVRNAAVQ 1197

Query: 235  ---IPYREKKSLSGTARYMSINTHLGREQSRR---DDMEALGHVFFYFLRGQLPWQGL 286
               +  +    + GT  YM+  T  G     +   DD+ ALG V      G+ PW  L
Sbjct: 1198 DFGVETKSLNEMMGTPMYMAPETISGSAVKGKLGADDVWALGCVVLEMATGRRPWSNL 1255

>CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces
           cerevisiae YHR205w SCH9 serine/threonine protein kinase,
           start by similarity
          Length = 746

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 63/135 (46%), Gaps = 20/135 (14%)

Query: 167 RFSIKTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDAN-MVHLIDFGMAKL 225
           RF+         +++  +E LHD+D++YRD+KP+N L+      DAN  + L DFG++K 
Sbjct: 437 RFTEDRAKFYIAELVLALEHLHDNDIVYRDLKPENILL------DANGNIALCDFGLSKA 490

Query: 226 YRDPKTKQHIPYREKKSLSGTARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPWQ 284
               +T          +  GT  Y++    L     ++  D  +LG + F    G   W 
Sbjct: 491 DLKDRT---------NTFCGTTEYLAPELLLDESGYTKMVDFWSLGVLIFEMCCG---WS 538

Query: 285 GLKAANNKLKYEKIG 299
              A +N+  Y+KI 
Sbjct: 539 PFYAEDNQKMYQKIA 553

>ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH]
           complement(333434..337711) [4278 bp, 1425 aa]
          Length = 1425

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 54/220 (24%), Positives = 99/220 (45%), Gaps = 28/220 (12%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRK---------TDAPQ-LKDEYRTYKI 126
           +K+GK +G+GS G +    NM +    AIK  P++         T  P  ++ E    K+
Sbjct: 61  WKLGKTLGKGSSGRVRLAKNMQSGKLAAIKIVPKRNVRHNQKQVTALPYGIEREIIIMKL 120

Query: 127 LSGSEGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSI--KTVVHVAIQMITLI 184
           ++    I   Y   +      LV++ +     +LFD+   R  +  +  +H   Q++  +
Sbjct: 121 ITHP-NIMALYEVWENKSELYLVLEYVEGG--ELFDYLIARGKLPEQEAIHYFKQIVQGV 177

Query: 185 EELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLS 244
              H+ ++ +RD+KP+N L+ + N+     V + DFGMA L            R  ++  
Sbjct: 178 SYCHNFNICHRDLKPENLLLDKKNK----TVKIADFGMAAL--------ETTNRLLETSC 225

Query: 245 GTARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPW 283
           G+  Y S    +G++      D+ + G + F  L G LP+
Sbjct: 226 GSPHYASPEIVMGQKYHGSPSDVWSCGIILFALLTGHLPF 265

>CAGL0K03399g complement(310487..312598) highly similar to sp|P12688
           Saccharomyces cerevisiae YKL126w
           Serine/threonine-protein kinase, start by similarity
          Length = 703

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 54/215 (25%), Positives = 90/215 (41%), Gaps = 24/215 (11%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIK-----FEPRKTDAPQLKDEYRTYKILSGSE 131
           + + K IG+GSFG + +          A+K     +   K++      E      +    
Sbjct: 370 FDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCPF 429

Query: 132 GIPQAYYF-GQEGLHNILVIDLLGPSLEDLFDWCGR--RFSIKTVVHVAIQMITLIEELH 188
            +P  + F  QE L+ +L     G    +LF    R  RF +      A +++  ++ LH
Sbjct: 430 IVPLKFSFQSQEKLYLVLACINGG----ELFYHLQREGRFDLSRSRFYAAELLCALDTLH 485

Query: 189 DHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTAR 248
             D+IYRD+KP+N L+          + L DFG+ KL    + K         +  GT  
Sbjct: 486 KMDVIYRDLKPENILLDYQGH-----IALCDFGLCKLNMKDEDKTD-------TFCGTPE 533

Query: 249 YMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 283
           Y++    LG+  S+  D   LG + +  L G  P+
Sbjct: 534 YLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPY 568

>CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces
           cerevisiae YBR028c, start by similarity
          Length = 542

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 78/160 (48%), Gaps = 16/160 (10%)

Query: 172 TVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKT 231
           TV   A ++   ++ LH   ++YRD+KP+N L+ +    + ++V L DFG++K      +
Sbjct: 271 TVAFYAAEISCALKFLHSKGVVYRDLKPENCLLNQ----NGHLV-LTDFGLSKSSASNAS 325

Query: 232 KQHI-------PYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 284
           ++ +          E  S+ GT  Y +    LG+  +   D  +LG + +  L G+ P+ 
Sbjct: 326 QEDLGAGNEGEDVNELHSIIGTPEYCAPEILLGQPYTANCDWYSLGCLLYDMLTGKPPYT 385

Query: 285 GLKAANNKLKYEKIGEKKRSTNV-YDLSQGLPVQFGRYLE 323
           G   AN+K+   KI   K+   + Y LS G+    G  L+
Sbjct: 386 G---ANHKVIANKIKNDKQGPKIPYYLSDGMKDVLGALLK 422

>Scas_703.5
          Length = 749

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 64/135 (47%), Gaps = 20/135 (14%)

Query: 167 RFSIKTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDAN-MVHLIDFGMAKL 225
           RF+ +       +++  +E LHD+D++YRD+KP+N L+      DAN  + L DFG++K 
Sbjct: 441 RFTEERAKFYIAELVLALEYLHDNDIVYRDLKPENILL------DANGNIALCDFGLSKA 494

Query: 226 YRDPKTKQHIPYREKKSLSGTARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPWQ 284
               +T          +  GT  Y++    L     ++  D  +LG + F    G   W 
Sbjct: 495 DLKDRT---------NTFCGTTEYLAPELLLDEAGYTKMVDFWSLGVLIFEMCCG---WS 542

Query: 285 GLKAANNKLKYEKIG 299
              A +N+  Y+KI 
Sbjct: 543 PFFAEDNQKMYQKIA 557

>CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces
           cerevisiae YOL016c CMK2 Ca2+/calmodulin-dependent
           ser/thr protein kinase, type II, hypothetical start
          Length = 442

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 78/159 (49%), Gaps = 9/159 (5%)

Query: 76  HYKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRK------TDAPQLKDEYRTYKILSG 129
           +Y  GK +G G+FGV+ +      N  VA+K   +K           L DE    ++L  
Sbjct: 44  NYVFGKTLGAGTFGVVRQARYSPTNEDVAVKILLKKALKGNDVQLQMLYDELSILQMLKH 103

Query: 130 SEGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELHD 189
              +    +F  +    I+    +G  L D     G+ F+ +  V + +Q+++ ++ +H 
Sbjct: 104 PNIVEFKDWFESKDKFYIVTQLAVGGELFDRILAKGK-FTERDAVSITMQILSAVDYMHS 162

Query: 190 HDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRD 228
            ++++RD+KP+N L    ++ D + + + DFG+AK  +D
Sbjct: 163 KNVVHRDLKPENVLY--IDKSDDSQLVIADFGIAKQLQD 199

>Kwal_26.7635
          Length = 691

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 52/214 (24%), Positives = 92/214 (42%), Gaps = 22/214 (10%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIK-----FEPRKTDAPQLKDEYRTYKILSGSE 131
           +++ K IG+GSFG + +      N   A+K     +   K++      E      +    
Sbjct: 358 FELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENPF 417

Query: 132 GIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGR--RFSIKTVVHVAIQMITLIEELHD 189
            +P  + F       I++  + G    +LF    R  RFS+        +++  +E LH+
Sbjct: 418 IVPLKFTFQSPDKLYIVLAFING---GELFYHLQREGRFSLSRARLYTAELLCALETLHN 474

Query: 190 HDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARY 249
            D+IYRD+KP+N L+          + L DFG+ KL    + K +       +  GT  Y
Sbjct: 475 LDVIYRDLKPENILLDHQGH-----IALCDFGLCKLNMKGQDKTN-------TFCGTPEY 522

Query: 250 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 283
           ++    LG+  S+  D   LG + +  + G  P+
Sbjct: 523 LAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPY 556

>ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH]
           complement(27643..29778) [2136 bp, 711 aa]
          Length = 711

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 64/135 (47%), Gaps = 20/135 (14%)

Query: 167 RFSIKTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDAN-MVHLIDFGMAKL 225
           RF+ +       +++  +E LHD+D++YRD+KP+N L+      DAN  + L DFG++K 
Sbjct: 401 RFTEERAKFYIAELVLALEYLHDNDIVYRDLKPENILL------DANGNIALCDFGLSKA 454

Query: 226 YRDPKTKQHIPYREKKSLSGTARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPWQ 284
               +T          +  GT  Y++    L     ++  D  +LG + F    G   W 
Sbjct: 455 DLKDRT---------NTFCGTTEYLAPELLLDETGYTKMVDFWSLGVLIFEMCCG---WS 502

Query: 285 GLKAANNKLKYEKIG 299
              A +N+  Y+KI 
Sbjct: 503 PFFAEDNQKMYQKIA 517

>KLLA0B03586g complement(326871..329075) similar to sp|P11792
           Saccharomyces cerevisiae YHR205w SCH9 serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway, start by similarity
          Length = 734

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 64/135 (47%), Gaps = 20/135 (14%)

Query: 167 RFSIKTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDAN-MVHLIDFGMAKL 225
           RF+         +++  +E LHD+D++YRD+KP+N L+      DAN  + L DFG++K 
Sbjct: 422 RFTEDRAKFYIAELVLALEYLHDNDIVYRDLKPENILL------DANGNIALCDFGLSKA 475

Query: 226 YRDPKTKQHIPYREKKSLSGTARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPWQ 284
               +T          +  GT  Y++    +     ++  D  +LG + F    G   W 
Sbjct: 476 DLKDRT---------NTFCGTTEYLAPELLMDETGYTKMVDFWSLGVLIFEMCCG---WS 523

Query: 285 GLKAANNKLKYEKIG 299
              A++N+  Y+KI 
Sbjct: 524 PFFASDNQKMYQKIA 538

>CAGL0G02035g 179911..180930 highly similar to sp|P19454
           Saccharomyces cerevisiae YOR061w CKA2 casein kinase II
           alpha chain, start by similarity
          Length = 339

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 77/159 (48%), Gaps = 22/159 (13%)

Query: 76  HYKIGKKIGEGSFGVLFEGVNMINNVPVAIK-FEPRKTDAPQLKDEYRTYKILSGSEGIP 134
           +Y+I  KIG G +  +F G  + N+ P  IK  +P K     +K  YR  KIL+   G P
Sbjct: 49  NYEIVTKIGRGKYSEVFSGKCITNDQPCVIKVLKPVK-----MKKIYRELKILTNLTGGP 103

Query: 135 QAYYFGQEGLHNIL------VIDLLGPSLEDL-FDWCGRRFSIKTVVHVAIQMITLIEEL 187
                   GL +I+      +  L+   +++  F      F+++ + +   Q++  ++  
Sbjct: 104 NVI-----GLLDIVQDQASKIPALIFEEVKNADFRTLYPSFTLQDLQYYFTQLLIALDYC 158

Query: 188 HDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLY 226
           H   +++RD+KP N +I     P    + LID+G+A+ Y
Sbjct: 159 HSMGIMHRDVKPQNVMI----DPAQKKLRLIDWGLAEFY 193

>YPL203W (TPK2) [5245] chr16 (166255..167397) Catalytic subunit of
           cAMP-dependent protein kinase 2, protein kinase A or PKA
           [1143 bp, 380 aa]
          Length = 380

 Score = 52.8 bits (125), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 62/233 (26%), Positives = 103/233 (44%), Gaps = 28/233 (12%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLK------DEYRTYKILSGS 130
           ++I + +G GSFG +    ++ N    AIK   +K    ++K      DE R  K++   
Sbjct: 70  FQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVL-KKQQVVKMKQVEHTNDERRMLKLVEHP 128

Query: 131 EGIPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELHD 189
             I     F Q+  +  +V+D + G  L  L     +RF        A ++I  +E LH 
Sbjct: 129 FLIRMWGTF-QDARNIFMVMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVILALEYLHA 186

Query: 190 HDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARY 249
           H++IYRD+KP+N L+ R        + + DFG A      K  Q + +    +L GT  Y
Sbjct: 187 HNIIYRDLKPENILLDRNGH-----IKITDFGFA------KEVQTVTW----TLCGTPDY 231

Query: 250 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKYEKIGEKK 302
           ++      +  ++  D  +LG + +  L G  P+           YEKI + K
Sbjct: 232 IAPEVITTKPYNKSVDWWSLGVLIYEMLAGYTPFYDTTPMKT---YEKILQGK 281

>Scas_616.10
          Length = 1461

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 61/128 (47%), Gaps = 15/128 (11%)

Query: 159 DLFDWCGRR--FSIKTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVH 216
           +LFD+   +   S K  VH   Q+I  +   H  ++ +RD+KP+N L+ + N+     + 
Sbjct: 222 ELFDYLVSKGKLSEKEAVHYFKQIIQGVSYCHSFNICHRDLKPENLLLDKKNKS----IK 277

Query: 217 LIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSINTHLGRE-QSRRDDMEALGHVFFY 275
           + DFGMA L         +P +  ++  G+  Y S    +G+       D+ + G + F 
Sbjct: 278 IADFGMAAL--------ELPNKLLQTSCGSPHYASPEIVMGKSYHGGPSDVWSCGIILFA 329

Query: 276 FLRGQLPW 283
            L G LP+
Sbjct: 330 LLTGHLPF 337

>KLLA0F13552g complement(1252906..1256709)
           gi|33386566|emb|CAD87727.1 Kluyveromyces lactis protein
           kinase, start by similarity
          Length = 1267

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 54/218 (24%), Positives = 95/218 (43%), Gaps = 26/218 (11%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRK-TDAPQLKD-------EYRTYKILS 128
           +K+GK +G+GS G +    NM      AIK  P+K   + Q+K        E    K++S
Sbjct: 73  WKLGKTLGKGSSGRVRLAKNMETGKLSAIKIVPKKFVKSNQIKQLPYGIEREIIIMKLIS 132

Query: 129 GSEGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSI--KTVVHVAIQMITLIEE 186
               +   Y   +      LV++ +     +LFD+   +  +     +H   Q++  +  
Sbjct: 133 H-PNVMGLYEVWENKSELYLVLEYVEGG--ELFDYLVSKGKLPESEAIHYFKQIVQAVAY 189

Query: 187 LHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGT 246
            H  ++ +RD+KP+N L+ +  +     + + DFGMA L    K  +        +  G+
Sbjct: 190 CHGFNICHRDLKPENLLLDKKKRS----IKIADFGMAALETSDKLLE--------TSCGS 237

Query: 247 ARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPW 283
             Y S    LGR+      D+ + G + F  L G LP+
Sbjct: 238 PHYASPEIVLGRKYHGSPSDVWSCGIILFALLTGHLPF 275

>Sklu_2429.5 YOL016C, Contig c2429 9000-10298 reverse complement
          Length = 432

 Score = 52.8 bits (125), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 51/215 (23%), Positives = 95/215 (44%), Gaps = 20/215 (9%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRK------TDAPQLKDEYRTYKILSGS 130
           Y  GK +G GSFGV+ +   +     VA+K   +K           L DE    + L+  
Sbjct: 46  YIFGKTLGAGSFGVVRQARKISTGDNVAVKILLKKALKGNDVQLQMLYDELMILQKLNHP 105

Query: 131 EGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRR--FSIKTVVHVAIQMITLIEELH 188
             +    +F  E      ++  L    E LFD   ++  F+    V + +Q++  +E LH
Sbjct: 106 NIVKFKDWF--ESKEKFYIVTQLATGGE-LFDRILQKGKFTEVDAVKIVVQILKAVEYLH 162

Query: 189 DHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTAR 248
             ++++RD+KP+N L    ++ D + + L DFG+AK  ++     H         +G+  
Sbjct: 163 SRNIVHRDLKPENLLY--LDKSDNSQLVLGDFGIAKELKNDGDLIH-------KAAGSMG 213

Query: 249 YMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 283
           Y++          +  D+ ++G + +  L G  P+
Sbjct: 214 YVAPEVLTSNGHGKPCDIWSIGVITYTLLCGYSPF 248

>YKL101W (HSL1) [3161] chr11 (248566..253122) Serine/threonine
           protein kinase that genetically interacts with histone
           mutants and negatively regulates Swe1p protein kinase
           [4557 bp, 1518 aa]
          Length = 1518

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 59/249 (23%), Positives = 104/249 (41%), Gaps = 56/249 (22%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRK------TDAPQLKDEYRTYKILS-- 128
           +K+GK +G+GS G +    NM      AIK  P+K      ++   + + Y +  + S  
Sbjct: 81  WKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVHCSNNGTVPNSYSSSMVTSNV 140

Query: 129 GSEGIP--------QAYYFGQEGLHNILVIDLLGPS------------------LE---- 158
            S  I         Q   +G E    I+++ L+  +                  LE    
Sbjct: 141 SSPSIASREHSNHSQTNPYGIE--REIVIMKLISHTNVMALFEVWENKSELYLVLEYVDG 198

Query: 159 -DLFDWCGRRFSI--KTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMV 215
            +LFD+   +  +  +  +H   Q++  +   H  ++ +RD+KP+N L+ + N+     +
Sbjct: 199 GELFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLLDKKNR----RI 254

Query: 216 HLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSINTHLGRE-QSRRDDMEALGHVFF 274
            + DFGMA L         +P +  K+  G+  Y S    +GR       D+ + G V F
Sbjct: 255 KIADFGMAAL--------ELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLF 306

Query: 275 YFLRGQLPW 283
             L G LP+
Sbjct: 307 ALLTGHLPF 315

>Kwal_33.13846
          Length = 375

 Score = 52.0 bits (123), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 59/228 (25%), Positives = 95/228 (41%), Gaps = 26/228 (11%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKT-----DAPQLKDEYRTYKILSGSE 131
           + I + +G GSFG +    +  N    A+K   ++T           DE R   ++S   
Sbjct: 65  FHILRTLGTGSFGRVHLVRSNHNGRFYAMKVLKKRTIVKLKQVEHTNDERRMLSVVSHPF 124

Query: 132 GIPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELHDH 190
            I     F Q+  H  +++D + G  L  L     +RF        A ++   +E LH  
Sbjct: 125 IIRMWGTF-QDAEHVFMIMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVCLALEYLHAQ 182

Query: 191 DLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYM 250
           D+IYRD+KP+N L+ +        V + DFG AK   D      + Y    +L GT  Y+
Sbjct: 183 DIIYRDLKPENVLLDKNGH-----VKITDFGFAKFVPD------VTY----TLCGTPDYI 227

Query: 251 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKYEKI 298
           +      +  ++  D  + G + F  L G  P+     +N    YE I
Sbjct: 228 APEVVSTKPYNKSVDWWSFGILIFEMLAGYTPFYD---SNTMKTYENI 272

>CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces
           cerevisiae YDL101c DUN1 protein kinase, start by
           similarity
          Length = 506

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 54/232 (23%), Positives = 99/232 (42%), Gaps = 35/232 (15%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIK-FEPRKTDAPQLKDEYRTYKILSGSEGIPQ 135
           Y +GK +G G + ++ E  N      VA+K F P++ D  +   ++R    +      P 
Sbjct: 193 YLLGKDLGSGHYAIVKEAKNKTTGETVAVKIFHPQQNDDQKKNKQFREETTILMKIHHPN 252

Query: 136 AYYF--------GQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAI--QMITLIE 185
                        +  +   LV++ +     +LFD   ++ S+      AI  Q++T ++
Sbjct: 253 IVNLLDSFVEPISKTQIQKYLVLEKIDDG--ELFDRIVKKTSLPQEESKAIFKQILTGLK 310

Query: 186 ELHDHDLIYRDIKPDNFL--IGRPNQPDAN------------MVHLIDFGMAKLYRDPKT 231
            LH  ++I+RDIKP+N L  I R   PD               V + DFG+AK   + + 
Sbjct: 311 YLHSQNIIHRDIKPENILLNIRRRQSPDERQLGPWDEDEIDIQVKIADFGLAKFTGEMQF 370

Query: 232 KQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 283
                     +L GT  Y++    + +  + + D+ + G + +  L G  P+
Sbjct: 371 TN--------TLCGTPSYVAPEVLVKKGYTSKVDLWSAGVILYVCLCGFPPF 414

>KLLA0D08415g 714473..716797 similar to sp|P22211 Saccharomyces
           cerevisiae YNL183c NPR1 ser/thr protein kinase, start by
           similarity
          Length = 774

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 68/139 (48%), Gaps = 10/139 (7%)

Query: 159 DLFDWC-GRRFSIKTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHL 217
           DLF      + S + +     Q++T +E LH   L +RD+K DN +I   NQ    +V L
Sbjct: 508 DLFAIVMSNKMSYEEICCCFKQILTGVEYLHSIGLAHRDMKLDNCVIN--NQ---GIVKL 562

Query: 218 IDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSINTHL-GREQSRRDDMEALGHVFFYF 276
           IDFG A+++  P +K  I   E   + G+  Y++    +  +   R  D+ ++  +F   
Sbjct: 563 IDFGAAEVFSYPHSKTLI---ESSGIVGSDPYLAPEVCIFTKYDPRPVDIWSVAILFACM 619

Query: 277 LRGQLPWQGLKAANNKLKY 295
           +  + PW+  K  +N  K+
Sbjct: 620 VLKKFPWKIPKLKDNSFKF 638

>ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C
           (YPK2) - SH] complement(345955..348123) [2169 bp, 722
           aa]
          Length = 722

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 54/117 (46%), Gaps = 12/117 (10%)

Query: 167 RFSIKTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLY 226
           RF +        +++  +E LH  ++IYRD+KP+N L+          + L DFG+ KL 
Sbjct: 483 RFDLSRARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGH-----IALCDFGLCKLN 537

Query: 227 RDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 283
              + K +       +  GT  Y++    LG+  S+  D   LG + +  L G  P+
Sbjct: 538 MKDQDKTN-------TFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPY 587

>Kwal_56.24091
          Length = 381

 Score = 51.6 bits (122), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 63/131 (48%), Gaps = 16/131 (12%)

Query: 168 FSIKTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYR 227
           F+  T  H   QM   +  +H  ++++RDIKP+N L+G       N + L DFG +    
Sbjct: 218 FNDITASHFVHQMADALNYMHSKNILHRDIKPENILLGF-----QNTLKLTDFGWS---- 268

Query: 228 DPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLK 287
                 ++   ++K+L GT  Y+S      RE   + D+ ALG + +  L G  P++   
Sbjct: 269 ----VSNVGNSKRKTLCGTMDYLSPELIKSREYDNKVDVWALGVLTYELLVGSPPFE--- 321

Query: 288 AANNKLKYEKI 298
               +L Y++I
Sbjct: 322 EDTKELTYKRI 332

>ABL143C [449] [Homologous to ScYNL183C (NPR1) - SH; ScYDL214C
           (PRR2) - SH] (128217..130394) [2178 bp, 725 aa]
          Length = 725

 Score = 52.0 bits (123), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 49/223 (21%), Positives = 98/223 (43%), Gaps = 21/223 (9%)

Query: 76  HYKIGKKIGEGSFGVLFEGVNMINNVPVAIK-FEPRKTDAPQLKDEYRTYKILSGSEGIP 134
           + + G+K+G G+ G +     + +NV  A+K F P+  +  + K +Y         + I 
Sbjct: 389 YSRTGEKLGAGAGGSVKLVRRLKDNVVFAVKEFRPKHEN--ETKRDY--------IKKIT 438

Query: 135 QAYYFGQEGLHNILVIDLLGPSLEDLFDWC-GRRFSIKTVVHVAIQMITLIEELHDHDLI 193
             Y  G    H+ +++ ++     DLF      R S + +     Q++  I  LH   L 
Sbjct: 439 SEYCIGSTLRHSNIILQVMEYCDYDLFAIVMSNRMSYEEICCCLKQILIGIGYLHSLGLA 498

Query: 194 YRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSIN 253
           +RD+K DN ++         +V +IDFG A ++  P +   +   E   + G+  Y++  
Sbjct: 499 HRDLKLDNCVLN-----SQGIVKIIDFGAAVVFTYPHSGTLV---EASGIVGSDPYLAPE 550

Query: 254 THL-GREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKY 295
             +  +   R  D+ +   ++   +  + PW+  K  +N  K+
Sbjct: 551 VCIFSKYDPRPVDIWSAAIIYACMILKKFPWKIPKLKDNSFKF 593

>Kwal_47.16761
          Length = 744

 Score = 52.0 bits (123), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 63/135 (46%), Gaps = 20/135 (14%)

Query: 167 RFSIKTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDAN-MVHLIDFGMAKL 225
           RF+         +++  +E LH++D++YRD+KP+N L+      DAN  + L DFG++K 
Sbjct: 431 RFAEDRARFYIAELVLALEYLHENDIVYRDLKPENILL------DANGNIALCDFGLSKA 484

Query: 226 YRDPKTKQHIPYREKKSLSGTARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPWQ 284
               +T          +  GT  Y++    L     ++  D  +LG + F    G   W 
Sbjct: 485 DLKDRT---------NTFCGTTEYLAPELLLDESGYTKMVDFWSLGVLIFEMCCG---WS 532

Query: 285 GLKAANNKLKYEKIG 299
              A +N+  Y+KI 
Sbjct: 533 PFFAEDNQKMYQKIA 547

>YOL016C (CMK2) [4800] chr15 complement(294777..296120)
           Calcium/calmodulin-dependent serine/threonine protein
           kinase (CaM kinase) type II [1344 bp, 447 aa]
          Length = 447

 Score = 51.6 bits (122), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 55/215 (25%), Positives = 98/215 (45%), Gaps = 18/215 (8%)

Query: 76  HYKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKT---DAPQLKDEYRTYKILSGSEG 132
           +Y  G+ +G GSFGV+ +   +  N  VAIK   +K    +  QL+  Y    IL     
Sbjct: 46  NYIFGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQGNNVQLQMLYEELSILQKLSH 105

Query: 133 IPQAYYFGQ--EGLHNILVIDLLGPSLEDLFDWCGRR--FSIKTVVHVAIQMITLIEELH 188
            P    F    E      ++  L    E LFD    R  F+    V + +Q++  +E +H
Sbjct: 106 -PNIVSFKDWFESKDKFYIVTQLATGGE-LFDRILSRGKFTEVDAVEIIVQILGAVEYMH 163

Query: 189 DHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTAR 248
             ++++RD+KP+N L    ++ + + + + DFG+AK     K ++ + Y+   SL   A 
Sbjct: 164 SKNVVHRDLKPENVLY--VDKSENSPLVIADFGIAKQL---KGEEDLIYKAAGSLGYVAP 218

Query: 249 YMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 283
            +      G+      D+ ++G + +  L G  P+
Sbjct: 219 EVLTQDGHGKPC----DIWSIGVITYTLLCGYSPF 249

>Sklu_2323.3 YPL209C, Contig c2323 5241-6443
          Length = 400

 Score = 51.6 bits (122), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 62/123 (50%), Gaps = 16/123 (13%)

Query: 179 QMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYR 238
           QM   +  +HD ++++RDIKP+N LIG       N + L DFG + +             
Sbjct: 246 QMADALNYMHDRNVLHRDIKPENILIGF-----QNTLKLTDFGWSVI--------STTGA 292

Query: 239 EKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKYEKI 298
           ++K+L GT  Y+S      RE   + D+ ALG + +  L G  P++    A+ +L Y++I
Sbjct: 293 KRKTLCGTLDYLSPELVKYREYDEKVDVWALGVLAYELLVGTPPFE---EASKELTYKRI 349

Query: 299 GEK 301
             +
Sbjct: 350 VRR 352

>Sklu_2430.5 YKL126W, Contig c2430 8144-10345
          Length = 733

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 54/117 (46%), Gaps = 12/117 (10%)

Query: 167 RFSIKTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLY 226
           RF +        +++  +E LH  ++IYRD+KP+N L+          + L DFG+ KL 
Sbjct: 494 RFDLSRARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGH-----IALCDFGLCKLN 548

Query: 227 RDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 283
              + K +       +  GT  Y++    LG+  S+  D   LG + +  L G  P+
Sbjct: 549 MQDQDKTN-------TFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPY 598

>YPL209C (IPL1) [5240] chr16 complement(156489..157592)
           Serine/threonine protein kinase of the mitotic spindle,
           involved in chromosome segregation and activation of the
           spindle checkpoint by detection of kinetochore tension,
           required for proper spindle disassembly and orientation
           [1104 bp, 367 aa]
          Length = 367

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 69/145 (47%), Gaps = 18/145 (12%)

Query: 179 QMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYR 238
           Q+   ++ +H  ++I+RDIKP+N LIG       N++ L DFG + +        + P  
Sbjct: 210 QIANALDYMHKKNIIHRDIKPENILIGF-----NNVIKLTDFGWSII--------NPPEN 256

Query: 239 EKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKYEKI 298
            +K++ GT  Y+S      RE     D  ALG + F  L G  P++          Y++I
Sbjct: 257 RRKTVCGTIDYLSPEMVESREYDHTIDAWALGVLAFELLTGAPPFE---EEMKDTTYKRI 313

Query: 299 G--EKKRSTNVYDLSQGLPVQFGRY 321
              + K  +N+   +Q L ++  +Y
Sbjct: 314 AALDIKMPSNISQDAQDLILKLLKY 338

>YFR014C (CMK1) [1695] chr6 complement(172529..173869)
           Calcium/calmodulin-dependent serine/threonine protein
           kinase (CaM kinase) type I [1341 bp, 446 aa]
          Length = 446

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 85/178 (47%), Gaps = 14/178 (7%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKT---DAPQLKDEYRTYKILSGSEGI 133
           Y  GK +G G+FGV+ +  N      VA+K   +K    +  QL+  Y    IL      
Sbjct: 37  YVFGKTLGAGTFGVVRQAKNTETGEDVAVKILIKKALKGNKVQLEALYDELDILQRLHH- 95

Query: 134 PQAYYFGQ--EGLHNILVIDLLGPSLEDLFDWCGRR--FSIKTVVHVAIQMITLIEELHD 189
           P    F    E      +I  L    E LFD   ++  F+ +  V + +++++ ++ +H 
Sbjct: 96  PNIVAFKDWFESKDKFYIITQLAKGGE-LFDRILKKGKFTEEDAVRILVEILSAVKYMHS 154

Query: 190 HDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTA 247
            ++++RD+KP+N L    ++ D + + + DFG+AK     K+ + + Y+   SL   A
Sbjct: 155 QNIVHRDLKPENLLY--IDKSDESPLVVADFGIAKRL---KSDEELLYKPAGSLGYVA 207

>CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces
           cerevisiae YHR102w NRK1 ser/thr protein kinase, start by
           similarity
          Length = 1072

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/228 (21%), Positives = 98/228 (42%), Gaps = 33/228 (14%)

Query: 73  VGLHYKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLKDEYRTYKILSGSEG 132
           +   +K  + IG G FG++++G ++      AIK     +   +++D  R  + L+  + 
Sbjct: 12  ISSTFKRTEVIGRGKFGIVYKGYHVKTKQVYAIKVLNLDSSEDEVEDVQREIQFLASLKQ 71

Query: 133 IPQ-AYYFGQEGLHNILVIDLLGPSLEDLFDWCG----------RRFSIKTVVHVAIQMI 181
           IP    Y+G           L G SL  + ++C            +   K +  +  +++
Sbjct: 72  IPNITRYYGSY---------LRGTSLWIIMEYCAGGSLRSLLRPGKIDEKYIGVIMRELL 122

Query: 182 TLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKK 241
             ++ +H  ++I+RDIK  N LI    Q     V L DFG+A        +       ++
Sbjct: 123 VALKVIHKDNVIHRDIKAANVLITNEGQ-----VKLCDFGVAAQLNQTSLR-------RQ 170

Query: 242 SLSGTARYMSINTHL-GREQSRRDDMEALGHVFFYFLRGQLPWQGLKA 288
           +++GT  +M+    + G     + D+ +LG   +    G  P+  ++A
Sbjct: 171 TMAGTPYWMAPEVIMEGVYYDTKVDIWSLGITAYEIATGNPPYCDVEA 218

>YPL153C (RAD53) [5294] chr16 complement(261726..264191)
           Serine/threonine/tyrosine protein kinase with a
           checkpoint function in S and G2 phases, contains
           forkhead associated (FHA) domain [2466 bp, 821 aa]
          Length = 821

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 54/238 (22%), Positives = 105/238 (44%), Gaps = 33/238 (13%)

Query: 79  IGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLKDEYRTYKILS--GSEGIPQA 136
           I + +G+G+F  + + +        A+K   ++     +    R  ++L       I + 
Sbjct: 200 IDEVVGQGAFATVKKAIERTTGKTFAVKIISKRKVIGNMDGVTRELEVLQKLNHPRIVRL 259

Query: 137 YYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVV--HVAIQMITLIEELHDHDLIY 194
             F ++     +V++ +  S  DL D+     ++       ++ Q++T I+ +H   + +
Sbjct: 260 KGFYEDTESYYMVMEFV--SGGDLMDFVAAHGAVGEDAGREISRQILTAIKYIHSMGISH 317

Query: 195 RDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSINT 254
           RD+KPDN LI    Q D  +V + DFG+AK+  +            K+  GT  Y++   
Sbjct: 318 RDLKPDNILI---EQDDPVLVKITDFGLAKVQGNGSF--------MKTFCGTLAYVAPEV 366

Query: 255 HLGR-------------EQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKYEKIG 299
             G+             E S   DM ++G + +  L G LP+ G  +  ++L Y++IG
Sbjct: 367 IRGKDTSVSPDEYEERNEYSSLVDMWSMGCLVYVILTGHLPFSG--STQDQL-YKQIG 421

>YOR233W (KIN4) [5024] chr15 (775846..778248) Serine/threonine
           protein kinase related to Kin1p and Kin2p, catalytic
           domain is highly related to Snf1p [2403 bp, 800 aa]
          Length = 800

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 54/221 (24%), Positives = 101/221 (45%), Gaps = 28/221 (12%)

Query: 77  YKIGKKIGEGSFGVLFEG---VNMINNVP--VAIKFEPRKTDAPQLKDEYRTYKILSGSE 131
           Y IG  +GEG FG +  G    +  N VP  VAIK   R T       E + Y+ ++  +
Sbjct: 46  YIIGSTLGEGEFGKVKLGWTKASSSNEVPKQVAIKLIRRDTIKKDADKEIKIYREINALK 105

Query: 132 GI--PQAYYFGQEGLHNILVIDLLGPSLE--DLFDWCGRRFSIK--TVVHVAIQMITLIE 185
            +  P   Y  +E L N   I ++   +   + + +  R+  +K  +   +  Q+I+ + 
Sbjct: 106 HLTHPNIIYL-EEVLQNSKYIGIVLEFVSGGEFYKYIQRKRRLKESSACRLFAQLISGVN 164

Query: 186 ELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMA-KLYRDPKTKQHIPYREKKSLS 244
            +H   L++RD+K +N L+ +      N+V + DFG   + + D +          K+  
Sbjct: 165 YMHYKGLVHRDLKLENLLLDK----HENLV-ITDFGFVNEFFEDNEL--------MKTSC 211

Query: 245 GTARYMSINTHLGRE--QSRRDDMEALGHVFFYFLRGQLPW 283
           G+  Y +    +  +  ++R+ D+ + G + +  L G LPW
Sbjct: 212 GSPCYAAPELVVSTKAYEARKADVWSCGVILYAMLAGYLPW 252

>KLLA0D03190g 267933..269051 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, start by similarity
          Length = 372

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 59/228 (25%), Positives = 94/228 (41%), Gaps = 26/228 (11%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEP-----RKTDAPQLKDEYRTYKILSGSE 131
           ++I + +G GSFG +    ++ N    AIK        R        DE R  K++    
Sbjct: 62  FQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKHQIIRMKQIEHTNDERRMLKLVEHPF 121

Query: 132 GIPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELHDH 190
            I     F Q+  +  +V+D + G  L  L     +RF        A ++   +E LH H
Sbjct: 122 LIRMWGTF-QDSRNLFMVMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVTLALEYLHSH 179

Query: 191 DLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYM 250
           ++IYRD+KP+N L+ R        + + DFG AK                 +L GT  Y+
Sbjct: 180 NIIYRDLKPENILLDRNGH-----IKITDFGFAKEV----------ITVTWTLCGTPDYI 224

Query: 251 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKYEKI 298
           +      +  ++  D  +LG + F  L G  P+  +        YEKI
Sbjct: 225 APEVITTKPYNKSVDWWSLGILIFEMLAGYTPFYDVTPMKT---YEKI 269

>Scas_721.124
          Length = 684

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 54/117 (46%), Gaps = 12/117 (10%)

Query: 167 RFSIKTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLY 226
           RF +      A +++  +E LH+ ++IYRD+KP+N L+          + L DFG+ KL 
Sbjct: 445 RFDLSRSRFYAAELLCALETLHNLNVIYRDLKPENILLDYQGH-----IALCDFGLCKLN 499

Query: 227 RDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 283
                K         +  GT  Y++    LG+  ++  D   LG + +  L G  P+
Sbjct: 500 MKDDDKTD-------TFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPY 549

>Scas_627.7
          Length = 349

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 62/122 (50%), Gaps = 16/122 (13%)

Query: 177 AIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIP 236
             Q+   +  LHD  +I+RD+KP+N LIG       N++ L DFG + +  +P+  +   
Sbjct: 195 VFQIADALNYLHDKQIIHRDLKPENILIGF-----NNVIKLTDFGWSII--NPRGVK--- 244

Query: 237 YREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKYE 296
              +K+L GT  Y+S      RE   + D+ ALG + +  + G  P++       +L Y+
Sbjct: 245 ---RKTLCGTIDYLSPEMIRSREYDDKVDVWALGVLTYELIVGSPPFE---EDTKELTYK 298

Query: 297 KI 298
           +I
Sbjct: 299 RI 300

>Scas_593.14d
          Length = 495

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/154 (28%), Positives = 75/154 (48%), Gaps = 19/154 (12%)

Query: 172 TVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKL-----Y 226
           TV   A ++   ++ LHD  ++YRD+KP+N L+      D   + L DFG++K       
Sbjct: 249 TVAFYAAEISCALKFLHDKGIVYRDLKPENCLLN-----DKGHLVLTDFGLSKKSVTQNS 303

Query: 227 RDPK--TKQHIPYREKKSLS---GTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQL 281
            +P   T  + P  +  +L    GT  Y +     G   ++  D  +LG + +  L G+ 
Sbjct: 304 ANPSEVTSLNEPSEDLSTLHSIIGTPEYCAPEILQGLPYNKNCDWYSLGCLIYDMLSGKP 363

Query: 282 PWQGLKAANNKLKYEKIGEKKRSTNV-YDLSQGL 314
           P+ G   AN+K+   KI + K+   + Y LS+G+
Sbjct: 364 PYTG---ANHKVILNKIQKDKQGPKIPYYLSEGM 394

>CAGL0I05896g 560169..562505 some similarities with sp|P14680
           Saccharomyces cerevisiae YJL141c YAK1 ser/thr protein
           kinase, hypothetical start
          Length = 778

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 84/184 (45%), Gaps = 28/184 (15%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIKF-EPRKTDAPQLKDEYRTYKILSGSEGIPQ 135
           Y +   +G+G+FG + +  N+     +A+K  + R     Q   E +  ++L+       
Sbjct: 361 YLVLDILGQGTFGQVVKCQNLQTKEIIAVKVVKSRSEYLNQSISEAKILELLNEKIDPNN 420

Query: 136 AYYFGQ------EGLHNILVIDLLGPSLEDLFDWCGRRF---SIKTVVHVAIQMITLIEE 186
            ++F +         H  LV +LL  +L +L      +F   SI+ +    IQ++  +  
Sbjct: 421 KHHFLRMHDSFVHKNHLCLVFELLSNNLYELLK--QNKFHGLSIQLIRTFTIQILDSLCV 478

Query: 187 LHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFG-------------MAKLYRDPKTKQ 233
           L D  LI+ D+KP+N L+  P++PD   + +IDFG              ++ YR P+   
Sbjct: 479 LKDSKLIHCDLKPENILLCSPDKPD---LKVIDFGSSCEETRTVYTYIQSRFYRAPEIIL 535

Query: 234 HIPY 237
            IPY
Sbjct: 536 GIPY 539

>AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH]
           complement(274336..275376) [1041 bp, 346 aa]
          Length = 346

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 62/229 (27%), Positives = 100/229 (43%), Gaps = 28/229 (12%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLK------DEYRTYKILSGS 130
           ++I + +G GSFG +    ++ N    AIK   +K    ++K      DE R  K++   
Sbjct: 36  FQIMRTLGTGSFGRVHLVRSIHNGRYYAIKVL-KKQQVIRMKQIEHTNDERRMLKVVEHP 94

Query: 131 EGIPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELHD 189
             I     F Q+  +  +V+D + G  L  L     +RF        A ++   +E LH 
Sbjct: 95  FLIRMWGTF-QDARNLFIVMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVTLALEYLHA 152

Query: 190 HDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARY 249
           H++IYRD+KP+N L+ R        + + DFG AK   D  T          +L GT  Y
Sbjct: 153 HNIIYRDLKPENILLDRNGH-----IKITDFGFAKEV-DTVT---------WTLCGTPDY 197

Query: 250 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKYEKI 298
           ++      +  ++  D  +LG + F  L G  P+  +        YEKI
Sbjct: 198 IAPEVITTKPYNKSIDWWSLGILIFEMLAGYTPFYDVTPIKT---YEKI 243

>YDL214C (PRR2) [660] chr4 complement(74447..76546) Serine/threonine
           protein kinase potentially involved in pheromone
           response [2100 bp, 699 aa]
          Length = 699

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 59/117 (50%), Gaps = 9/117 (7%)

Query: 179 QMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYR 238
           Q+I  ++ LHD  L +RD+K DN ++ R       ++ LIDFG + ++  P + Q I   
Sbjct: 467 QLINGVKYLHDIGLSHRDLKLDNCVVTR-----RGILKLIDFGASSVFHYPLSSQMI--- 518

Query: 239 EKKSLSGTARYMSINTHLGREQSRRD-DMEALGHVFFYFLRGQLPWQGLKAANNKLK 294
           E   + G+  Y+S       E   R  D+ ++G +FF  +  + PW+  K  + + K
Sbjct: 519 EANGIVGSDPYLSPEVFYFNEYDPRALDVWSVGIIFFCMITRRFPWKYPKVKDVQFK 575

>KLLA0F24618g complement(2288943..2290613) similar to sp|P38070
           Saccharomyces cerevisiae YBR028c, start by similarity
          Length = 556

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 67/135 (49%), Gaps = 10/135 (7%)

Query: 172 TVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAK--LYRDP 229
           TV   A ++   ++ LH   ++YRD+KP+N L+      +   + L DFG++K  ++ D 
Sbjct: 282 TVAFYAAELSCALKFLHSKGIVYRDLKPENCLLN-----ERGHLVLTDFGLSKKSVFDDA 336

Query: 230 KTKQHIP-YREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGL-- 286
            T +      +  S+ GT  Y +     G   ++  D  +LG + +  L G+ P+ G+  
Sbjct: 337 ATPEEGENVNQLYSIIGTPEYCAPEILAGEPYTQNCDWYSLGCLVYDMLIGKPPFTGVNH 396

Query: 287 KAANNKLKYEKIGEK 301
           K   NK+K EK G +
Sbjct: 397 KIILNKIKQEKTGAR 411

>ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH]
           (146098..147402) [1305 bp, 434 aa]
          Length = 434

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 52/225 (23%), Positives = 102/225 (45%), Gaps = 43/225 (19%)

Query: 76  HYKIGKKIGEGSFGVLFEGVNMIN-NVPVAIKFEPRKTDAPQ----LKDEYRTYKILSGS 130
           HY++ + +G+GS+G +   ++ +N N P+ I  + + T+  Q    LK   R  K +   
Sbjct: 72  HYEVLQMLGKGSYGTVVSAIDNLNANYPIRIAIK-KITNIFQREVLLKRAIRELKFMH-- 128

Query: 131 EGIPQAYYFGQEGLHNILVIDLLGP-------SLEDLFDWCGRR-------FSIKTVVHV 176
                 Y+ G + + +++ ++++           ++L D+   R       FS   + H 
Sbjct: 129 ------YFKGHKNIVSLINLEIVNEKPYDGLYCYQELIDYDLARVIHSNVQFSEFHIKHF 182

Query: 177 AIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAK----LYRDPKTK 232
             Q++  ++ +H  D+I+RD+KP N L     Q     + + DFG+A+    L+ + KT 
Sbjct: 183 TYQILCGVKYIHSADVIHRDLKPGNILCSISGQ-----LKICDFGLARGISPLFTNTKTS 237

Query: 233 QHIPYREKKSLSGTARYMSINTHLGREQSRRD-DMEALGHVFFYF 276
            HI      +   T  Y +    L  ++  +  DM A+G +   F
Sbjct: 238 NHI-----TNYVATRWYRAPELILSHKRYNKSIDMWAIGCILAEF 277

>Kwal_33.14434
          Length = 759

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 65/138 (47%), Gaps = 10/138 (7%)

Query: 159 DLFDWC-GRRFSIKTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHL 217
           DLF      + S + +     Q++T ++ LH   L +RD+K DN +I +       +V L
Sbjct: 489 DLFAIVMSNKMSYEEICCCFKQILTGVQYLHSMGLAHRDLKLDNCVINK-----HGVVKL 543

Query: 218 IDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSINTHL-GREQSRRDDMEALGHVFFYF 276
           IDFG A ++  P +K  +   E   + G+  Y++    +  +   R  D+ ++  +F   
Sbjct: 544 IDFGAAAVFSYPFSKTLV---ESSGIVGSDPYLAPEVCIFSKYDPRPVDVWSVAIIFACM 600

Query: 277 LRGQLPWQGLKAANNKLK 294
           +  + PW+  K  +N  K
Sbjct: 601 VLKKFPWKIPKLKDNSFK 618

>YBR028C (YBR028C) [220] chr2 complement(294387..295964)
           Serine/threonine protein kinase with similarity to
           Ypk2p/Ykr2p and Ypk1p [1578 bp, 525 aa]
          Length = 525

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/147 (27%), Positives = 72/147 (48%), Gaps = 12/147 (8%)

Query: 172 TVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMA-KLYRDPK 230
           TV   A ++   +  LH   ++YRD+KP+N L+ +        + L DFG++ K   D  
Sbjct: 253 TVSFYAAEISCALRFLHTKGVVYRDLKPENCLLNQRGH-----LVLTDFGLSKKSANDSA 307

Query: 231 TKQHIPYREKK--SLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKA 288
             +  P       S+ GT  Y +    LG+  S+  D  +LG + +  L G+ P+ G   
Sbjct: 308 VDEEDPENVNALYSIIGTPEYCAPEILLGKAYSQNCDWYSLGCLLYDMLVGKPPYTG--- 364

Query: 289 ANNKLKYEKIGEKKRSTNV-YDLSQGL 314
           +N+K+   KI + K+   + + LS+G+
Sbjct: 365 SNHKVIINKIQQNKQGPKIPFYLSEGM 391

>Scas_717.69
          Length = 674

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 53/117 (45%), Gaps = 12/117 (10%)

Query: 167 RFSIKTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLY 226
           RF +        +++  +E LH+ D+IYRD+KP+N L+          + L DFG+ KL 
Sbjct: 439 RFELSRARFYTAELLCALETLHNLDVIYRDLKPENILLDYQGH-----IALCDFGLCKLN 493

Query: 227 RDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 283
              + K         +  GT  Y++    L +  S+  D   LG + +  L G  P+
Sbjct: 494 MKDQDKT-------DTFCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPY 543

>AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH]
            complement(595092..599363) [4272 bp, 1423 aa]
          Length = 1423

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/223 (22%), Positives = 99/223 (44%), Gaps = 27/223 (12%)

Query: 80   GKKIGEGSFGVLFEGVNMINNVPVAIKF----------EPRKTDAPQLKDEYRTYKILSG 129
            G+ IG+GSFG ++ G+N+     +A+K           E    +A  L  E  T K L  
Sbjct: 1127 GEMIGKGSFGAVYLGLNVTTGEMMAVKQVEVPKFGSQDETTVNNAEALISEVSTLKDLDH 1186

Query: 130  SEGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELHD 189
               +    +  +  ++++ +  + G S+  L    G  F  + +  +  Q++  +  LH 
Sbjct: 1187 LNIVQYLGFENKNCIYSLFLEYVAGGSVGSLIRLYG-HFDEQLIRFLTTQVLEGLAYLHL 1245

Query: 190  HDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARY 249
              +++RD+K DN L+      +  +  + DFG++      +   +I    + ++ GT  +
Sbjct: 1246 RGILHRDMKADNLLLD-----NDGVCKISDFGIS------RKSNNIYSNSEMTMRGTVFW 1294

Query: 250  MS---INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAA 289
            M+   ++T  G   S + D+ +LG V      G+ PW  L+  
Sbjct: 1295 MAPEMVDTTQG--YSAKVDIWSLGCVVLEMFAGKRPWSNLEVV 1335

>CAGL0K07458g complement(736336..738450) similar to sp|P12688
           Saccharomyces cerevisiae YKL126w or sp|P18961
           Saccharomyces cerevisiae YMR104c ser/thr-specific
           protein kinases, start by similarity
          Length = 704

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 52/116 (44%), Gaps = 12/116 (10%)

Query: 168 FSIKTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYR 227
           F I      A +++  ++ LH  D++YRD+KP+N L+          + L DFG+ KL  
Sbjct: 472 FDISRARFYASELLLALDSLHKMDVVYRDLKPENILLDSQGH-----IALCDFGLCKLNM 526

Query: 228 DPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 283
               K         +  GT  Y++    LG+  ++  D   LG + +  L G  P+
Sbjct: 527 KDNEKT-------STFCGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPY 575

>YMR104C (YPK2) [4061] chr13 complement(473419..475452)
           Serine/threonine protein kinase with similarity to
           Ypk1p, involved in the cell integrity signaling pathway
           [2034 bp, 677 aa]
          Length = 677

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 59/132 (44%), Gaps = 15/132 (11%)

Query: 167 RFSIKTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLY 226
           RFS+        +++  ++ LH  D+IYRD+KP+N L+          + L DFG+ KL 
Sbjct: 438 RFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGH-----IALCDFGLCKLN 492

Query: 227 RDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGL 286
                K         +  GT  Y++    LG+  ++  D   LG + +  + G  P+   
Sbjct: 493 MKDNDKTD-------TFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYD- 544

Query: 287 KAANNKLKYEKI 298
              N  + Y+KI
Sbjct: 545 --ENVPVMYKKI 554

>YGR052W (YGR052W) [2015] chr7 (593598..594707) Serine/threonine
           protein kinase of unknown function [1110 bp, 369 aa]
          Length = 369

 Score = 49.7 bits (117), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 54/222 (24%), Positives = 91/222 (40%), Gaps = 28/222 (12%)

Query: 81  KKIGEGSFGVLFEGVNMINNVPVAIKFEPR-KTDAPQLKDEYRTYKILSGSE---GIPQA 136
           + I  G+F  +++  +  +N  VA+K  P+ KT    +K+EY   KILS       I   
Sbjct: 6   RSIQSGTFSTVYKAWSTTHNRYVALKITPKYKTSEANMKNEYDVMKILSSCNPHPNICSM 65

Query: 137 YYFGQEGLHNILVIDLLGP-SLEDLFDWCGRRFSIKTVVHVAIQMITLIEEL-------H 188
             F  +  + I+V++      L D  D    + S  +   + I M  +I++L       H
Sbjct: 66  LDFYTDDSYYIMVLEYCECGDLYDFLDIAKSQGSPSSPSLIQIDMQKIIKQLCSAISFAH 125

Query: 189 DHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIP----YREKKSLS 244
              + +RDIKP+N L+          + L D+G A   + PK+         YR  ++ S
Sbjct: 126 SLGIAHRDIKPENILLTINGD-----IKLADWGHA--IQSPKSNDFQIGTDNYRAPETFS 178

Query: 245 GTARYMSINTHLGREQ-----SRRDDMEALGHVFFYFLRGQL 281
           G         +  R       + + D  +LG   FY + G  
Sbjct: 179 GRVSNSCFKKNFDRSSAPLYNTYQADYWSLGATIFYLMFGDC 220

>Scas_660.28
          Length = 623

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 79/161 (49%), Gaps = 18/161 (11%)

Query: 76  HYKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAP-----QLKDEYRTYKILSGS 130
           +Y+I K +GEGSFG +    +M     VA+K   +K  A      +++ E    ++L   
Sbjct: 45  NYQIVKTLGEGSFGKVKLAYHMTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHP 104

Query: 131 EGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRR--FSIKTVVHVAIQMITLIEELH 188
             I + Y   +     I+V++  G    +LFD+  +R   S         Q+I+ +E  H
Sbjct: 105 H-IIKLYDVIKSKDEIIMVMEYAG---NELFDYIVQRDKMSEDEARRFFQQIISAVEYCH 160

Query: 189 DHDLIYRDIKPDNFLIGRPNQPDANM-VHLIDFGMAKLYRD 228
            H +++RD+KP+N L+      D ++ V + DFG++ +  D
Sbjct: 161 RHKIVHRDLKPENLLL------DEHLNVKIADFGLSNIMTD 195

>CAGL0M08910g complement(887703..889541) highly similar to sp|Q00372
           Saccharomyces cerevisiae YDR477w carbon catabolite
           derepressing ser/thr protein kinase, hypothetical start
          Length = 612

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 80/161 (49%), Gaps = 18/161 (11%)

Query: 76  HYKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAP-----QLKDEYRTYKILSGS 130
           +Y+I K +GEGSFG +    ++     VA+K   +K  A      +++ E    ++L   
Sbjct: 38  NYQIVKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHP 97

Query: 131 EGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRR--FSIKTVVHVAIQMITLIEELH 188
             I + Y   +     I+VI+  G    +LFD+  +R   S +       Q+I+ +E  H
Sbjct: 98  H-IIKLYDVIKSKDEIIMVIEYAG---NELFDYIVQRNKMSEQEARRFFQQIISAVEYCH 153

Query: 189 DHDLIYRDIKPDNFLIGRPNQPDANM-VHLIDFGMAKLYRD 228
            H +++RD+KP+N L+      D ++ V + DFG++ +  D
Sbjct: 154 RHKIVHRDLKPENLLL------DEHLNVKIADFGLSNIMTD 188

>CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces
           cerevisiae YPL209c IPL1 ser/thr protein kinase, start by
           similarity
          Length = 358

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 63/124 (50%), Gaps = 16/124 (12%)

Query: 175 HVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQH 234
           H   Q+   +  +H   +I+RD+KP+N LIG       N+V L DFG + L  +P+  + 
Sbjct: 202 HYIYQIADALHYMHKKRIIHRDVKPENVLIGF-----DNVVKLADFGWSIL--NPEGSK- 253

Query: 235 IPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLK 294
                +K+L GT  Y+S      RE   + D+ ALG + +  + G  P++     + +L 
Sbjct: 254 -----RKTLCGTIDYLSPEMITPREYDEQVDVWALGVLAYELVVGVPPFE---ENSKELT 305

Query: 295 YEKI 298
           Y++I
Sbjct: 306 YKRI 309

>CAGL0M08404g complement(836791..838179) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3 or
           sp|P06244 Saccharomyces cerevisiae YJL164c SRA3 or
           sp|P06245 Saccharomyces cerevisiae YPL203w TPK2,
           hypothetical start
          Length = 462

 Score = 49.3 bits (116), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 59/228 (25%), Positives = 95/228 (41%), Gaps = 26/228 (11%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKT-----DAPQLKDEYRTYKILSGSE 131
           ++I + +G GSFG +    +  N    A+K   + T           DE R   I+S   
Sbjct: 152 FQILRTLGTGSFGRVHLIRSNHNGRFYALKALKKHTVVKLKQVEHTNDERRMLSIVSHPF 211

Query: 132 GIPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELHDH 190
            I     F Q+  H  +V+D + G  L  L     +RF        A ++   +E LH  
Sbjct: 212 IIRMWGTF-QDSQHVFMVMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVCLALEYLHSK 269

Query: 191 DLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYM 250
           ++IYRD+KP+N L+ +        + + DFG AK   D      + Y    +L GT  Y+
Sbjct: 270 EIIYRDLKPENILLDKNGH-----IKITDFGFAKYVPD------VTY----TLCGTPDYI 314

Query: 251 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKYEKI 298
           +      +  ++  D  + G + +  L G  P+     AN    YE I
Sbjct: 315 APEVVSTKPYNKSVDWWSFGILIYEMLAGYTPFYD---ANTMKTYEHI 359

>YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine
           protein kinase involved in regulation of cell wall beta
           1,6-glucan levels, interacts with Cdc31p [3243 bp, 1080
           aa]
          Length = 1080

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 51/221 (23%), Positives = 100/221 (45%), Gaps = 19/221 (8%)

Query: 73  VGLHYKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLKDEYRTYKILSGSEG 132
           V   +K  + IG G FGV+++G N+      AIK     +D+ +++D  R  + L+  + 
Sbjct: 19  VSSLFKRTEVIGRGKFGVVYKGYNVKTGRVYAIKVLNLDSDSDEVEDVQREIQFLASLKQ 78

Query: 133 IPQ-AYYFG---QEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELH 188
           I     Y+G   ++    I++    G SL  L      +   K +  +  +++  ++ +H
Sbjct: 79  ISNITRYYGSYLKDTSLWIIMEHCAGGSLRSLLR--PGKIDEKYIGVIMRELLVALKCIH 136

Query: 189 DHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTAR 248
             ++I+RDIK  N LI      +   V L DFG+A        +       +++++GT  
Sbjct: 137 KDNVIHRDIKAANVLIT-----NEGNVKLCDFGVAAQVNQTSLR-------RQTMAGTPY 184

Query: 249 YMSINTHL-GREQSRRDDMEALGHVFFYFLRGQLPWQGLKA 288
           +M+    + G     + D+ +LG   +    G  P+  ++A
Sbjct: 185 WMAPEVIMEGVYYDTKVDIWSLGITTYEIATGNPPYCDVEA 225

>YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine
           protein kinase essential for derepression of
           glucose-repressed genes, acts in concert with Snf4p,
           involved in aging [1902 bp, 633 aa]
          Length = 633

 Score = 49.3 bits (116), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 79/161 (49%), Gaps = 18/161 (11%)

Query: 76  HYKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAP-----QLKDEYRTYKILSGS 130
           +Y+I K +GEGSFG +    +      VA+K   +K  A      +++ E    ++L   
Sbjct: 54  NYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHP 113

Query: 131 EGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRR--FSIKTVVHVAIQMITLIEELH 188
             I + Y   +     I+VI+  G    +LFD+  +R   S +       Q+I+ +E  H
Sbjct: 114 H-IIKLYDVIKSKDEIIMVIEYAG---NELFDYIVQRDKMSEQEARRFFQQIISAVEYCH 169

Query: 189 DHDLIYRDIKPDNFLIGRPNQPDANM-VHLIDFGMAKLYRD 228
            H +++RD+KP+N L+      D ++ V + DFG++ +  D
Sbjct: 170 RHKIVHRDLKPENLLL------DEHLNVKIADFGLSNIMTD 204

>Scas_700.54
          Length = 698

 Score = 49.3 bits (116), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 47/215 (21%), Positives = 95/215 (44%), Gaps = 25/215 (11%)

Query: 83  IGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLKDEYRTYKILSGSE--GIPQAYYFG 140
           +G+G+F  + + V        A+K   ++     ++   R  ++L   +   I +   F 
Sbjct: 229 VGQGAFATVKKAVERSTGKTFAVKIISKRKVMGNMEGVSRELEVLQQLDHPRIVRLKGFY 288

Query: 141 QEGLHNILVIDLLGPSLEDLFDWCGRRFSI--KTVVHVAIQMITLIEELHDHDLIYRDIK 198
           ++     +V++ +     DL D+     ++  +    ++ Q++  ++ +H   + +RD+K
Sbjct: 289 EDKDSYYMVMEFVSGG--DLMDFVAAHGAVGEEAGKEISRQILEAVKYIHSKGISHRDLK 346

Query: 199 PDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSINTHLGR 258
           PDN LI    Q D  +V + DFG+AK+  +            K+  GT  Y++     G+
Sbjct: 347 PDNILI---EQDDPVLVKITDFGLAKVQGNGSF--------MKTFCGTLAYVAPEVIGGK 395

Query: 259 --------EQSRRDDMEALGHVFFYFLRGQLPWQG 285
                   E S   DM ++G + +  L G LP+ G
Sbjct: 396 GETNEERNEYSSLVDMWSMGCLVYVILTGHLPFSG 430

>Scas_711.15
          Length = 727

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 41/72 (56%), Gaps = 14/72 (19%)

Query: 166 RRFSIKTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQ-------------PDA 212
           R FSI ++  +  Q++  I+ +HDH+  +RDIKP+N L+  PN+             PD 
Sbjct: 163 RVFSIPSLKSILAQILAGIKHIHDHNFFHRDIKPENILVS-PNKRYFDKERLELGFYPDN 221

Query: 213 NMVHLIDFGMAK 224
            +V L DFG+A+
Sbjct: 222 YVVKLADFGLAR 233

>CAGL0K04301g 404419..405486 similar to sp|P53233 Saccharomyces
           cerevisiae YGR052w, hypothetical start
          Length = 355

 Score = 48.5 bits (114), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 55/237 (23%), Positives = 97/237 (40%), Gaps = 31/237 (13%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPR-KTDAPQLKDEYRTYKILSGSEGIPQ 135
           YK    I  GSF  +++G N   +  VA+K  P+ K     + +EY   K+LS  EG P 
Sbjct: 8   YKKLNPIQSGSFSTVYKGYNTETDDFVALKVIPKSKFSQRGMANEYNVGKLLSKDEGCPF 67

Query: 136 AY----YFGQEGLHNILVIDLLGPSLEDLFDWCGRR--FSIKTVVHVAIQMITL-----I 184
                 ++  E  + ++          D  +   ++   +  +++ +  Q + L     I
Sbjct: 68  ICSFVDFYEDETNYTLVQEYCECGDFYDFLELSKKKGDLNAPSIIKLNFQKVVLQLSYAI 127

Query: 185 EELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHI---PYREKK 241
           +  H   + +RDIKP+N LI          + L D+G A +        +I    YR  +
Sbjct: 128 KYAHSMGIAHRDIKPENILINYHGD-----IKLADWGHA-ISASSSNDNNIGTDNYRGPE 181

Query: 242 SLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKYEKI 298
           + S    Y   NT+       R D  ++G    Y L    P++     N K+ Y+++
Sbjct: 182 TFSAKVSY---NTY-------RSDYWSMGVTLLYLLFSHCPFRCSNIKNEKIVYKRL 228

>KLLA0F11143g complement(1026129..1028570) similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, start by similarity
          Length = 813

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 58/120 (48%), Gaps = 20/120 (16%)

Query: 175 HVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQH 234
            +  Q++  ++ +HD  + +RD+KPDN +I    Q D  ++ + DFG+AK+         
Sbjct: 292 EITRQVLEAVKYMHDQGISHRDLKPDNIMI---EQDDPVLIKITDFGLAKVQNQNTFLN- 347

Query: 235 IPYREKKSLSGTARYMS---INTHLGREQSRRD------DMEALGHVFFYFLRGQLPWQG 285
                  +  GT  Y++   I+     +++ RD      DM ++G + +  L G LP+ G
Sbjct: 348 -------TFCGTLAYVAPEVIDGKNAEDKTNRDLYSSLVDMWSIGCLVYVILTGHLPFSG 400

>Scas_580.6
          Length = 1015

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 49/228 (21%), Positives = 98/228 (42%), Gaps = 33/228 (14%)

Query: 73  VGLHYKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLKDEYRTYKILSGSEG 132
           V   ++  + IG G FG++++G ++      AIK     +D  +++D  R  + LS  + 
Sbjct: 33  VNSMFRRTEVIGRGKFGIVYKGYHVRTKQIYAIKVLNLDSDEDEVEDVQREVQFLSSLKQ 92

Query: 133 IPQ-AYYFGQEGLHNILVIDLLGPSLEDLFDWCG----------RRFSIKTVVHVAIQMI 181
           IP    Y+G           L   SL  + ++C            +   K +  +  +++
Sbjct: 93  IPNITRYYGSY---------LKDTSLWIIMEYCAGGSLRSLLRPGKIDEKYIGVIMRELL 143

Query: 182 TLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKK 241
             ++ +H  ++I+RDIK  N LI      +   V L DFG+A        +       ++
Sbjct: 144 VALKYIHKDNVIHRDIKAANVLIT-----NEGSVKLCDFGVAAQLNQSTLR-------RQ 191

Query: 242 SLSGTARYMSINTHL-GREQSRRDDMEALGHVFFYFLRGQLPWQGLKA 288
           +++GT  +M+    + G     + D+ +LG   +    G  P+  ++A
Sbjct: 192 TMAGTPYWMAPEVIMEGVYYDTKVDIWSLGITAYEIATGNPPYCEVEA 239

>Kwal_33.13984
          Length = 649

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 87/184 (47%), Gaps = 28/184 (15%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTD-APQLKDEYRTYKILSGSEGIPQ 135
           Y +   +G+G+FG + +  N++    +A+K    K++   Q   E +  ++L+G      
Sbjct: 278 YLVLDILGQGTFGQVVKCQNLLTKEILAVKVVKSKSEYLNQSITEAKILELLNGKIDPQG 337

Query: 136 AYYFGQ--EGL----HNILVIDLLGPSLEDLFDWCGRRF---SIKTVVHVAIQMITLIEE 186
            ++F +  E      H  LV +LL  +L +L      +F   SI  +   A Q++  +  
Sbjct: 338 EHHFLRMHETFVHKNHLCLVFELLSSNLYELLK--QNQFHGLSISLIRTFARQLLDSLCV 395

Query: 187 LHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMA-------------KLYRDPKTKQ 233
           L +H LI+ D+KP+N L+   ++P+   + +IDFG A             + YR P+   
Sbjct: 396 LKEHKLIHCDLKPENILLVSLDRPE---LKVIDFGSACEETRTLYTYIQSRFYRAPEVIL 452

Query: 234 HIPY 237
            IPY
Sbjct: 453 GIPY 456

>KLLA0C04191g 384198..386591 weakly similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15 protein kinase of
           the MAP kinase kinase kinase family, hypothetical start
          Length = 797

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 58/239 (24%), Positives = 97/239 (40%), Gaps = 45/239 (18%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLKDEYRTYKILSG--SEGIP 134
           Y + + IG G++GV++  V    N P AIK +    D  +L +      +L     + I 
Sbjct: 10  YALKQVIGRGAYGVVYRAVKRGTNKPCAIK-QIEFEDESELNEHMLEIDLLKNLRHQNIV 68

Query: 135 QAYYFGQEGLHNILVI----------DLL--GPSLEDLFDWCGRRFSIKTVVHVAIQMIT 182
           +   F Q+  H + +I          D+L  GP LED              V+   Q + 
Sbjct: 69  EYRGFIQKA-HELYIILEYCARGSLRDILKHGPLLED------------DTVNYVTQTLY 115

Query: 183 LIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKS 242
            ++ LH+  +I+RDIK  N L+      +  +V L DFG++              R   +
Sbjct: 116 GLQYLHEQGVIHRDIKAANLLL-----TEEGIVKLADFGVSTRIN----------RMAMT 160

Query: 243 LSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKYEKIGEK 301
            +G+  +M+     G+  S   D+ +LG      L G  P+  L   N    Y  + E+
Sbjct: 161 YAGSPNWMAPEVMTGQGASTVSDIWSLGATVVELLTGNPPFHNL--VNESACYAIVNEE 217

>CAGL0F00649g 71961..73505 similar to sp|P38623 Saccharomyces
           cerevisiae YLR248w RCK2 Ca/calmodulin-dependent or
           sp|P38622 Saccharomyces cerevisiae YGL158w RCK1,
           hypothetical start
          Length = 514

 Score = 48.5 bits (114), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 80/182 (43%), Gaps = 39/182 (21%)

Query: 76  HYKIGKKIGEGSFGVLFEGVNMINNVP----VAIKFEPR---------KTDAPQLKDEYR 122
           +Y+I  KIGEG+F  +F+ V + NN+     VAIK  P+         KT   Q  +E  
Sbjct: 66  NYRIISKIGEGAFSRVFKAVPLHNNLALPKFVAIKVVPKEDFHDHNLKKTSKLQTLNELN 125

Query: 123 TYKILSGSEGIPQA------------YYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSI 170
            +  L+ +  +P              YYF QE +         G     +  +    FS 
Sbjct: 126 IHLKLTKA-NVPNVVKLLEFQVSKKYYYFIQEYIEG-------GEIFNQIVKYT--YFSE 175

Query: 171 KTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPK 230
               HV  Q+ T ++ LH++++I+RDIKP+N +     +P      +  +   +   DPK
Sbjct: 176 DLTRHVIRQVATAVKGLHENNIIHRDIKPENLIF----EPIIKEQTIHRYQKLRKSDDPK 231

Query: 231 TK 232
           TK
Sbjct: 232 TK 233

>Scas_648.17
          Length = 340

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 74/166 (44%), Gaps = 38/166 (22%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIK-FEPRKTDAPQLKDEYRTYKILSGSEGIPQ 135
           Y+I  KIG G +  +F G  + N  P  IK  +P K     +K  YR  KIL+   G P 
Sbjct: 50  YEIITKIGRGKYSEVFSGECVNNETPCVIKVLKPVK-----MKKIYRELKILTNLTGGPN 104

Query: 136 AYYFGQEGLHNILVIDLLG---------PSL--EDLFDWCGRR----FSIKTVVHVAIQM 180
                        VI+LL          P+L  E++ +   R+    F++  +     Q+
Sbjct: 105 -------------VIELLDIVQDPGSKIPALIFEEVKNMDFRQLYPTFTLPDIQFYFTQL 151

Query: 181 ITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLY 226
           +  +   H   +++RD+KP N +I     P    + LID+G+A+ Y
Sbjct: 152 LIALNYCHSMGIMHRDVKPQNVMI----DPKERKLRLIDWGLAEFY 193

>Kwal_26.8796
          Length = 796

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 62/137 (45%), Gaps = 21/137 (15%)

Query: 159 DLFDWCGRRFSIKTVV--HVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVH 216
           DL D+     S+       +  Q++  ++ +H   + +RD+KPDN LI R    D  +V 
Sbjct: 270 DLMDFVAAHGSVGEDAGREITRQILEAVKYIHSMGISHRDLKPDNILIER---DDPVLVK 326

Query: 217 LIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRD--------DMEA 268
           + DFG+AK+  +            K+  GT  Y++     G+    ++        DM +
Sbjct: 327 ITDFGLAKIQGNGTF--------MKTFCGTLAYVAPEVISGKNSGEKEGNTYSSLVDMWS 378

Query: 269 LGHVFFYFLRGQLPWQG 285
           +G + +  L G LP+ G
Sbjct: 379 IGCLVYVILTGHLPFSG 395

>YKL126W (YPK1) [3140] chr11 (205353..207395) Serine/threonine
           protein kinase involved in the cell integrity signaling
           pathway and required for endocytosis, possibly involved
           in a sphingolipid-mediated signaling pathway, has
           similarity to protein kinase C [2043 bp, 680 aa]
          Length = 680

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 51/117 (43%), Gaps = 12/117 (10%)

Query: 167 RFSIKTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLY 226
           RF +        +++  ++ LH  D++YRD+KP+N L+          + L DFG+ KL 
Sbjct: 441 RFDLSRARFYTAELLCALDNLHKLDVVYRDLKPENILLDYQGH-----IALCDFGLCKLN 495

Query: 227 RDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 283
                K         +  GT  Y++    LG   ++  D   LG + +  L G  P+
Sbjct: 496 MKDDDKTD-------TFCGTPEYLAPELLLGLGYTKAVDWWTLGVLLYEMLTGLPPY 545

>KLLA0F01507g 144356..145774 some similarities with sp|P47042
           Saccharomyces cerevisiae YJL057c IKS1 singleton,
           hypothetical start
          Length = 472

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 59/120 (49%), Gaps = 12/120 (10%)

Query: 168 FSIKTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLI----GRPNQPDANMVHLIDFGMA 223
            + + +V +A  + T +++LH   +I+RD+KP N L+     R +        + DFG +
Sbjct: 211 LTTRQIVSIANDIATGLKQLHSLRIIHRDLKPSNCLLLEEFDRSDTDKFPKCVIGDFGES 270

Query: 224 KLYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 283
           +LY           R+    +GT  +++     G + S + D+ A G + ++ + GQLP+
Sbjct: 271 QLYGQ--------LRDATGSTGTVEFVAPELTKGAQFSFKSDIYAFGMILYFVIMGQLPF 322

>Kwal_47.18233
          Length = 598

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 78/160 (48%), Gaps = 18/160 (11%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAP-----QLKDEYRTYKILSGSE 131
           Y+I K +GEGSFG +    ++     VA+K   +K  A      +++ E    ++L    
Sbjct: 31  YQIIKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPH 90

Query: 132 GIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRR--FSIKTVVHVAIQMITLIEELHD 189
            I + Y   +     ++VI+  G    +LFD+  +R   S         Q+I+ +E  H 
Sbjct: 91  -IIKLYDVVKSKDEIVMVIEYAG---NELFDYIVQRDKMSENEARRFFQQIISAVEYCHR 146

Query: 190 HDLIYRDIKPDNFLIGRPNQPDANM-VHLIDFGMAKLYRD 228
           H +++RD+KP+N L+      D ++ V + DFG++ +  D
Sbjct: 147 HKIVHRDLKPENLLL------DEHLNVKIADFGLSNIMTD 180

>Scas_689.25*
          Length = 409

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/214 (24%), Positives = 90/214 (42%), Gaps = 25/214 (11%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKT-----DAPQLKDEYRTYKILSGSE 131
           + I +  G GSFG +    ++ N    A+K   ++T           DE R   + S   
Sbjct: 99  FNILRTSGTGSFGRVHLVRSVHNGRFYALKVLKKQTVVRLKQVEHTNDERRMLSV-SVHA 157

Query: 132 GIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGR--RFSIKTVVHVAIQMITLIEELHD 189
            I + +   Q+  H  +++D +     +LF    R  RF        A ++   ++ LH 
Sbjct: 158 FIVRLWGTFQDSEHLFMIMDYVEGG--ELFSLLRRSQRFPNPVAKFYAAEVCLALDYLHS 215

Query: 190 HDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARY 249
            D+IYRD+KP+N L+ R        + + DFG AK   D      + Y    +L GT  Y
Sbjct: 216 LDIIYRDLKPENLLLDRNGH-----IKVTDFGFAKYVPD------VTY----TLCGTPDY 260

Query: 250 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 283
           ++      +  ++  D  + G + +  L G  P+
Sbjct: 261 IAPEVISAKPYNKSVDWWSFGILIYEMLSGHTPF 294

>KLLA0F02838g 264329..266596 some similarities with sp|P32581
           Saccharomyces cerevisiae YJL106w IME2 ser/thr protein
           kinase, hypothetical start
          Length = 755

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 53/100 (53%), Gaps = 14/100 (14%)

Query: 139 FGQEGLHNI-LVIDLLGPSLEDLFDWCGRR-FSIKTVVHVAIQMITLIEELHDHDLIYRD 196
           F  + L+++ +V++ +  ++  L     RR FS+ T+  +  Q++  I+ +HDHD  +RD
Sbjct: 133 FIDDSLYHLHIVMECMEQNIYQLMKHRKRRVFSLPTLRSILFQILAGIKHIHDHDFFHRD 192

Query: 197 IKPDNFLIG------------RPNQPDANMVHLIDFGMAK 224
           IKP+N LI               N  D  +V L D+G+A+
Sbjct: 193 IKPENILISPSHRYFSKKWLEDDNYSDNYVVKLADYGLAR 232

>KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces
           cerevisiae YOL016c CMK2 Ca2+/calmodulin-dependent
           ser/thr protein kinase, type II, start by similarity
          Length = 427

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/214 (24%), Positives = 93/214 (43%), Gaps = 18/214 (8%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKT---DAPQLKDEYRTYKILSGSEGI 133
           Y  GK +G G+FGV+ +   + +   VA+K   +K     + QL+  Y    IL      
Sbjct: 46  YIFGKTLGAGTFGVVRQARCISSGENVAVKILLKKALKGQSVQLQMLYDELSILQQLNH- 104

Query: 134 PQAYYFGQ--EGLHNILVIDLLGPSLEDLFDWCGRR--FSIKTVVHVAIQMITLIEELHD 189
           P    F    E      ++  L    E LFD    +  F     V +  Q++  ++ LH 
Sbjct: 105 PNIVRFKDWFESKEKFYIVTQLATGGE-LFDRILEKGKFCEVDAVFIVKQILQGVQYLHQ 163

Query: 190 HDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARY 249
            ++++RD+KP+N L    N+ D + + + DFG+AK  +D     H         +G+  Y
Sbjct: 164 RNIVHRDLKPENILY--LNKSDDSPLVIGDFGIAKELKDDNELIH-------KAAGSMGY 214

Query: 250 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 283
           ++          +  D+ ++G + +  L G  P+
Sbjct: 215 VAPEVLTSSGHGKPCDIWSIGVITYTLLCGYSPF 248

>CAGL0C05005g complement(467626..470856) similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15, hypothetical
           start
          Length = 1076

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 59/230 (25%), Positives = 96/230 (41%), Gaps = 40/230 (17%)

Query: 74  GLHYKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLKDEYRTYKILSGSEGI 133
            + Y++ + IG GS+GV+++  N      VAIK E    D  +L D      +L     I
Sbjct: 19  SVQYQLRQIIGRGSYGVVYKATNKKTAQEVAIK-EVNYQDDDELVDIMSEIDLLKNLNHI 77

Query: 134 PQAYYFG-QEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVV--------HVAI----QM 180
               Y G  +  HN+ +I           ++C +  S+K ++        H A     Q 
Sbjct: 78  NIVKYHGFIQKQHNLYII----------LEYCAKG-SLKNLISRNRPMSEHEAKPYVRQT 126

Query: 181 ITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREK 240
           +  +  LH+  +I+RDIK  N L+        N+V L DFG++       TK +      
Sbjct: 127 LNGLNYLHEQGVIHRDIKAANILLD-----SENVVKLADFGVS-------TKVN---NTA 171

Query: 241 KSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAAN 290
            +L+G+  +M+      R  S   D+ +LG      L G  P+  L   N
Sbjct: 172 MTLAGSLNWMAPEIIGNRGASTLSDIWSLGATVVELLTGNPPFHNLIDMN 221

>YOR351C (MEK1) [5128] chr15 complement(995013..996506)
           Serine/threonine protein kinase required for meiotic
           recombination [1494 bp, 497 aa]
          Length = 497

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 55/224 (24%), Positives = 93/224 (41%), Gaps = 30/224 (13%)

Query: 105 IKFEPRKTDAPQLKDEYRTYKILSGSEGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDW- 163
           IK +P K D      E R    L     I   + F     H  +  DL+     DLF + 
Sbjct: 201 IKLKPNKFDK-----EARILLRLDHPNIIKVYHTFCDRNNHLYIFQDLIPGG--DLFSYL 253

Query: 164 ----CGRRFSIKTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLID 219
               C    S    + +  Q++  +  LHD D+++RD+K DN L+  P +P   +V L D
Sbjct: 254 AKGDCLTSMSETESLLIVFQILQALNYLHDQDIVHRDLKLDNILLCTP-EPCTRIV-LAD 311

Query: 220 FGMAKLYRDPKTKQH------------IPYRE-KKSLSGTARYMSINTHLGREQSRRDDM 266
           FG+AK     K + H            + +R  +K+    +R  ++     R    + D+
Sbjct: 312 FGIAKDLNSNKERMHTVVGTPEYCAPEVGFRANRKAYQSFSRAATLEQ---RGYDSKCDL 368

Query: 267 EALGHVFFYFLRGQLPWQGLKAANNKLKYEKIGEKKRSTNVYDL 310
            +LG +    L G  P+ G  +  + ++  KIG+       +D+
Sbjct: 369 WSLGVITHIMLTGISPFYGDGSERSIIQNAKIGKLNFKLKQWDI 412

>YKL166C (TPK3) [3104] chr11 complement(134514..135710) Catalytic
           subunit of cAMP-dependent protein kinase 3, protein
           kinase A or PKA [1197 bp, 398 aa]
          Length = 398

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 94/228 (41%), Gaps = 26/228 (11%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKT-----DAPQLKDEYRTYKILSGSE 131
           ++I + +G GSFG +    +  N    A+K   + T           DE R   I+S   
Sbjct: 88  FQILRTLGTGSFGRVHLIRSNHNGRFYALKTLKKHTIVKLKQVEHTNDERRMLSIVSHPF 147

Query: 132 GIPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELHDH 190
            I     F Q+     +V+D + G  L  L     +RF        A ++   +E LH  
Sbjct: 148 IIRMWGTF-QDSQQVFMVMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVCLALEYLHSK 205

Query: 191 DLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYM 250
           D+IYRD+KP+N L+ +        + + DFG AK   D      + Y    +L GT  Y+
Sbjct: 206 DIIYRDLKPENILLDKNGH-----IKITDFGFAKYVPD------VTY----TLCGTPDYI 250

Query: 251 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKYEKI 298
           +      +  ++  D  + G + +  L G  P+     +N    YE I
Sbjct: 251 APEVVSTKPYNKSVDWWSFGVLIYEMLAGYTPFYN---SNTMKTYENI 295

>AEL083W [2423] [Homologous to ScYBR028C - SH]
           complement(470964..472574) [1611 bp, 536 aa]
          Length = 536

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/147 (27%), Positives = 70/147 (47%), Gaps = 14/147 (9%)

Query: 172 TVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKL----YR 227
           TV   A ++   ++ LH   ++YRD+KP+N L+      D   + L DFG++K       
Sbjct: 265 TVSFYAAEISCALKFLHSKGIVYRDLKPENCLLD-----DKGHLVLTDFGLSKRGVNQAD 319

Query: 228 DPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLK 287
            P   + +   E  S+ GT  Y +     G+  ++  D  +LG + +  L G+ P+ G  
Sbjct: 320 SPLGGEQV--EELYSIIGTPEYCAPEILCGQPYTQNCDWYSLGSLTYDMLIGKPPFTG-- 375

Query: 288 AANNKLKYEKIGEKKRSTNVYDLSQGL 314
            AN+K+   KI + K     + LS G+
Sbjct: 376 -ANHKVILSKIKQDKGIKIPHYLSDGM 401

>YJL141C (YAK1) [2777] chr10 complement(147885..150308)
           Serine/threonine protein kinase, negative regulator of
           cell growth acting in opposition to cAMP-dependent
           protein kinase A [2424 bp, 807 aa]
          Length = 807

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 85/184 (46%), Gaps = 28/184 (15%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTD-APQLKDEYRTYKILSGSEGIPQ 135
           Y +   +G+G+FG + +  N++    +A+K    +T+   Q   E +  ++L+       
Sbjct: 369 YLVLDILGQGTFGQVVKCQNLLTKEILAVKVVKSRTEYLTQSITEAKILELLNQKIDPTN 428

Query: 136 AYYFGQ------EGLHNILVIDLLGPSLEDLFDWCGRRF---SIKTVVHVAIQMITLIEE 186
            ++F +         H  LV +LL  +L +L      +F   SI+ +     Q++  +  
Sbjct: 429 KHHFLRMYDSFVHKNHLCLVFELLSNNLYELLK--QNKFHGLSIQLIRTFTTQILDSLCV 486

Query: 187 LHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFG-------------MAKLYRDPKTKQ 233
           L +  LI+ D+KP+N L+  P++P+   + +IDFG              ++ YR P+   
Sbjct: 487 LKESKLIHCDLKPENILLCAPDKPE---LKIIDFGSSCEEARTVYTYIQSRFYRAPEIIL 543

Query: 234 HIPY 237
            IPY
Sbjct: 544 GIPY 547

>AFR076W [3268] [Homologous to ScYJL106W (IME2) - SH]
           complement(564252..566714) [2463 bp, 820 aa]
          Length = 820

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 84/195 (43%), Gaps = 47/195 (24%)

Query: 77  YKIGKKIGEGSFGVLF--------------EGVNMINNVPVAIKFE-------------P 109
           YK+ +++G GSFG +               EG  M  ++   I+ E              
Sbjct: 38  YKLIQELGNGSFGSVTLAKAQFEISQINGKEGTLMDQSIIPTIREENWNNKNKGLVAIKT 97

Query: 110 RKTDAPQLKDEYRTYKI-----LSGSEGIPQAY-YFGQEGLHNI-LVIDLLGPSLEDLFD 162
             T  P L D  R  +I     +     + Q Y  F  + L+ + +V++ +  ++  L  
Sbjct: 98  MMTRLPTLNDYTRVREIKFILQIPAHAHLVQIYELFIDDSLYQLHIVMECMEQNIYQLMK 157

Query: 163 WCGRR-FSIKTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQ------------ 209
              RR FS+ T+  +  Q+++ I  +H H+  +RDIKP+N LI   N+            
Sbjct: 158 CRKRRVFSLPTLRSILSQILSGIRHIHAHNFYHRDIKPENILISPANRYYSKEWISAGHY 217

Query: 210 PDANMVHLIDFGMAK 224
           PD  +V + D+G+A+
Sbjct: 218 PDNYVVKIADYGLAR 232

>Scas_673.20*
          Length = 758

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/218 (22%), Positives = 90/218 (41%), Gaps = 32/218 (14%)

Query: 76  HYKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLKDEYRTYKILSGSEGIPQ 135
            Y+  K+IGEG+ G+++    +  ++ VAIK    K   P+L+  +    +L   +    
Sbjct: 480 RYRKLKRIGEGASGIVYTAYEIGTDISVAIKQIDLKIQ-PRLQMIWTEMLVLKEYQHPNI 538

Query: 136 AYYFGQEGLHNILVIDLL---GPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEE------ 186
             +     LH+ L I +    G SL D+  +               QM T+  E      
Sbjct: 539 INFINSYLLHDTLWIVMEYMDGGSLADIVSF---------FTPTEEQMATICRETLFGLN 589

Query: 187 -LHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSG 245
            LH   +++RDIK DN L+          + + DFG      +  TK       + ++ G
Sbjct: 590 FLHSRGIVHRDIKSDNILLSMNGD-----IKITDFGFCGQLTESNTK-------RTTMVG 637

Query: 246 TARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 283
           T  +M+      +E   + D+ +LG +    + G+ P+
Sbjct: 638 TPYWMAPEVIASKEYGPKVDVWSLGIMIIEMIEGEPPY 675

>YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic
           subunit of cAMP-dependent protein kinase 1, protein
           kinase A or PKA [1194 bp, 397 aa]
          Length = 397

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 59/134 (44%), Gaps = 18/134 (13%)

Query: 165 GRRFSIKTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAK 224
            +RF        A ++   +E LH  D+IYRD+KP+N L+ +        + + DFG AK
Sbjct: 179 SQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGH-----IKITDFGFAK 233

Query: 225 LYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 284
              D      + Y    +L GT  Y++      +  ++  D  + G + +  L G  P+ 
Sbjct: 234 YVPD------VTY----TLCGTPDYIAPEVVSTKPYNKSIDWWSFGILIYEMLAGYTPFY 283

Query: 285 GLKAANNKLKYEKI 298
               +N    YEKI
Sbjct: 284 D---SNTMKTYEKI 294

>Scas_655.2
          Length = 800

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 64/138 (46%), Gaps = 10/138 (7%)

Query: 159 DLFDWC-GRRFSIKTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHL 217
           DLF      + S + +     Q++T ++ LH   L +RD+K DN +I      +  +V L
Sbjct: 528 DLFAIVMSNKMSYEEICCCFKQILTGVQYLHSIGLAHRDLKLDNCVIN-----EKGIVKL 582

Query: 218 IDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSINTHL-GREQSRRDDMEALGHVFFYF 276
           IDFG A ++  P +K  +   E   + G+  Y++    +  +   R  D+ +   +F   
Sbjct: 583 IDFGAAVVFSYPFSKTLV---EASGIVGSDPYLAPEVCIFSKYDPRPVDIWSTAIIFACM 639

Query: 277 LRGQLPWQGLKAANNKLK 294
           +  + PW+  K  +N  K
Sbjct: 640 ILKKFPWKIPKLRDNSFK 657

>ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH]
           complement(597519..600032) [2514 bp, 837 aa]
          Length = 837

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 63/139 (45%), Gaps = 23/139 (16%)

Query: 159 DLFDWCGRRFSIKTVV--HVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVH 216
           DL D+     S+       +  Q++  +  +H+  + +RD+KPDN LI    Q D  +V 
Sbjct: 299 DLMDFVAAHGSVGEDAGREITRQILEAVRYIHEQGISHRDLKPDNILI---EQDDPVLVK 355

Query: 217 LIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSI----------NTHLGREQSRRDDM 266
           + DFG+AK+ +D  T         K+  GT  Y++           N   G   S   DM
Sbjct: 356 ITDFGLAKI-QDNTTFM-------KTFCGTLAYVAPEVIGGKNPEGNGANGNLYSSLVDM 407

Query: 267 EALGHVFFYFLRGQLPWQG 285
            ++G + +  L G LP+ G
Sbjct: 408 WSIGCLVYVILTGHLPFSG 426

>YNL183C (NPR1) [4417] chr14 complement(293137..295509)
           Serine/threonine protein kinase involved in regulating
           transport systems for nitrogen source nutrients [2373
           bp, 790 aa]
          Length = 790

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 64/138 (46%), Gaps = 10/138 (7%)

Query: 159 DLFDWC-GRRFSIKTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHL 217
           DLF      + S + +     Q++T ++ LH   L +RD+K DN +I      +  +V L
Sbjct: 523 DLFAIVMSNKMSYEEICCCFKQILTGVQYLHSIGLAHRDLKLDNCVIN-----EKGIVKL 577

Query: 218 IDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSINTHL-GREQSRRDDMEALGHVFFYF 276
           IDFG A ++  P +K  +   E   + G+  Y++    +  +   R  D+ +   +F   
Sbjct: 578 IDFGAAVVFSYPFSKNLV---EASGIVGSDPYLAPEVCIFAKYDPRPVDIWSSAIIFACM 634

Query: 277 LRGQLPWQGLKAANNKLK 294
           +  + PW+  K  +N  K
Sbjct: 635 ILKKFPWKIPKLRDNSFK 652

>ACR249C [1296] [Homologous to ScYJL141C (YAK1) - SH]
           (797020..798951) [1932 bp, 643 aa]
          Length = 643

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 86/186 (46%), Gaps = 32/186 (17%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTD-APQLKDEYRTYKILSGSEGIPQ 135
           Y I   +G+G+FG + +  NM     VA+K    KT+   Q   E +  ++L+       
Sbjct: 273 YLILDILGQGTFGQVVKCQNMQTKEIVAVKVVKSKTEYLNQSIMEAKILELLNKRIDPLN 332

Query: 136 AYYFGQEGLHN--------ILVIDLLGPSLEDLFDWCGRRF---SIKTVVHVAIQMITLI 184
            ++F +  LH+         LV +LL  +L +L      +F   S+  + +   Q++  +
Sbjct: 333 QHHFLR--LHDSFVHKNHLCLVFELLSNNLYELLK--QNKFHGLSMNLIKNFCKQLLDSL 388

Query: 185 EELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMA-------------KLYRDPKT 231
             L +  LI+ D+KP+N L+  P++P+   + +IDFG A             + YR P+ 
Sbjct: 389 CVLKESKLIHCDLKPENVLLVSPDRPE---LKVIDFGSACEEARTVYTYIQSRFYRAPEV 445

Query: 232 KQHIPY 237
              IPY
Sbjct: 446 LMGIPY 451

>CAGL0K10604g complement(1029226..1030566) similar to sp|P27466
           Saccharomyces cerevisiae YFR014c CMK1
           Ca2+/calmodulin-dependent ser/thr protein kinase type I,
           hypothetical start
          Length = 446

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/214 (22%), Positives = 97/214 (45%), Gaps = 15/214 (7%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQ-----LKDEYRTYKILSGSE 131
           Y   + +G GSFGV+     + ++  VA+K   ++          + DE    + L    
Sbjct: 65  YLFQRTLGAGSFGVVKRAKQLHSDEDVAVKILLKRALEKNGGLEPIYDELNIIQHLDHPN 124

Query: 132 GIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELHDHD 191
            +    +F  E    I+     G  L D     G+ ++ +  V++ +Q++  +E LH  +
Sbjct: 125 IVKFKDWFETESKFYIVTQLASGGELFDRIMHDGK-YTEEDAVNIVVQILKAVEYLHSQN 183

Query: 192 LIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMS 251
           +I+RD+KP+N L    ++ D+ +V L DFG+A   R  +    + YR     +G+  Y++
Sbjct: 184 IIHRDLKPENLLYLDKSK-DSRIV-LADFGIA---RQLENDDDVIYRP----AGSLGYVA 234

Query: 252 INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQG 285
                     +  D+ ++G + +  L G  P++ 
Sbjct: 235 PEVFTSDGHGKPSDIWSVGVITYTLLCGYSPFKA 268

>CAGL0G09020g 860266..861351 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, hypothetical start
          Length = 361

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 59/229 (25%), Positives = 99/229 (43%), Gaps = 28/229 (12%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLK------DEYRTYKILSGS 130
           + I + +G GSFG +    ++ N    AIK   +K    ++K      DE R  K++   
Sbjct: 51  FHIMRTLGTGSFGRVHLVRSVHNGRYYAIKV-LKKAQVVKMKQIEHTNDERRMLKLVEHP 109

Query: 131 EGIPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELHD 189
             I     F Q+  +  +V+D + G  L  L     +RF        A ++   +E LH 
Sbjct: 110 FLIRMWGTF-QDSRNLFMVMDYIEGGELFTLLR-KSQRFPNPVAKFYAAEVTLALEYLHF 167

Query: 190 HDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARY 249
           H++IYRD+KP+N L+ R        + + DFG A      K  + + +    +L GT  Y
Sbjct: 168 HNIIYRDLKPENILLDRNGH-----IKITDFGFA------KEVETVTW----TLCGTPDY 212

Query: 250 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKYEKI 298
           ++      +  ++  D  +LG + +  L G  P+           YEKI
Sbjct: 213 IAPEVIATKPYNKSVDWWSLGVLIYEMLAGYTPFYDTTPMKT---YEKI 258

>Scas_720.94
          Length = 1683

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 61/237 (25%), Positives = 105/237 (44%), Gaps = 45/237 (18%)

Query: 83   IGEGSFGVLFEGVNMINNVPVA---IKFEPRKTDA---PQLKDEYRTYKILSGSEGIPQA 136
            IG G+FG ++  VN+ N   +A   IK +  KT     P +K+E    ++L+    +   
Sbjct: 1367 IGGGTFGTVYSAVNLDNGEILAVKEIKIQDSKTMKKIFPLVKEEMTVLEMLNHPNIVQ-- 1424

Query: 137  YYFGQEGLH----NILVIDLLGPSLEDLFDWCGRRFSIKTVVHV-AIQMITLIEELHDHD 191
             Y+G E +H    NI +    G S+  L +    R   + V  V  ++++  +  LH   
Sbjct: 1425 -YYGVE-VHRDKVNIFMEYCEGGSMASLLE--HGRIEDEMVTQVYTLELLEGLAYLHQAG 1480

Query: 192  LIYRDIKPDNFLIGRPNQPDAN-MVHLIDFGMA-KLYRDPKTKQHIPYREKK-------- 241
            +++RDIKP+N L+      D N ++  +DFG A K+ ++     +I  + K         
Sbjct: 1481 VVHRDIKPENILL------DFNGIIKYVDFGAARKIAKNGTKVTNINSKSKDDDEPDEKD 1534

Query: 242  ---------SLSGTARYM---SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGL 286
                      + GT  YM   SI  +  + +   DD+ + G V    + G+ PW  L
Sbjct: 1535 TEGGANSVHDMLGTPMYMAPESITGYKNKTKFGSDDIWSFGCVVLEMITGRRPWANL 1591

>CAGL0L06820g 767038..768138 highly similar to sp|P38615
           Saccharomyces cerevisiae YMR139w MDS1
           Serine/threonine-protein kinase, start by similarity
          Length = 366

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 76/162 (46%), Gaps = 18/162 (11%)

Query: 73  VGLHYKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLKD-EYRTYKILSGSE 131
           + + +   + +G GSFGV+F  V    N  VAIK   +     + K+ E    K+L    
Sbjct: 33  ITISFPATEVVGHGSFGVVFTTVIQETNEKVAIK---KVLQDKRFKNRELEIMKMLQHRN 89

Query: 132 GIPQAYYFGQ----EGLHNILVIDLLGPSL-EDLFDWCGRRFSIKTVVHVAIQMITLIEE 186
            I   YYF +    E +   L++D +  SL + L  +  +R  +   + + I M  L + 
Sbjct: 90  IIDLKYYFYEIDEREDVFLNLILDYMPQSLYQRLRHFVHQRTPMPR-LEIKIYMYQLFKA 148

Query: 187 L----HDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAK 224
           L    H  ++ +RDIKP N L+     P++  + L DFG AK
Sbjct: 149 LNYLHHTANVCHRDIKPQNLLVD----PNSWCLRLCDFGSAK 186

>YOR231W (MKK1) [5022] chr15 (772601..774127) Serine/threonine
           protein kinase of the MAP kinase kinase (MEK) family
           involved in cell wall integrity (low-osmolarity) pathway
           [1527 bp, 508 aa]
          Length = 508

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 57/132 (43%), Gaps = 14/132 (10%)

Query: 165 GRRFSIKTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAK 224
           G R S K +  +A  ++  +  LH+  +I+RDIKP N L+    Q     V L DFG++ 
Sbjct: 318 GGRISEKVLGKIAEAVLRGLSYLHEKKVIHRDIKPQNILLNENGQ-----VKLCDFGVSG 372

Query: 225 LYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 284
              +             + +GT+ YM+     G+  S   D+ +LG        G+ P  
Sbjct: 373 EAVNSLA---------TTFTGTSFYMAPERIQGQPYSVTSDVWSLGLTILEVANGKFPCS 423

Query: 285 GLKAANNKLKYE 296
             K A N   +E
Sbjct: 424 SEKMAANIAPFE 435

>ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..27572)
           [1098 bp, 365 aa]
          Length = 365

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 70/160 (43%), Gaps = 19/160 (11%)

Query: 76  HYKIGKKIGEGSFGVLFEGVNMINNVPVAIK-FEP--RKTDAPQLKDEYRTYKILSGSEG 132
           HYK+   IGEG++G++   ++      VAIK  +P  R     +   E +  K     E 
Sbjct: 12  HYKLVDLIGEGAYGIVCSAIHKPTGTKVAIKKIQPFTRPMFVTRTLRELKLLKFFHSHEN 71

Query: 133 I--------PQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAIQMITLI 184
           I        P +Y   Q+     LV +L+   L+ +        S   + +   Q++  +
Sbjct: 72  IISVLDIVRPTSY---QDFEAVYLVQELMETDLQRIISQPNSFLSDDHIQYFTYQILRAL 128

Query: 185 EELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAK 224
           + LH   +I+RD+KP N L+          + L DFG+++
Sbjct: 129 KSLHSAQVIHRDLKPSNLLLNSSCD-----LKLCDFGLSR 163

>Kwal_27.11919
          Length = 209

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 90/207 (43%), Gaps = 24/207 (11%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVA----IKFEPRKTDAPQLKDEYRTYKILS--GS 130
           YK  +K+GEG++GV+++ +++ +   V     I+ E      P      R   +L     
Sbjct: 7   YKRLEKVGEGTYGVVYKALDLRHGQRVVALKKIRLESEDEGVPS--TAIREISLLKELKD 64

Query: 131 EGIPQAYYFGQEGLHNI-LVIDLLGPSLEDLFDWCGRRFSI--KTVVHVAIQMITLIEEL 187
           + I + Y       H + LV + L   L+   +   +   +    +    +Q+   I   
Sbjct: 65  DNIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMEAIPKEQPLGDNIIKKFMMQLCKGIAYC 124

Query: 188 HDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTA 247
           H H +++RD+KP N LI R    D NM  L DFG+A+ +        +P R       T 
Sbjct: 125 HSHRILHRDLKPQNLLINR----DGNM-KLADFGLARAF-------GVPLRAYTHEIVTL 172

Query: 248 RYMSINTHLGREQ-SRRDDMEALGHVF 273
            Y +    LG +Q S   D+ ++G +F
Sbjct: 173 WYRAPEVLLGGKQYSTGVDIWSIGCIF 199

>CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces
           cerevisiae YBR274w CHK1 regulats inhibitory Cdk
           phosphorylation of PDS1, start by similarity
          Length = 528

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 62/230 (26%), Positives = 95/230 (41%), Gaps = 49/230 (21%)

Query: 78  KIGKKIGEGSFGVLFEG-VNMINNVPVAIKFEPRKTDAPQ-LKDEYRTYKILSGSEGIPQ 135
           ++G  IGEGSFG +    +   ++V VA+KF    T A   L  +  + +++  S+    
Sbjct: 15  ELGGTIGEGSFGCVRSARLKFDSSVVVAVKFVHLPTCAESGLSQKDVSREVVLHSKCSKH 74

Query: 136 AYYFGQEGLHNIL-VIDL------LGPSLE-----DLFDWCGRRFSIKTVV--HVAIQMI 181
           A         N+L VID       L   LE     DLFD       +   V      Q+I
Sbjct: 75  A---------NVLRVIDCNVGGEYLWIMLEMADGGDLFDKIEPDVGVDPDVAQFYFQQLI 125

Query: 182 TLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHI------ 235
             +  LHD  + +RDIKP+N L+ +        + L DFG+A  +R       +      
Sbjct: 126 RALNYLHDVGVAHRDIKPENILLDKKGN-----LKLADFGLASQFRRKDGTLRVSTDQRG 180

Query: 236 --PYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 283
             PY   + LS    Y +I            D+ + G + F  L G++PW
Sbjct: 181 SPPYMAPEILSSQGYYANIT-----------DIWSAGVLLFVLLTGEIPW 219

>CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4 ser/thr protein kinase or
           tr|Q03002 Saccharomyces cerevisiae YPL141c, start by
           similarity
          Length = 661

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 52/228 (22%), Positives = 98/228 (42%), Gaps = 37/228 (16%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNV----------PVAIKFEPRKTDAPQLKDEYRTYKI 126
           Y +G  +GEG FG +  G     +            VAIK   R T     + E + Y+ 
Sbjct: 44  YIVGSTLGEGEFGKVKLGWTRTPSTGPEQRPAVSKQVAIKLIRRDTIVKNSEKEIKIYRE 103

Query: 127 LSGSEGIPQAYYFG-QEGLHNILVIDLLGPSLE-----DLFDWCGRRFSIK--TVVHVAI 178
           ++  + +        +E L N   I ++   LE     + + +  R+  +K  T   +  
Sbjct: 104 INALKHLTHPNVVRLEEVLQNSKYIGIV---LEYASGGEFYKYIQRKRRLKESTACRLFA 160

Query: 179 QMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYR 238
           Q+I+ +  +H  +L++RD+K +N L+ +    + N+V + DFG    +        +P  
Sbjct: 161 QLISGVTYMHSKNLVHRDLKLENLLLDK----NENLV-ITDFGFVNEF--------LPDN 207

Query: 239 E-KKSLSGTARYMSINTHLGREQ--SRRDDMEALGHVFFYFLRGQLPW 283
           E  K+  G+  Y +    +      +R+ D+ + G + +  L G LPW
Sbjct: 208 EYMKTSCGSPCYAAPELVISTRPYVARKADVWSCGIILYAMLAGYLPW 255

>Kwal_26.8703
          Length = 444

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 71/162 (43%), Gaps = 21/162 (12%)

Query: 137 YY--FGQEGLHNILVID--LLGPSLEDLFDWC---GRRFSIKTVVHVAIQMITLIEELHD 189
           YY  F +E   +I +    + G SL+ ++      G R   K +  +A  ++  +  L +
Sbjct: 219 YYGMFAEESTSSIYIAMEYMGGKSLDAIYKHLLERGGRIGEKVLGKIAESVLKGLSYLQE 278

Query: 190 HDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARY 249
             +I+RDIKP N L+      +A  V L DFG++ +  +             + +GT+ Y
Sbjct: 279 RKIIHRDIKPQNILLN-----EAGQVKLCDFGVSGVAVN---------SLATTFTGTSFY 324

Query: 250 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANN 291
           M+     G+  S   D+ +LG       +GQ P+     A N
Sbjct: 325 MAPERIQGQPYSVTSDVWSLGLTLLEVAQGQFPFGSDNMAAN 366

>KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235.1
           Kluyveromyces lactis putative kinase, start by
           similarity
          Length = 602

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 79/160 (49%), Gaps = 18/160 (11%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAP-----QLKDEYRTYKILSGSE 131
           Y+I K +GEGSFG +    ++     VA+K   +K  A      +++ E    ++L    
Sbjct: 35  YQIIKTLGEGSFGKVKLAYHISTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPH 94

Query: 132 GIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSI--KTVVHVAIQMITLIEELHD 189
            I + Y   +     I+VI+  G    +LFD+  +R  +  +       Q+I+ ++  H 
Sbjct: 95  -IIKLYDVIKSKDEIIMVIEYAG---NELFDYIVQRDKMPEQEARRFFQQIISAVDYCHR 150

Query: 190 HDLIYRDIKPDNFLIGRPNQPDANM-VHLIDFGMAKLYRD 228
           H +++RD+KP+N L+      D ++ V + DFG++ +  D
Sbjct: 151 HKIVHRDLKPENLLL------DEHLNVKIADFGLSNIMTD 184

>AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH]
           complement(198401..200227) [1827 bp, 608 aa]
          Length = 608

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 78/160 (48%), Gaps = 18/160 (11%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAP-----QLKDEYRTYKILSGSE 131
           Y++ K +GEGSFG +    ++     VA+K   +K  A      +++ E    ++L    
Sbjct: 39  YQVIKTLGEGSFGKVKLAHHVSTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPH 98

Query: 132 GIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRR--FSIKTVVHVAIQMITLIEELHD 189
            I + Y   +     I+VI+  G    +LFD+  +R   S         Q+I+ +E  H 
Sbjct: 99  -IIKLYDVIKSKDEIIMVIEYAG---NELFDYIVQRDKMSENEARRFFQQIISAVEYCHR 154

Query: 190 HDLIYRDIKPDNFLIGRPNQPDANM-VHLIDFGMAKLYRD 228
           H +++RD+KP+N L+      D ++ V + DFG++ +  D
Sbjct: 155 HKIVHRDLKPENLLL------DEHLNVKIADFGLSNIMTD 188

>Sklu_1843.3 YOR231W, Contig c1843 2632-4092 reverse complement
          Length = 486

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 56/127 (44%), Gaps = 14/127 (11%)

Query: 165 GRRFSIKTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAK 224
           G R S K +  +A  ++  +  LH+  +I+RDIKP N L+    Q     V L DFG++ 
Sbjct: 295 GGRISEKVLGKIAESVLRGLSYLHERRIIHRDIKPQNILLNEIGQ-----VKLCDFGVSG 349

Query: 225 LYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 284
              +             + +GT+ YM+     G+  S   D+ +LG       +G  P+ 
Sbjct: 350 EAVNSLA---------TTFTGTSYYMAPERIQGQPYSVTSDVWSLGLTLLEVAQGHFPFN 400

Query: 285 GLKAANN 291
             K A N
Sbjct: 401 SDKMAIN 407

>Scas_690.13
          Length = 354

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 61/233 (26%), Positives = 100/233 (42%), Gaps = 28/233 (12%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLK------DEYRTYKILSGS 130
           +++ + +G GSFG +    ++ N    AIK   +K    ++K      DE R  K++   
Sbjct: 44  FQVMRTLGTGSFGRVHLVRSVHNGRYYAIKVL-KKQQVVRMKQIEHTNDERRMLKLVEHP 102

Query: 131 EGIPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELHD 189
             I     F Q+  +  +V+D + G  L  L     +RF        A ++   +E LH 
Sbjct: 103 FLIRMWGTF-QDSRNLFMVMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVTLGLEYLHS 160

Query: 190 HDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARY 249
           H++IYRD+KP+N L+ R        + + DFG AK   D  T          +L G   Y
Sbjct: 161 HNIIYRDLKPENILLDRNGH-----IKITDFGFAKEV-DTVT---------WTLCGPPDY 205

Query: 250 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKYEKIGEKK 302
           ++      +  ++  D  +LG + F  L G  P+           YEKI + K
Sbjct: 206 IAPEVIATKPYNKSVDWWSLGVLIFEMLAGYTPFYDTTPMKT---YEKILQGK 255

>YNR031C (SSK2) [4613] chr14 complement(680693..685432) MAP kinase
            kinase kinase (MAPKKK) involved in the high-osmolarity
            signal transduction pathway [4740 bp, 1579 aa]
          Length = 1579

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 64/255 (25%), Positives = 109/255 (42%), Gaps = 54/255 (21%)

Query: 73   VGLHYKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDA-------PQLKDEYRTYK 125
            V + ++    IG G+FG ++  V++ N   +A+K E    D+       P +K+E    +
Sbjct: 1262 VSMRWQKRNFIGGGTFGRVYSAVDLDNGEILAVK-EINIQDSKSMQKIFPLIKEEMSVLE 1320

Query: 126  ILSGSEGIPQAYYFGQEGLH----NILVIDLLGPSLEDLFDWCGRRFSIKTVVHV-AIQM 180
            IL+    +    Y+G E +H    NI +    G SL  L +    R   + V  V  +Q+
Sbjct: 1321 ILNHPNIVS---YYGVE-VHRDKVNIFMEYCEGGSLAALLE--HGRIEDEMVTQVYTLQL 1374

Query: 181  ITLIEELHDHDLIYRDIKPDNFLIGRPNQPDAN-MVHLIDFGMAKLYRDPKTK------- 232
            +  +  LH+  +++RD+KP+N L+      D N ++  +DFG AK   +  T+       
Sbjct: 1375 LEGLAYLHESGIVHRDVKPENILL------DFNGVIKYVDFGAAKKIANNGTRLASMNKI 1428

Query: 233  ----------------QHIPYREKKSLS--GTARYM---SINTHLGREQSRRDDMEALGH 271
                            + +   E   L   GT  YM   SI     + +   DD+ +LG 
Sbjct: 1429 ENADGEHEDVTHVSDSKAVKNNENALLDMMGTPMYMAPESITGSTTKGKLGADDVWSLGC 1488

Query: 272  VFFYFLRGQLPWQGL 286
            V    + G+ PW  L
Sbjct: 1489 VVLEMITGRRPWANL 1503

>Scas_698.37
          Length = 347

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 72/158 (45%), Gaps = 22/158 (13%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIK-FEPRKTDAPQLKDEYRTYKILSGSEGIPQ 135
           Y+I  KIG G +  +F G +++N+V   IK  +P K     L+  +R  KIL    G P 
Sbjct: 58  YEIINKIGRGKYSEVFRGKHILNDVSCVIKVLKPVK-----LRKIHRELKILWNLTGGPN 112

Query: 136 AYYFGQEGLHN-------ILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELH 188
                 + +H+        +  D+      +L+      F +  V +   Q++  +   H
Sbjct: 113 IVEL-LDVVHDEKTRVPAFIFEDVKNVDFRELYP----TFKLSDVQYYFKQLLIALNYAH 167

Query: 189 DHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLY 226
              +++RD+KP N +I     P    + LID+G+A+ Y
Sbjct: 168 SMGIMHRDVKPQNVMI----DPVQRKLRLIDWGLAEFY 201

>KLLA0F01276g complement(120001..121560) similar to sp|P38147
           Saccharomyces cerevisiae YBR274w CHK1 regulats
           inhibitory Cdk phosphorylation of PDS1, start by
           similarity
          Length = 519

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 54/230 (23%), Positives = 97/230 (42%), Gaps = 46/230 (20%)

Query: 78  KIGKKIGEGSFGVLFEGVNMIN-NVPVAIKFEPRKTDAPQLKDEYRTYKILSGSEGIPQA 136
           ++G+ IG+GSF  +      ++ +  +A+KF       P  +            +G+ Q 
Sbjct: 16  QLGRTIGKGSFAFVKRASLEVDPSTVIAVKF----IHLPSCE-----------KQGMSQE 60

Query: 137 YYFGQEGLHN-----ILVIDLLGPSLEDLFDWCGRRFS------------IKTVVHVA-- 177
               +  LH+     + V+ ++  +L D F W     +            I     VA  
Sbjct: 61  DVLREVKLHSRCSNFVNVLKVIDCNLSDPFLWIAMELAEGGDLFDKIEPDIGVDSEVAQF 120

Query: 178 --IQMITLIEELHDHD-LIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQH 234
              Q+I  I  LHD   + +RDIKP+N L+ +    D N+  L DFG+A L++     + 
Sbjct: 121 YYKQLIKAISYLHDTCGVAHRDIKPENILLDK----DGNL-KLADFGLASLFKRKDGSKR 175

Query: 235 IPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 284
           I   ++ SL   A  +    +     +   D+ ++G + F  L G+ PW+
Sbjct: 176 ISRDQRGSLPYMAPEI---IYCDGYYADMTDIWSIGVLLFVLLTGETPWE 222

>Scas_651.18
          Length = 371

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 58/134 (43%), Gaps = 18/134 (13%)

Query: 165 GRRFSIKTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAK 224
            +RF        A ++   +E LH  D+IYRD+KP+N L+ +        + + DFG AK
Sbjct: 151 SQRFPNPVAKFYAAEVCLALEYLHSMDIIYRDLKPENILLDKNGH-----IKITDFGFAK 205

Query: 225 LYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 284
              D      I Y    +L GT  Y++      +  ++  D  + G + +  L G  P+ 
Sbjct: 206 YVPD------ITY----TLCGTPDYIAPEVVSTKPYNKSVDWWSFGILIYEMLAGYTPFY 255

Query: 285 GLKAANNKLKYEKI 298
               +N    YE I
Sbjct: 256 D---SNTMKTYENI 266

>Sklu_2392.6 YNL161W, Contig c2392 12867-15293 reverse complement
          Length = 808

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 45/155 (29%), Positives = 69/155 (44%), Gaps = 17/155 (10%)

Query: 77  YKIGKKIGEGSFG----VLFEGVNMINNVPVAIKFEPRKTDAPQLKDEYRTYKILSGSEG 132
           ++  K IG+G+FG    V  +    I  +   +K E  K D  QL        +L+GS+ 
Sbjct: 401 FQTVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKD--QLAHVKAERDVLAGSDS 458

Query: 133 --IPQAYYFGQEGLHNILVIDLL--GPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELH 188
             +   YY  Q+  +  L+++ L  G  +  L  W  + F+         + I  IE +H
Sbjct: 459 PWVVSLYYSFQDAQYLYLIMEFLPGGDLMTMLIRW--QIFTEDVTRFYMAECILAIEAIH 516

Query: 189 DHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMA 223
               I+RDIKPDN LI          V L DFG++
Sbjct: 517 KLGFIHRDIKPDNILIDIRGH-----VKLSDFGLS 546

>Scas_651.3
          Length = 793

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 80/182 (43%), Gaps = 24/182 (13%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIK-FEPRKTDAPQLKDEYRTYKILSGSEGIPQ 135
           Y +   +G+G+FG + +  N+     +A+K  + R     Q   E +  ++++       
Sbjct: 380 YLVLDILGQGTFGQVVKCQNLTTKEILAVKVIKSRSEYLNQSITEAKILELINNKIDPEN 439

Query: 136 AYYFGQ------EGLHNILVIDLLGPSLEDLFDWCGRR-FSIKTVVHVAIQMITLIEELH 188
            ++F +         H  LV +LL  +L +L         SI+ +     QM+  +  L 
Sbjct: 440 KHHFLRMYDSFIHKNHLCLVFELLSNNLYELLKQNQFHGLSIQLIRIFTKQMLESLCVLK 499

Query: 189 DHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFG-------------MAKLYRDPKTKQHI 235
           D  LI+ D+KP+N L+  P++P    + +IDFG              ++ YR P+    I
Sbjct: 500 DSKLIHCDLKPENILLCSPDKP---ALKIIDFGSSCEETRTVYTYIQSRFYRAPEIILGI 556

Query: 236 PY 237
           PY
Sbjct: 557 PY 558

>KLLA0E01584g 149713..150960 highly similar to sp|P39009
           Saccharomyces cerevisiae YDL101c DUN1 protein kinase,
           start by similarity
          Length = 415

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 54/237 (22%), Positives = 101/237 (42%), Gaps = 45/237 (18%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIK-FEPRKTDAPQLKDEYRTYKILSGSEGIPQ 135
           Y  GK++G G + ++ E  N      VA+K F P++ D     D+ RT K    ++ +  
Sbjct: 101 YLAGKELGTGHYAIVKEARNKETGETVAVKIFHPQQND-----DDKRTKKFTEETKILLS 155

Query: 136 AYY-------------FGQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAI--QM 180
             +               +  +   LV++ +     +LF+   R+ +++     A+  Q+
Sbjct: 156 IQHPNIVKLIDRFVEPVSKTQIQTYLVLEKINDG--ELFERIVRKNNLREDETKALFRQL 213

Query: 181 ITLIEELHDHDLIYRDIKPDNFL--IGRPNQPDA------------NMVHLIDFGMAKLY 226
           +  ++ LH  ++I+RDIKP+N L  I +   P+               V + DFG+AK  
Sbjct: 214 LNGLKYLHSRNIIHRDIKPENILLSISKRRSPEEIALGPWDDDELDIQVKIADFGLAKFT 273

Query: 227 RDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 283
            + K           +L GT  Y++    +    + R DM + G + +  L G  P+
Sbjct: 274 GEMKFTN--------TLCGTPSYVAPEVLVKTGYTSRVDMWSAGVLLYVCLCGFPPF 322

>Kwal_55.21709
          Length = 340

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 74/163 (45%), Gaps = 30/163 (18%)

Query: 76  HYKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLKDEYRTYKILSGSEGIPQ 135
           HY+I  KIG G +  +F G  ++N+    IK         +LK  YR  KIL+   G P 
Sbjct: 49  HYEIVNKIGRGKYSEVFRGKCVVNDEYCVIK----VLKPVKLKKIYRELKILTNLTGGPN 104

Query: 136 AYYFGQEGLHNILVIDLLGPS--------LEDL----FDWCGRRFSIKTVVHVAIQMITL 183
                      I ++D++  S         E++    F     +F++  + +   Q++  
Sbjct: 105 V----------IALLDIVQDSGSKIPALIFEEVKNVDFRTLYLKFTLPDIQYYFSQLLIA 154

Query: 184 IEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLY 226
           ++  H   +++RD+KP N +I     P    + LID+G+A+ Y
Sbjct: 155 LDYCHSMGIMHRDVKPQNVMI----DPVERKLRLIDWGLAEFY 193

>KLLA0C03828g 349187..351568 similar to sp|P54199 Saccharomyces
           cerevisiae YDL028c MPS1 serine/threonine/tyrosine
           protein kinase, hypothetical start
          Length = 793

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 59/127 (46%), Gaps = 24/127 (18%)

Query: 179 QMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYR 238
           +MI  ++ +HD D+++ D+KP NF+  +       M+ +IDFG+A    D     H    
Sbjct: 578 EMIKCVKVVHDADIVHSDLKPANFVFVK------GMLKIIDFGIANAVPD-----HTVNI 626

Query: 239 EKKSLSGTARYMSINTHLGREQSRRD------------DMEALGHVFFYFLRGQLPWQGL 286
            + +  GT  YM+  T +    +R D            D+ + G + +  + G+ P+ G 
Sbjct: 627 YRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPY-GT 685

Query: 287 KAANNKL 293
              NN+L
Sbjct: 686 FQGNNRL 692

>YMR139W (RIM11) [4096] chr13 (546124..547236) Member of the GSK3
           subfamily of protein kinases, required for induction of
           IME2 by Ime1p [1113 bp, 370 aa]
          Length = 370

 Score = 45.4 bits (106), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 73/161 (45%), Gaps = 16/161 (9%)

Query: 73  VGLHYKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLKD-EYRTYKILSGSE 131
           V + +   + +G GSFGV+F  V    N  VAIK   +     + K+ E    K+LS   
Sbjct: 35  VQISFPTTEVVGHGSFGVVFATVIQETNEKVAIK---KVLQDKRFKNRELEIMKMLSHIN 91

Query: 132 GIPQAYYF----GQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEEL 187
            I   Y+F     Q+ ++  L+++ +  SL         + +  + + +   M  L + L
Sbjct: 92  IIDLKYFFYERDSQDEIYLNLILEYMPQSLYQRLRHFVHQRTPMSRLEIKYYMFQLFKSL 151

Query: 188 ----HDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAK 224
               H  ++ +RDIKP N L+     P+   + L DFG AK
Sbjct: 152 NYLHHFANVCHRDIKPQNLLVD----PETWSLKLCDFGSAK 188

>KLLA0A05819g 541545..543659 similar to sp|P14680 Saccharomyces
           cerevisiae YJL141c YAK1 ser/thr protein kinase, start by
           similarity
          Length = 704

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 85/184 (46%), Gaps = 28/184 (15%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTD-APQLKDEYRTYKILSGSEGIPQ 135
           Y +   +G+G+FG + +  N+I    +A+K    K++   Q   E +  ++L+       
Sbjct: 332 YLVLDLLGQGTFGQVVKCQNLITKEILAVKVVKSKSEYLNQSVTEAKVLELLNRQIDPNN 391

Query: 136 AYYFGQ------EGLHNILVIDLLGPSLEDLF---DWCGRRFSIKTVVHVAIQMITLIEE 186
            ++F +         H  LV +LL  +L +L    ++ G   S+  +   + Q++  +  
Sbjct: 392 EHHFLRLHDTFVHKHHLCLVFELLSNNLYELLKLNEFHG--LSMTLIKTFSKQLLDSLCV 449

Query: 187 LHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMA-------------KLYRDPKTKQ 233
           L D  LI+ D+KP+N L+   ++PD   + +IDFG A             + YR P+   
Sbjct: 450 LKDSKLIHCDLKPENILLVSNDRPD---LKVIDFGSACEETRTIYTYIQSRFYRAPEVLL 506

Query: 234 HIPY 237
            IPY
Sbjct: 507 GIPY 510

>AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C
           (TPK1) - SH] (405062..406222) [1161 bp, 386 aa]
          Length = 386

 Score = 45.4 bits (106), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 53/119 (44%), Gaps = 15/119 (12%)

Query: 165 GRRFSIKTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAK 224
            +RF        A ++   +E LH  D+IYRD+KP+N L+ +        + L DFG AK
Sbjct: 168 SQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGH-----IKLTDFGFAK 222

Query: 225 LYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 283
              D      + Y    +L GT  Y++      +  ++  D  + G + +  L G  P+
Sbjct: 223 YVPD------VTY----TLCGTPDYIAPEVVSTKPYNKSVDWWSFGILIYEMLAGYTPF 271

>Kwal_0.155
          Length = 587

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 60/260 (23%), Positives = 98/260 (37%), Gaps = 64/260 (24%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVP---------VAIKFEPRK-------------TDA 114
           YK+  KIGEG+F  ++ GV   ++           VA+K   +K             T  
Sbjct: 157 YKLIAKIGEGAFSKVYRGVPQEHSSKSFLSRAFKQVAVKVISKKHLSSTHKDAKSKATSR 216

Query: 115 PQLKDEYRTYKILSGSEGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGR--RFSIKT 172
            Q+  E   ++ +S SE +     F +   +  +V +LL     ++F    R   FS   
Sbjct: 217 EQVLKEVAIHRTVSASENVVSFVDFQESHNYYFIVQELLAGG--EIFGEIVRLTYFSEDL 274

Query: 173 VVHVAIQMITLIEELHDHDLIYRDIKPDNFL-------------IGRPNQPDAN------ 213
             HV  Q+   ++ +H   +++RDIKP+N L             + + + P A       
Sbjct: 275 SRHVIRQLALAVKHMHAMGIVHRDIKPENLLFEHVDYEPSPSPVLRKSDDPKAKQDEGIF 334

Query: 214 ----------MVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRR 263
                      V L DFG++K          I     K+  GT  Y +         S +
Sbjct: 335 RPGIGGGGIGTVKLADFGLSK---------QIYSTNTKTPCGTVGYTAPEVVKDERYSMQ 385

Query: 264 DDMEALGHVFFYFLRGQLPW 283
            DM  +G V +  L G  P+
Sbjct: 386 VDMWGIGCVLYTVLCGFPPF 405

>Kwal_26.8709
          Length = 829

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 55/226 (24%), Positives = 99/226 (43%), Gaps = 37/226 (16%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINN----VP--VAIKFEPRKTDAPQLKDEYRTYKILSGS 130
           Y +G  +GEG FG +  G +  +N    VP  VAIK   R T     + E + Y+ ++  
Sbjct: 40  YIVGSTLGEGEFGKVKLGWSKTSNSSMDVPKQVAIKLIRRDTIPKNSEKEIKIYREINAL 99

Query: 131 EGI--PQAYYFGQEGLHNILVIDLLGPSLE-----DLFDWCGRRFSIKT--VVHVAIQMI 181
           + +  P      +E L N   I ++   LE     + + +  ++  +K      +  Q+I
Sbjct: 100 KHLNHPNIVRL-EEVLQNSKYIGIV---LEYASGGEFYKYIQKKRRLKEGPACRLFAQLI 155

Query: 182 TLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDP----KTKQHIPY 237
           + +  +H   L++RD+K +N L+ +    + N++ + DFG    +       KT    P 
Sbjct: 156 SGVYYMHSKGLVHRDLKLENLLLDK----NENLL-ITDFGFVNEFLPENELMKTSCGSPC 210

Query: 238 REKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 283
                L  TAR           ++R+ D+ + G + +  L G LPW
Sbjct: 211 YAAPELVVTARPY---------EARKADVWSCGVILYAMLAGYLPW 247

>KLLA0B09790g complement(855327..856214) highly similar to sp|P00546
           Saccharomyces cerevisiae YBR160w CDC28 cyclin-dependent
           protein kinase, start by similarity
          Length = 295

 Score = 45.1 bits (105), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 53/206 (25%), Positives = 89/206 (43%), Gaps = 20/206 (9%)

Query: 76  HYKIGKKIGEGSFGVLFEGVNMI--NNVPVAIKFEPRKTDAPQLKDEYRTYKILS--GSE 131
           +YK  +K+GEG++GV+++ V++   N V    K      D        R   +L     +
Sbjct: 6   NYKRLEKVGEGTYGVVYKAVDLRHQNRVVAMKKIRLESEDEGVPSTAIREISLLKELKDD 65

Query: 132 GIPQAYYFGQEGLHNI-LVIDLLGPSLEDLFDWCGRRFSI--KTVVHVAIQMITLIEELH 188
            I + Y       H + LV + L   L+   +   +   +    +    +Q+   I   H
Sbjct: 66  NIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMESIPKDQPLGGNIIKKFMMQLCKGIAYCH 125

Query: 189 DHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTAR 248
            H +I+RD+KP N LI R    D N+  L DFG+A+ +        +P R       T  
Sbjct: 126 AHRIIHRDLKPQNLLINR----DGNL-KLGDFGLARAF-------GVPLRAYTHEIVTLW 173

Query: 249 YMSINTHLGREQ-SRRDDMEALGHVF 273
           Y +    LG +Q S   D+ ++G +F
Sbjct: 174 YRAPEVLLGGKQYSTGVDVWSIGCIF 199

>YNL161W (CBK1) [4436] chr14 (332597..334867) Serine/threonine
           protein kinase required for sporulation and production
           of daughter specific proteins [2271 bp, 756 aa]
          Length = 756

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 67/151 (44%), Gaps = 17/151 (11%)

Query: 81  KKIGEGSFG----VLFEGVNMINNVPVAIKFEPRKTDAPQLKDEYRTYKILSGSEG--IP 134
           K IG+G+FG    V  +    I  +   +K E  K D  QL        +L+GS+   + 
Sbjct: 356 KVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKD--QLAHVKAERDVLAGSDSPWVV 413

Query: 135 QAYYFGQEGLHNILVIDLL--GPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELHDHDL 192
             YY  Q+  +  L+++ L  G  +  L  W  + F+         + I  IE +H    
Sbjct: 414 SLYYSFQDAQYLYLIMEFLPGGDLMTMLIRW--QLFTEDVTRFYMAECILAIETIHKLGF 471

Query: 193 IYRDIKPDNFLIGRPNQPDANMVHLIDFGMA 223
           I+RDIKPDN LI          + L DFG++
Sbjct: 472 IHRDIKPDNILIDIRGH-----IKLSDFGLS 497

>CAGL0M02233g complement(267332..269635) highly similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, hypothetical start
          Length = 767

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 62/138 (44%), Gaps = 28/138 (20%)

Query: 175 HVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQH 234
            ++ Q++  I+ +H   + +RD+KPDN LI    Q D  +V + DFG+AK+  +      
Sbjct: 288 EISRQILEAIQYIHSKGISHRDLKPDNILI---EQDDPVLVKITDFGLAKVQGNGSI--- 341

Query: 235 IPYREKKSLSGTARYMSINTHLG--------------REQSRRDDMEALGHVFFYFLRGQ 280
                 K+  GT  Y++     G               E S   DM ++G + F  L G 
Sbjct: 342 -----MKTFCGTLAYVAPEVIGGFTGATGEEETEEERIEYSSLVDMWSMGCLVFVILTGH 396

Query: 281 LPWQGLKAANNKLKYEKI 298
           LP+ G   +  +  YE+I
Sbjct: 397 LPFSG---STQEQLYEQI 411

>Sklu_2104.1 YBR160W, Contig c2104 694-1593
          Length = 299

 Score = 44.7 bits (104), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 54/207 (26%), Positives = 93/207 (44%), Gaps = 24/207 (11%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMIN-NVPVA---IKFEPRKTDAPQLKDEYRTYKILSG--S 130
           YK  +K+GEG++GV+++ +++ + N  VA   I+ E      P      R   +L     
Sbjct: 7   YKRLEKVGEGTYGVVYKALDLRHGNRIVALKKIRLESEDEGVPS--TAIREISLLKELRD 64

Query: 131 EGIPQAYYFGQEGLHNI-LVIDLLGPSLEDLFDWCGRRFSI--KTVVHVAIQMITLIEEL 187
           + I + Y       H + LV + L   L+   +   +   +  K +    +Q+   I   
Sbjct: 65  DNIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMESVPKEQPLGNKIIKKFMMQLCKGIAYC 124

Query: 188 HDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTA 247
           H H +++RD+KP N LI R    D N+  L DFG+A+ +        +P R       T 
Sbjct: 125 HAHRILHRDLKPQNLLINR----DGNL-KLGDFGLARAF-------GVPLRAYTHEIVTL 172

Query: 248 RYMSINTHLGREQ-SRRDDMEALGHVF 273
            Y +    LG +Q S   D+ ++G +F
Sbjct: 173 WYRAPEVLLGGKQYSTGVDIWSIGCIF 199

>AFR035W [3227] [Homologous to ScYNL161W (CBK1) - SH]
           complement(498529..500688) [2160 bp, 719 aa]
          Length = 719

 Score = 45.4 bits (106), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 67/151 (44%), Gaps = 17/151 (11%)

Query: 81  KKIGEGSFG----VLFEGVNMINNVPVAIKFEPRKTDAPQLKDEYRTYKILSGSEG--IP 134
           K IG+G+FG    V  +    I  +   +K E  K D  QL        +L+GS+   + 
Sbjct: 314 KVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKD--QLAHVKAERDVLAGSDSPWVV 371

Query: 135 QAYYFGQEGLHNILVIDLL--GPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELHDHDL 192
             YY  Q+  +  L+++ L  G  +  L  W  + F+         + I  IE +H    
Sbjct: 372 SLYYSFQDAQYLYLIMEFLPGGDLMTMLIRW--QIFTEDVTRFYMAECILAIEAIHKLGF 429

Query: 193 IYRDIKPDNFLIGRPNQPDANMVHLIDFGMA 223
           I+RDIKPDN LI          + L DFG++
Sbjct: 430 IHRDIKPDNILIDIRGH-----IKLSDFGLS 455

>CAGL0G04455g 426386..428641 similar to sp|P32581 Saccharomyces
           cerevisiae YJL106w IME2 ser/thr protein kinase,
           hypothetical start
          Length = 751

 Score = 45.4 bits (106), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 38/71 (53%), Gaps = 12/71 (16%)

Query: 166 RRFSIKTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIG------------RPNQPDAN 213
           R FSI ++  +  Q++  +  +HD +  +RD+KP+N LI             + N PD  
Sbjct: 177 RVFSIPSLKSILAQVLAGLRHIHDQNFFHRDLKPENILITPSTRYFDSSWLEKGNYPDNY 236

Query: 214 MVHLIDFGMAK 224
           +V L DFG+A+
Sbjct: 237 VVKLADFGLAR 247

>YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase,
           required for metaphase DNA-damage checkpoint [1584 bp,
           527 aa]
          Length = 527

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 55/109 (50%), Gaps = 12/109 (11%)

Query: 179 QMITLIEELH-DHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPY 237
           Q+++ I  LH +  + +RDIKP+N L+ +    + N+  L DFG+A  +R       +  
Sbjct: 124 QLVSAINYLHVECGVAHRDIKPENILLDK----NGNL-KLADFGLASQFRRKDGTLRVSM 178

Query: 238 REKKSLSGTARYMSINTHLGRE--QSRRDDMEALGHVFFYFLRGQLPWQ 284
            ++    G+  YM+       E   + R D+ ++G + F  L GQ PW+
Sbjct: 179 DQR----GSPPYMAPEVLYSEEGYYADRTDIWSIGILLFVLLTGQTPWE 223

>KLLA0F22297g complement(2083448..2085547) some similarities with
           sp|P32350 Saccharomyces cerevisiae YLL019c KNS1 ser/thr
           protein kinase, hypothetical start
          Length = 699

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 61/130 (46%), Gaps = 9/130 (6%)

Query: 83  IGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQ--LKDEYRTYKIL-----SGSEGIPQ 135
           +G+G+FG + +  + +N++ VA+K   R  D  +   K E R  + +     SG      
Sbjct: 295 LGQGTFGKVVKCKDYLNDITVAVKI-IRAVDRYRQAAKTELRVLQTIKENDRSGQYQCLL 353

Query: 136 AYYFGQEGLHNILVIDLLGPSLEDLFDWCG-RRFSIKTVVHVAIQMITLIEELHDHDLIY 194
              F     H  LV DL G S+ D     G  RF    V  +  Q++  +  LHD  +I+
Sbjct: 354 LREFFDYKNHICLVTDLYGRSVYDFMTNNGYARFPGSHVQAIGKQLVRSVCFLHDLGIIH 413

Query: 195 RDIKPDNFLI 204
            D+KP+N LI
Sbjct: 414 TDLKPENILI 423

>YPL141C (YPL141C) [5305] chr16 complement(283463..286060)
           Serine/threonine protein kinase with similarity to Kin4p
           [2598 bp, 865 aa]
          Length = 865

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 52/230 (22%), Positives = 97/230 (42%), Gaps = 41/230 (17%)

Query: 77  YKIGKKIGEGSFGVLFEG--------VNMINNVP--VAIKFEPRKTDAPQLKDEYRTYKI 126
           Y +G  +GEG FG +  G         N   + P  VAIK   R + +   + E + Y+ 
Sbjct: 41  YILGSTLGEGEFGKVKLGWPKNFSNSSNSTFDFPKQVAIKLIKRDSISNDYRKEVKIYRE 100

Query: 127 LSGSEGIPQAYYFG-QEGLHNILVIDLLGPSLEDLFDWCG----------RRFSIKTVVH 175
           ++  + +        +E L N   I ++      L   CG          RR        
Sbjct: 101 INALKHLSHPNIVKLEEVLQNSRYIGIV------LEYACGGEFYKYIQKKRRLKEMNACR 154

Query: 176 VAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHI 235
           +  Q+I+ +  +H   L++RD+K +N L+ +    + N+V + DFG    +    ++  +
Sbjct: 155 LFSQLISGVHYIHSKGLVHRDLKLENLLLDK----NENLV-ITDFGFVNEF---CSRNEL 206

Query: 236 PYREKKSLSGTARYMSINTHLGRE--QSRRDDMEALGHVFFYFLRGQLPW 283
                K+  G+  Y +    +  E  ++R+ D+ + G + +  L G LPW
Sbjct: 207 ----MKTSCGSPCYAAPELVISAEPYEARKADIWSCGVILYAILAGYLPW 252

>ADL283W [1458] [Homologous to ScYDL108W (KIN28) - SH]
           complement(205175..205199,205252..206147) [921 bp, 306
           aa]
          Length = 306

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 74/167 (44%), Gaps = 20/167 (11%)

Query: 72  IVGLHYKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLKD--------EYRT 123
           +  ++Y   KK+GEG++ V++ G    +   +AIK    +    Q KD        E + 
Sbjct: 1   MTAVNYTKEKKVGEGTYAVVYLGHRQTDGRQIAIK----EIKTSQFKDGLDMSAIREVKY 56

Query: 124 YKILSGSEGIPQA-YYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAIQMIT 182
            + +  +  I     +  QE L+  LV++ L   LE L       F+   +    +  + 
Sbjct: 57  LQEIRHANVIELVDLFMAQENLN--LVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLR 114

Query: 183 LIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDP 229
            +   H   +++RD+KP+N L+     PD  +  + DFG+A+    P
Sbjct: 115 GVHHCHRSFILHRDLKPNNLLLA----PDGQL-KIADFGLARTLAAP 156

>Kwal_23.5290
          Length = 819

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 52/111 (46%), Gaps = 12/111 (10%)

Query: 173 VVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTK 232
           + ++  +    ++ LHD  +I+RDIK DN L+      +   V + DFG      D ++K
Sbjct: 647 IAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLD-----NRARVKITDFGFCAKLTDKRSK 701

Query: 233 QHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 283
                  + ++ GT  +M+      RE   + D+ +LG +    L G+ P+
Sbjct: 702 -------RATMVGTPYWMAPEVVKQREYDEKVDVWSLGIMTIEMLEGEPPY 745

>YLR113W (HOG1) [3526] chr12 (371621..372928) MAP kinase (MAPK),
           principal component of the high-osmolarity signal
           transduction pathway [1308 bp, 435 aa]
          Length = 435

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 75/161 (46%), Gaps = 14/161 (8%)

Query: 83  IGEGSFGVLFEGVNMINNVPVAIK--FEPRKTDAPQLKDEYRTYKILSG--SEGIPQAYY 138
           +G G+FG++    + + + PVAIK   +P  T A   K  YR  K+L     E +     
Sbjct: 29  VGMGAFGLVCSATDTLTSQPVAIKKIMKPFST-AVLAKRTYRELKLLKHLRHENLICLQD 87

Query: 139 FGQEGLHNI-LVIDLLGPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELHDHDLIYRDI 197
                L +I  V +L G  L  L     R    + V +   Q++  ++ +H   +I+RD+
Sbjct: 88  IFLSPLEDIYFVTELQGTDLHRLLQ--TRPLEKQFVQYFLYQILRGLKYVHSAGVIHRDL 145

Query: 198 KPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYR 238
           KP N LI          + + DFG+A++ +DP+   ++  R
Sbjct: 146 KPSNILINENCD-----LKICDFGLARI-QDPQMTGYVSTR 180

>ADR058C [1799] [Homologous to ScYBR160W (CDC28) - SH]
           (810941..811828) [888 bp, 295 aa]
          Length = 295

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 91/207 (43%), Gaps = 24/207 (11%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVA----IKFEPRKTDAPQLKDEYRTYKILS--GS 130
           YK  +K+GEG++GV+++ V++ +   +     I+ E      P      R   +L     
Sbjct: 7   YKRLEKVGEGTYGVVYKAVDLRHGQRIVALKKIRLESEDEGVPS--TAIREISLLKELKD 64

Query: 131 EGIPQAYYFGQEGLHNI-LVIDLLGPSLEDLFDWCGRRFSI--KTVVHVAIQMITLIEEL 187
           + I + Y       H + LV + L   L+   +   +   +  K +    +Q+   I   
Sbjct: 65  DNIVRLYDIVHSDAHKLYLVFEFLELDLKRYMESVPKDQPLGDKIIKKFMMQLCKGIAYC 124

Query: 188 HDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTA 247
           H H +I+RD+KP N LI R    + N+  L DFG+A+ +        +P R       T 
Sbjct: 125 HAHRIIHRDLKPQNLLINR----NGNL-KLGDFGLARAF-------GVPLRAYTHEIVTL 172

Query: 248 RYMSINTHLGREQ-SRRDDMEALGHVF 273
            Y +    LG +Q S   D+ ++G +F
Sbjct: 173 WYRAPEVLLGGKQYSTGVDVWSIGCIF 199

>Kwal_33.14554
          Length = 714

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/155 (28%), Positives = 69/155 (44%), Gaps = 17/155 (10%)

Query: 77  YKIGKKIGEGSFG----VLFEGVNMINNVPVAIKFEPRKTDAPQLKDEYRTYKILSGSEG 132
           ++  K IG+G+FG    V  +    I  +   +K E  K D  QL        +L+GS+ 
Sbjct: 303 FQTVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKD--QLAHVKAERDVLAGSDS 360

Query: 133 --IPQAYYFGQEGLHNILVIDLL--GPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELH 188
             +   YY  Q+  +  L+++ L  G  +  L  W  + F+         + I  IE +H
Sbjct: 361 PWVVSLYYSFQDTQYLYLIMEFLPGGDLMTMLIRW--QIFTEDVTRFYMAECILAIEAIH 418

Query: 189 DHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMA 223
               I+RDIKPDN LI          + L DFG++
Sbjct: 419 KLGFIHRDIKPDNILIDIRGH-----IKLSDFGLS 448

>AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W
           (SKM1) - SH] complement(246871..249252) [2382 bp, 793
           aa]
          Length = 793

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 53/114 (46%), Gaps = 18/114 (15%)

Query: 173 VVHVAIQMITLIEELHDHDLIYRDIKPDNFLI---GRPNQPDANMVHLIDFGMAKLYRDP 229
           + ++  +    ++ LHD  +I+RDIK DN L+   GR        V + DFG      D 
Sbjct: 621 IAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTHGR--------VKITDFGFCAKLTDK 672

Query: 230 KTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 283
           ++K       + ++ GT  +M+      RE   + D+ +LG +    L G+ P+
Sbjct: 673 RSK-------RATMVGTPYWMAPEVVKQREYDEKVDVWSLGIMTIEMLEGEPPY 719

>Kwal_27.9804
          Length = 473

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 73/175 (41%), Gaps = 27/175 (15%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRK---------------TDAPQ-LKDE 120
           YK+  KIGEG+F  +++  ++  +V  A      K               T +PQ + +E
Sbjct: 26  YKLLDKIGEGTFSSVYKAEDLTGSVTSAFSSHFWKSAGKKRYVALKRIYVTSSPQRIYNE 85

Query: 121 YRTYKILSGSEGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAIQM 180
                +L GS  +           H   VI +L     + F    R   IK +     ++
Sbjct: 86  LNLLYMLCGSTRVAP---LCDALRHQDQVIAVLPWYPHEEFRNFYRDLPIKGIKKYMSEL 142

Query: 181 ITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKL----YRDPKT 231
           +  +  +H   +I+RDIKP NFL      P      L+DFG+A+      RDP+T
Sbjct: 143 LQALSFVHSKAIIHRDIKPTNFLYS----PQLGRGVLVDFGLAETEVSHARDPET 193

>CAGL0J11308g 1097845..1100031 similar to sp|P22211 Saccharomyces
           cerevisiae YNL183c NPR1 ser/thr protein kinase,
           hypothetical start
          Length = 728

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 62/138 (44%), Gaps = 10/138 (7%)

Query: 159 DLFDWC-GRRFSIKTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHL 217
           DLF      + S + +     Q++  ++ LH   L +RD+K DN +I         +V L
Sbjct: 459 DLFAIVMSNKMSYEEICCCFKQILCGVQYLHSIGLAHRDLKLDNCVIN-----SKGIVKL 513

Query: 218 IDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSINTHL-GREQSRRDDMEALGHVFFYF 276
           IDFG A ++  P +K  +   E   + G+  Y++    +  +   R  D+ +   +F   
Sbjct: 514 IDFGAAVVFSYPFSKTLV---EASGIVGSDPYLAPEVCIFTKYDPRPVDIWSTAIIFACM 570

Query: 277 LRGQLPWQGLKAANNKLK 294
           +  + PW+  K  +N  K
Sbjct: 571 ILKKFPWKIPKLRDNSFK 588

>Kwal_55.21545
          Length = 865

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/229 (21%), Positives = 98/229 (42%), Gaps = 35/229 (15%)

Query: 73  VGLHYKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLKDEYRTYKILSGSEG 132
           V   +K  + IG G FGV+++G         AIK     +   +++D  +  + LS  + 
Sbjct: 15  VSTLFKRTEVIGRGKFGVVYKGYYTKTKQVCAIKVLNLDSADDEVEDVQKEIQFLSSLKQ 74

Query: 133 IPQ-AYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVH-----------VAIQM 180
           +P   +Y+G           L    L  + ++C    S++T++            +  ++
Sbjct: 75  VPNITHYYGSY---------LNDTKLWVIMEYCAGG-SLRTLLRPGKIGEQYIGVIMREL 124

Query: 181 ITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREK 240
           +T +  +H   +I+RDIK  N LI      +   + L DFG+A      K +       +
Sbjct: 125 LTALMHIHKDGVIHRDIKAANVLIT-----NDGHIKLCDFGVAAQLSQTKIR-------R 172

Query: 241 KSLSGTARYMSINTHL-GREQSRRDDMEALGHVFFYFLRGQLPWQGLKA 288
           ++++GT  +M+    + G     + D+ +LG   +    G  P+  ++A
Sbjct: 173 QTMAGTPYWMAPEVIMEGVYYDTKVDIWSLGITAYEIATGNPPYCEVEA 221

>KLLA0D13266g complement(1137750..1141208) similar to sp|P32361
           Saccharomyces cerevisiae YHR079c IRE1 protein kinase
           singleton, hypothetical start
          Length = 1152

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 79/173 (45%), Gaps = 36/173 (20%)

Query: 76  HYKIGKKI-GEGSFG-VLFEGVNMINNVPVAIKFEPRKTDAPQLKDEY----RTYKILSG 129
           H  I  ++ G GS G V+F+G     N PVA+K          L D Y    +  ++LS 
Sbjct: 707 HLSISSRVLGYGSSGTVVFQG--KFQNRPVAVK--------RLLIDFYDIASKEIQLLSE 756

Query: 130 SEGIPQA--YYFGQEGLHNI-LVIDLLGPSLEDLFDWCGRRFSIKTV--------VHVAI 178
           S+  P    YYF +     + + ++L   SLED+ +  G +   K V        ++V  
Sbjct: 757 SDDHPNVIRYYFSESTEKFMYIAVELCSASLEDVIE--GSKGLAKNVAVQKNIDPINVLF 814

Query: 179 QMITLIEELHDHDLIYRDIKPDNFLIGRPNQ-------PDANMVHLIDFGMAK 224
           Q+ + +  LH   +++RD+KP N LI  P +        +   V + DFG+ K
Sbjct: 815 QITSGVNHLHSMKIVHRDLKPQNILIAPPKRYLSLHASKNKFRVLISDFGLCK 867

>CAGL0M03729g complement(420316..422901) similar to sp|P48562
           Saccharomyces cerevisiae YNL298w CLA4, start by
           similarity
          Length = 861

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 53/111 (47%), Gaps = 12/111 (10%)

Query: 173 VVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTK 232
           + ++  +    ++ LHD ++I+RDIK DN L+    +     V + DFG      D ++K
Sbjct: 689 IAYIVRETCKGLKFLHDKNIIHRDIKSDNVLLDTKAR-----VKITDFGFCAKLTDQRSK 743

Query: 233 QHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 283
                  + ++ GT  +M+      +E   + D+ +LG +    L G+ P+
Sbjct: 744 -------RATMVGTPYWMAPEVVKQKEYDAKVDVWSLGIMAIEMLEGEPPY 787

>KLLA0A02497g 218592..219680 highly similar to sp|P14681
           Saccharomyces cerevisiae YGR040w KSS1 ser/thr protein
           kinase of the MAP kinase family, start by similarity
          Length = 362

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/160 (23%), Positives = 74/160 (46%), Gaps = 21/160 (13%)

Query: 76  HYKIGKKIGEGSFGVLFEGVNMINNVPVAIK-FEP--RKTDAPQLKDEYRTYKILSGSEG 132
           HY++   +GEG++G +   ++   N  VAIK  +P  R     +   E +  K     E 
Sbjct: 12  HYQLVDLVGEGAYGTVCSAIHKPTNTKVAIKKIQPFSRSMFVTRTLRELKLLKFFHSHEN 71

Query: 133 I--------PQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAIQMITLI 184
           I        P +++   E ++  LV +L+   L+ + +   +  S   + +   Q++  +
Sbjct: 72  IISVLDIVRPTSWH-KFEAVY--LVQELMETDLQKIIN--QQNLSEDHIQYFVYQILRAL 126

Query: 185 EELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAK 224
           + LH   +I+RD+KP N L+          + + DFG+A+
Sbjct: 127 KSLHSAQVIHRDLKPSNLLLNSNCD-----LKVCDFGLAR 161

>AGR048C [4358] [Homologous to ScYLR113W (HOG1) - SH]
           (807470..808831) [1362 bp, 453 aa]
          Length = 453

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 88/203 (43%), Gaps = 22/203 (10%)

Query: 83  IGEGSFGVLFEGVNMINNVPVAIK--FEPRKTDAPQLKDEYRTYKILSG--SEGIPQAYY 138
           +G G+FG++   V+     PVAIK   +P  T A   K  YR  K+L     E +     
Sbjct: 35  VGMGAFGLVCSAVDTYTQQPVAIKKIMKPFST-AVLAKRTYRELKLLKHLRHENLICLED 93

Query: 139 FGQEGLHNI-LVIDLLGPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELHDHDLIYRDI 197
                L +I  V +L G  L  L     R    + + +   Q++  ++ +H   +I+RD+
Sbjct: 94  IFLSPLEDIYFVTELQGTDLHRLLQ--TRPLEKQFLQYFLYQILRGLKYVHSAGVIHRDL 151

Query: 198 KPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSINTHLG 257
           KP N LI          + + DFG+A++ +DP+   ++  R  ++      +   N  + 
Sbjct: 152 KPSNILINENCD-----LKICDFGLARI-QDPQMTGYVSTRYYRAPEIMLTWQKYNVEV- 204

Query: 258 REQSRRDDMEALGHVFFYFLRGQ 280
                  D+ + G +F   + G+
Sbjct: 205 -------DIWSAGCIFAEMIEGK 220

>CAGL0F03245g complement(316924..320034) similar to sp|P32361
           Saccharomyces cerevisiae YHR079c IRE1, hypothetical
           start
          Length = 1036

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 59/250 (23%), Positives = 102/250 (40%), Gaps = 67/250 (26%)

Query: 81  KKIGEGSFG-VLFEGVNMINNVPVAIKFEPRKTDAPQLKDEY-----RTYKILSGSEGIP 134
           K +G GS G V++EG           KF+ R     ++  ++     +  ++LS S+  P
Sbjct: 605 KVLGYGSSGTVVYEG-----------KFQERSVAVKRMLVDFYDIASKEIELLSESDEHP 653

Query: 135 QA--YYFGQEGLHNI-LVIDLLGPSLEDLFDWCG-----RRFSIKTVVHVAIQMITLIEE 186
               YY  +E    + + ++L   +LE L +        +R     +V +  Q+   I  
Sbjct: 654 NVVRYYCSEETSKFLYIALELCDSNLEQLIETNNVMRHEQRLKDYELVDILAQITQGIAY 713

Query: 187 LHDHDLIYRDIKPDNFLIGRP----------NQPDANMVHLIDFGMAKL--YRDPKTKQH 234
           LH  ++I+RDIKP N LI +           N  +   + L DFG+ K   +     K +
Sbjct: 714 LHSLNIIHRDIKPQNILISKSKKRLQKPTTGNGNNKTRIMLSDFGLCKKLDFEQSSFKTN 773

Query: 235 IPYREKKSLSGTARYMS-------------------------INTHLGREQSRRDDMEAL 269
           I     K+ +GT  +M+                          + +L R  ++  D+ +L
Sbjct: 774 I-----KNAAGTVGWMAPELLIEDENSNKISVSQEIEKIDEVYDPYLRRRLTKAIDIFSL 828

Query: 270 GHVFFYFLRG 279
           G VF+Y L G
Sbjct: 829 GCVFYYVLSG 838

>YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kinase
           required for induction of Rnr3p and DNA repair genes
           after DNA damage [1542 bp, 513 aa]
          Length = 513

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/232 (20%), Positives = 99/232 (42%), Gaps = 35/232 (15%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIK-FEPRKTDAPQLKDEYRTYKILSGSEGIPQ 135
           Y +GK++G G + ++ E  N      VA+K F  ++ D  +   ++R    +      P 
Sbjct: 200 YLLGKELGAGHYALVKEAKNKKTGQQVAVKIFHAQQNDDQKKNKQFREETNILMRVQHPN 259

Query: 136 AYYF--------GQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAI--QMITLIE 185
                        +  +   LV++ +     +LF+   R+  ++     A+  Q++T ++
Sbjct: 260 IVNLLDSFVEPISKSQIQKYLVLEKIDDG--ELFERIVRKTCLRQDESKALFKQLLTGLK 317

Query: 186 ELHDHDLIYRDIKPDNFLIGRPNQPDANMVHL--------------IDFGMAKLYRDPKT 231
            LH+ ++I+RDIKP+N L+    + + + V L               DFG+AK   +   
Sbjct: 318 YLHEQNIIHRDIKPENILLNITRRENPSQVQLGPWDEDEIDIQVKIADFGLAKFTGE--- 374

Query: 232 KQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 283
                 +   +L GT  Y++      +  + + D+ + G + +  L G  P+
Sbjct: 375 -----MQFTNTLCGTPSYVAPEVLTKKGYTSKVDLWSAGVILYVCLCGFPPF 421

>KLLA0E21780g complement(1936438..1939488) similar to sp|P38692
           Saccharomyces cerevisiae YHR102w NRK1 ser/thr protein
           kinase that interacts with CDC31P, start by similarity
          Length = 1016

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/225 (21%), Positives = 96/225 (42%), Gaps = 35/225 (15%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLKDEYRTYKILSGSEGIPQ- 135
           +K  + IG G FGV+++  ++      AIK         +++D  +  + LS  +  P  
Sbjct: 16  FKRKEIIGRGKFGVVYKAFHVKTQQVYAIKVLNLDNTEDEVEDIRKEIQFLSSLKQTPNI 75

Query: 136 AYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAI-----------QMITLI 184
            +Y+G           L+   L  + ++C    S++T++   I           +++  +
Sbjct: 76  THYYGSY---------LIDTKLWVIMEYCAGG-SLRTLLRPGIIEEKYIGVIMREILVAL 125

Query: 185 EELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLS 244
             +H  ++I+RDIK  N LI      +   V L DFG+A        K       +++++
Sbjct: 126 ISIHRDNVIHRDIKAANILIA-----NNGSVKLCDFGVAAQLSQSMLK-------RQTMA 173

Query: 245 GTARYMSINTHL-GREQSRRDDMEALGHVFFYFLRGQLPWQGLKA 288
           GT  +M+    + G     + D+ +LG   +    G  P+  ++A
Sbjct: 174 GTPYWMAPEVIMEGVYYDTKVDIWSLGITAYEIATGNPPYCHMEA 218

>YNL298W (CLA4) [4314] chr14 (68913..71441) Serine/threonine protein
           kinase required for cytokinesis [2529 bp, 842 aa]
          Length = 842

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 51/111 (45%), Gaps = 12/111 (10%)

Query: 173 VVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTK 232
           + ++  +    ++ LHD  +I+RDIK DN L+          V + DFG      D ++K
Sbjct: 670 IAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLD-----TRARVKITDFGFCARLTDKRSK 724

Query: 233 QHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 283
                  + ++ GT  +M+      RE   + D+ +LG +    L G+ P+
Sbjct: 725 -------RATMVGTPYWMAPEVVKQREYDEKIDVWSLGIMTIEMLEGEPPY 768

>YDL079C (MRK1) [789] chr4 complement(312951..314044,314337..314748)
           Member of the GSK-3 subfamily of protein kinases [1506
           bp, 501 aa]
          Length = 501

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 45/165 (27%), Positives = 75/165 (45%), Gaps = 18/165 (10%)

Query: 73  VGLHYKIGKKIGEGSFGVLFEGVNMINNVPVAIK--FEPRKTDAPQLKDEYRTYKILSGS 130
           + + Y   + +G GSFGV+   V +  N  VAIK   + R+    +L+    T K+L   
Sbjct: 160 IDISYPTTEVVGHGSFGVVVTTVIIETNQKVAIKKVLQDRRYKNRELE----TMKMLCHP 215

Query: 131 EGIPQAYYF----GQEGLHNILVIDLLGPSL-EDLFDWCGRRFSIKTV--VHVAIQMITL 183
             +   YYF     ++ ++  LV+D +  SL + L  +   +  +  V     A Q+   
Sbjct: 216 NTVGLQYYFYEKDEEDEVYLNLVLDYMPQSLYQRLRHFVNLKMQMPRVEIKFYAYQLFKA 275

Query: 184 IEELHDH-DLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYR 227
           +  LH+   + +RDIKP N L+     P      + DFG AK  +
Sbjct: 276 LNYLHNVPRICHRDIKPQNLLVD----PTTFSFKICDFGSAKCLK 316

>KLLA0F12188g 1122745..1124385 similar to sp|P38623 Saccharomyces
           cerevisiae YLR248w RCK2 Ca/calmodulin-dependent ser/thr
           protein kinase, start by similarity
          Length = 546

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 59/267 (22%), Positives = 97/267 (36%), Gaps = 71/267 (26%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVP-------------VAIKF---------------- 107
           Y + +KIGEG+F  ++ G+   +N               VAIK                 
Sbjct: 120 YTLIQKIGEGAFSKVYRGIPSTSNCSNGASSVIAQQYKEVAIKVIIKQQLPNTNKKGDEK 179

Query: 108 EPRKTDAPQLKDEYRTYKILSGSEGIPQAYYFGQEGLHNILVIDLL--GPSLEDLFDWCG 165
             + + A Q+  E   +KI+S  E I     F +   +  ++ +LL  G    ++  +  
Sbjct: 180 NGKTSTAEQVLKEIAIHKIVSSGENIVSFIDFQESEKYYYIIQELLAGGEIFGEIVKYT- 238

Query: 166 RRFSIKTVVHVAIQMITLIEELHDHDLIYRDIKPDNFL---------------------- 203
             FS     HV  Q+   ++ +H   +++RDIKP+N L                      
Sbjct: 239 -YFSEDLSRHVIRQLANAVKYMHQLGIVHRDIKPENLLFEPIDFIPNPKPKLRSSDDPST 297

Query: 204 -----IGRP--NQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSINTHL 256
                + RP        +V L DFG++K          I     K+  GT  Y +     
Sbjct: 298 KLDEGVFRPGIGGGGIGVVKLADFGLSK---------QIYQTNTKTPCGTVGYTAPEVVK 348

Query: 257 GREQSRRDDMEALGHVFFYFLRGQLPW 283
               S + DM  +G V +  L G  P+
Sbjct: 349 DERYSMQVDMWGVGCVLYTVLCGFPPF 375

>YDL028C (MPS1) [834] chr4 complement(400994..403288)
           Multi-functional serine/threonine/tyrosine protein
           kinase involved in mitotic checkpoint, spindle pole body
           duplication in meiosis and mitosis, and proper
           chromosome segregation in meiosis [2295 bp, 764 aa]
          Length = 764

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/193 (24%), Positives = 81/193 (41%), Gaps = 35/193 (18%)

Query: 116 QLKDEYRTYKILSGSEGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVH 175
           +LKD+ R  ++L    G    Y   + G H++  I         L    G       V  
Sbjct: 492 KLKDQKRVIQLLDYEMGDGLLYLIMECGDHDLSQI---------LNQRSGMPLDFNFVRF 542

Query: 176 VAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHI 235
              +M+  I+ +HD  +++ D+KP NF++ +       ++ +IDFG+A     P+   +I
Sbjct: 543 YTKEMLLCIKVVHDAGIVHSDLKPANFVLVK------GILKIIDFGIANAV--PEHTVNI 594

Query: 236 PYREKKSLSGTARYM-------------SINTHLGREQS--RRDDMEALGHVFFYFLRGQ 280
            YRE +   GT  YM             S N H G +    R  DM + G + +  + G+
Sbjct: 595 -YRETQ--IGTPNYMAPEALVAMNYTQNSENQHEGNKWKVGRPSDMWSCGCIIYQMIYGK 651

Query: 281 LPWQGLKAANNKL 293
            P+   +  N  L
Sbjct: 652 PPYGSFQGQNRLL 664

>KLLA0B07205g complement(624606..625973) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3
           cAMP-dependent protein kinase 3, catalytic chain,
           hypothetical start
          Length = 455

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 57/134 (42%), Gaps = 18/134 (13%)

Query: 165 GRRFSIKTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAK 224
            +RF        A ++   +E LH   +IYRD+KP+N L+ +        + L DFG AK
Sbjct: 237 SQRFPNPVAKFYAAEVCLALEYLHSKGIIYRDLKPENILLDKNGH-----IKLTDFGFAK 291

Query: 225 LYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 284
              D      + Y    +L GT  Y++      +  ++  D  + G + +  L G  P+ 
Sbjct: 292 YVPD------VTY----TLCGTPDYIAPEVVSTKPYNKSVDWWSFGVLIYEMLAGYTPFY 341

Query: 285 GLKAANNKLKYEKI 298
               +N    YE I
Sbjct: 342 D---SNTIKTYENI 352

>CAGL0J06072g complement(572377..574698) similar to sp|P53894
           Saccharomyces cerevisiae YNL161w CBK1, hypothetical
           start
          Length = 773

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 66/149 (44%), Gaps = 17/149 (11%)

Query: 83  IGEGSFG----VLFEGVNMINNVPVAIKFEPRKTDAPQLKDEYRTYKILSGSEG--IPQA 136
           IG+G+FG    V  +    I  +   +K E  K D  QL        +L+G++   I   
Sbjct: 376 IGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKD--QLAHVKAERDVLAGTDSPWIVSL 433

Query: 137 YYFGQEGLHNILVIDLL--GPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELHDHDLIY 194
           YY  Q+  +  L+++ L  G  +  L  W  + F+         + I  IE +H    I+
Sbjct: 434 YYSFQDAQYLYLIMEFLPGGDLMTMLIRW--QLFTEDVTRFYMAECILAIETIHKLGFIH 491

Query: 195 RDIKPDNFLIGRPNQPDANMVHLIDFGMA 223
           RDIKPDN LI          + L DFG++
Sbjct: 492 RDIKPDNILIDIRGH-----IKLSDFGLS 515

>Scas_713.38
          Length = 432

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 75/161 (46%), Gaps = 14/161 (8%)

Query: 83  IGEGSFGVLFEGVNMINNVPVAIK--FEPRKTDAPQLKDEYRTYKILSG--SEGIPQAYY 138
           +G G+FG++    + + + PVAIK   +P  T A   K  YR  K+L     E +     
Sbjct: 29  VGMGAFGLVCSATDTLTSQPVAIKKIMKPFST-AVLAKRTYRELKLLKHLRHENLICLQD 87

Query: 139 FGQEGLHNI-LVIDLLGPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELHDHDLIYRDI 197
                L +I  V +L G  L  L     R    + V +   Q++  ++ +H   +I+RD+
Sbjct: 88  IFLSPLEDIYFVTELQGTDLHRLLQ--TRPLEKQFVQYFLYQILRGLKYVHSVGVIHRDL 145

Query: 198 KPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYR 238
           KP N LI          + + DFG+A++ +DP+   ++  R
Sbjct: 146 KPSNILINENCD-----LKICDFGLARI-QDPQMTGYVSTR 180

>Kwal_26.7276
          Length = 646

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 37/71 (52%), Gaps = 12/71 (16%)

Query: 166 RRFSIKTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQ------------PDAN 213
           R FS+ ++  +  Q+IT I  +H H+  +RD+KP+N LI   N              D  
Sbjct: 178 RVFSLPSLKSILTQLITGIRHIHSHNFFHRDLKPENILISPSNHYFSKDWILNGNYSDNY 237

Query: 214 MVHLIDFGMAK 224
           +V + D+G+A+
Sbjct: 238 VVKIADYGLAR 248

>CAGL0M08316g 829069..831963 weakly similar to sp|P36003
           Saccharomyces cerevisiae YKL171w, hypothetical start
          Length = 964

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/191 (22%), Positives = 87/191 (45%), Gaps = 26/191 (13%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIK---FEPRKTDAPQLKDEYRTYKILSGSEGI 133
           +K+GK IG G++G++ E V++ +    A+K   F+  +     +  E   +K +     +
Sbjct: 487 HKLGKVIGFGAWGMIRECVDIQSGAQRAMKIVRFKDNQKVKRNVIREVNVWKEMHHMYIL 546

Query: 134 P---------QAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFS-------IKTVVHVA 177
           P          A Y   E + +  + DL+         W  R+ +       IK  + + 
Sbjct: 547 PLLDWKLISDYAMYCLTERVKDGTLYDLV-------LSWEDRKNNQIPVDERIKLTMFLM 599

Query: 178 IQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPY 237
           +Q+I+ ++ +H +  ++ DIK +N L+ +  Q     + L DFGM+  +   +++     
Sbjct: 600 LQLISALKYMHSNSTVHGDIKLENCLLKKGRQHKNWTIFLCDFGMSCRFGSYRSRYDTLI 659

Query: 238 REKKSLSGTAR 248
            E+K+ SG  R
Sbjct: 660 DEEKNNSGIIR 670

>Scas_654.12
          Length = 737

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 69/151 (45%), Gaps = 17/151 (11%)

Query: 81  KKIGEGSFGV--LFEGVNM--INNVPVAIKFEPRKTDAPQLKDEYRTYKILSGSEG--IP 134
           K IG+G+FG   L + ++   I  +   +K E  K D  QL        +L+GS+   + 
Sbjct: 323 KVIGKGAFGEVRLVQKIDTGKIYAMKTLLKSEMYKKD--QLAHVKAERDVLAGSDSPWVV 380

Query: 135 QAYYFGQEGLHNILVIDLL--GPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELHDHDL 192
             YY  Q+  +  L+++ L  G  +  L  W  + F+         + I  IE +H    
Sbjct: 381 SLYYSFQDTQYLYLIMEFLPGGDLMTMLIRW--QLFTEDVTRFYMAECILAIETIHKLGF 438

Query: 193 IYRDIKPDNFLIGRPNQPDANMVHLIDFGMA 223
           I+RDIKPDN LI          + L DFG++
Sbjct: 439 IHRDIKPDNILIDIRGH-----IKLSDFGLS 464

>KLLA0F20053g 1867209..1868543 highly similar to sp|P32485
           Saccharomyces cerevisiae YLR113w HOG1 ser/thr protein
           kinase of MAP kinase (MAPK) family, start by similarity
          Length = 444

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/203 (23%), Positives = 88/203 (43%), Gaps = 22/203 (10%)

Query: 83  IGEGSFGVLFEGVNMINNVPVAIK--FEPRKTDAPQLKDEYRTYKILS--GSEGIPQAYY 138
           +G G+FG++    + + + PVAIK   +P  T     K  YR  K+L     E +     
Sbjct: 28  VGMGAFGLVCSATDTLTSQPVAIKKIMKPFSTSV-LAKRTYRELKLLKHLRHENLICLED 86

Query: 139 FGQEGLHNI-LVIDLLGPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELHDHDLIYRDI 197
                L +I  V +L G  L  L     R    + V +   Q++  ++ +H   +I+RD+
Sbjct: 87  IFLSPLEDIYFVTELQGTDLHRLLQ--TRPLEKQFVQYFLYQILRGLKYVHSAGVIHRDL 144

Query: 198 KPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSINTHLG 257
           KP N LI          + + DFG+A++ +DP+   ++  R  ++      +   N  + 
Sbjct: 145 KPSNILINENCD-----LKICDFGLARI-QDPQMTGYVSTRYYRAPEIMLTWQKYNVEV- 197

Query: 258 REQSRRDDMEALGHVFFYFLRGQ 280
                  D+ + G +F   + G+
Sbjct: 198 -------DIWSAGCIFAEMIEGK 213

>Scas_683.12
          Length = 356

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 56/225 (24%), Positives = 98/225 (43%), Gaps = 35/225 (15%)

Query: 83  IGEGSFGVLFEGVNMINNVPVAIKFEPR-KTDAPQLKDEYRTYKILSGSE-GIPQAYYFG 140
           I  G+F  +++  +   N  VA+K  P+ K  +  + +E+   KIL  S   I     F 
Sbjct: 9   IQTGTFSTVYKAWSSQRNEYVALKIMPKSKYSSGGMANEFEIMKILGRSHPNICSMLDFY 68

Query: 141 QEGLHNILVIDLLGPSLEDLFDWC------GRRFSIKTV----VHVAIQMITLIEELHDH 190
           Q+  + +LV++       DL+D+       G +    T+      V  Q+ + I   H  
Sbjct: 69  QDTNYYVLVLEYC--EYGDLYDFLSVAKRQGDQIHPSTIQLDFAKVLRQISSAIMYSHSL 126

Query: 191 DLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQ-HI---PYREKKSLSGT 246
            + +RDIKP+N L+ +        + L D+G A   RD  +K+ HI    YR  ++   T
Sbjct: 127 GIAHRDIKPENILLTKEGD-----IKLADWGHA--IRDSFSKESHIGTDNYRAPETFDCT 179

Query: 247 ARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANN 291
             Y           + + D  +LG    Y + GQ P++ L  +++
Sbjct: 180 IEY----------DTFKIDYWSLGVTSLYLIFGQAPFKNLTLSSD 214

>YPL031C (PHO85) [5407] chr16
           complement(492014..492914,493017..493033)
           Cyclin-dependent protein kinase that interacts with
           cyclin Pho80p to regulate phosphate pathway and with
           cyclin Pcl5p to regulate Gcn4p stability, also interacts
           with other Pho80p-like cyclins [918 bp, 305 aa]
          Length = 305

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/213 (21%), Positives = 88/213 (41%), Gaps = 20/213 (9%)

Query: 76  HYKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLKDEYRTYKILS--GSEGI 133
            +K  +K+G G++  +++G+N    V VA+K     ++        R   ++     E I
Sbjct: 6   QFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIREISLMKELKHENI 65

Query: 134 PQAYYFGQEGLHNILVIDLLGPSLEDLFDW-----CGRRFSIKTVVHVAIQMITLIEELH 188
            + Y          LV + +   L+   D        R   +  V +   Q++  +   H
Sbjct: 66  VRLYDVIHTENKLTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLAFCH 125

Query: 189 DHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTAR 248
           ++ +++RD+KP N LI +  Q     + L DFG+A+ +        IP     S   T  
Sbjct: 126 ENKILHRDLKPQNLLINKRGQ-----LKLGDFGLARAF-------GIPVNTFSSEVVTLW 173

Query: 249 YMSINTHLG-REQSRRDDMEALGHVFFYFLRGQ 280
           Y + +  +G R  S   D+ + G +    + G+
Sbjct: 174 YRAPDVLMGSRTYSTSIDIWSCGCILAEMITGK 206

>Scas_718.72
          Length = 550

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 73/167 (43%), Gaps = 22/167 (13%)

Query: 76  HYKIGKKIGEGSFGVLFEGVNMINNVP-------------VAIKFEPRKTDAPQ-LKDEY 121
           +Y I  KIGEG+F  +++  ++   V              VA+K +   T +PQ + +E 
Sbjct: 47  NYNIIDKIGEGTFSSVYKAQDLKGKVTSKYASHFWKSPKYVALK-KIYVTSSPQRIYNEL 105

Query: 122 RTYKILSGSEGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAIQMI 181
               IL+GS  +               VI +L     D F    R   IK +     +++
Sbjct: 106 NLLYILTGSSKVAP---LCDAMRMRDQVIAILPYYPHDEFRTFYRDLPIKGIKMYIWELL 162

Query: 182 TLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRD 228
             +  +H   +I+RD+KP NFL      P+     L+DFG+A++  D
Sbjct: 163 QALNFVHSKGIIHRDVKPTNFLFN----PELGRGVLVDFGLAEIQSD 205

>Scas_713.21
          Length = 641

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 59/138 (42%), Gaps = 22/138 (15%)

Query: 160 LFDWCGRRFSIKTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLID 219
           L +   R F I  V  ++ +MI  I+ +HD D+++ D+KP NF+  +        + LID
Sbjct: 408 LHERVNRPFDINFVRLMSKEMIECIKAVHDSDIVHSDLKPANFIFVK------GTLKLID 461

Query: 220 FGMAKLYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQS-----------RRDDMEA 268
           FG+A    D     +     + +  GT  YM+  T + +  S           +  D+ +
Sbjct: 462 FGIANKIADNTLNVY-----RNTQMGTPNYMAPETLISQNYSNNNNNLLWKIGKPSDIWS 516

Query: 269 LGHVFFYFLRGQLPWQGL 286
            G + +    G  P+   
Sbjct: 517 YGCILYQMTYGHPPYSSF 534

>ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C
           (MKK2) - SH] complement(557738..559312) [1575 bp, 524
           aa]
          Length = 524

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 54/127 (42%), Gaps = 14/127 (11%)

Query: 165 GRRFSIKTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAK 224
           G R   K +  +A  ++  +  LH   +I+RDIKP N L+      +A  V L DFG++ 
Sbjct: 333 GGRVGEKVLGKIAESVLRGLSYLHQRKIIHRDIKPQNILLN-----EAGQVKLCDFGVSG 387

Query: 225 LYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 284
              +             + +GT+ YM+     G+  S   D+ +LG       +   P+ 
Sbjct: 388 EAVNSLA---------TTFTGTSYYMAPERIQGQPYSVTSDVWSLGLTLLEVAQAHFPFD 438

Query: 285 GLKAANN 291
             K A N
Sbjct: 439 SGKFAAN 445

>Sklu_2385.2 YLR113W, Contig c2385 3805-5109 reverse complement
          Length = 434

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 88/203 (43%), Gaps = 22/203 (10%)

Query: 83  IGEGSFGVLFEGVNMINNVPVAIK--FEPRKTDAPQLKDEYRTYKILS--GSEGIPQAYY 138
           +G G+FG++    +   + PVAIK   +P  T A   K  YR  K+L     E +     
Sbjct: 29  VGMGAFGLVCSATDTYTSQPVAIKKIMKPFST-AVLAKRTYRELKLLKHLRHENLICLED 87

Query: 139 FGQEGLHNI-LVIDLLGPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELHDHDLIYRDI 197
                L +I  V +L G  L  L     R    + V +   Q++  ++ +H   +I+RD+
Sbjct: 88  IFLSPLEDIYFVTELQGTDLHRLLQ--TRPLEKQFVQYFLYQILRGLKYVHSAGVIHRDL 145

Query: 198 KPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSINTHLG 257
           KP N LI          + + DFG+A++ +DP+   ++  R  ++      +   N  + 
Sbjct: 146 KPSNILINENCD-----LKICDFGLARI-QDPQMTGYVSTRYYRAPEIMLTWQKYNVEV- 198

Query: 258 REQSRRDDMEALGHVFFYFLRGQ 280
                  D+ + G +F   + G+
Sbjct: 199 -------DIWSAGCIFAEMIEGK 214

>AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH]
           (1044971..1047679) [2709 bp, 902 aa]
          Length = 902

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 55/218 (25%), Positives = 92/218 (42%), Gaps = 29/218 (13%)

Query: 76  HYKIGKKIGEGSFGVLFEGVNMINNVPVAIK-----FEPRKTDAPQLKDEYRTYKILSGS 130
           HY + + IG+G++GV+++ VN   +  +AIK      E    +     D  +  K     
Sbjct: 18  HYALKQVIGKGAYGVVYKAVNRATDQVIAIKAIEYENEEELHEHMLEIDLLKNLK----H 73

Query: 131 EGIPQAYYFGQEG--LHNILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELH 188
           E I + + F Q    L+ +L   + G SL DL        S         Q +  ++ LH
Sbjct: 74  ENIVKYHGFIQSSHELYILLEYCIRG-SLRDLIK--KEALSEAKAKTYVRQTLRGLQYLH 130

Query: 189 DHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTAR 248
           D  +I+RDIK  N L+      +  +V L DFG++    +             + +G+  
Sbjct: 131 DQGVIHRDIKAANLLLT-----ENGVVKLADFGVSTRVNN----------MAMTYAGSPN 175

Query: 249 YMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGL 286
           +M+    LG+  S   D+ +LG      L G  P+  L
Sbjct: 176 WMAPEVMLGKGASTVSDIWSLGATVVELLTGNPPFYNL 213

>KLLA0D10527g 892955..894892 similar to sp|P23293 Saccharomyces
           cerevisiae YPR161c SGV1 ser/thr protein kinase,
           hypothetical start
          Length = 645

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 76/186 (40%), Gaps = 41/186 (22%)

Query: 76  HYKIGKKIGEGSFGVLFEGVNMINNVPVAIK---FEPRKTDAP----------------- 115
           +Y+  +K+G+G+FG +F+G+++  N  VAIK       K   P                 
Sbjct: 54  NYREEEKLGQGTFGEVFKGIHLGTNRKVAIKRILVRAEKDLFPITAQREITILKRMNHKN 113

Query: 116 ------QLKDEYRTYKILSGSEGIPQAYYFGQE---------GLHNILVIDLLGPSLEDL 160
                  + DE  T K  S S   P   Y G           G H  +++  +   L  L
Sbjct: 114 IVKLIEIVYDESPTPKTDSTSPR-PVGNYHGNNTANQQKLITGKHFFMILPYMVSDLTGL 172

Query: 161 FDWCGRRFSIKTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDF 220
                  F +  V ++ +Q++  I  +H +  ++RDIK  N LI         +V + DF
Sbjct: 173 LHNPRVEFGMADVKNIMLQLLEGINYIHCNKFLHRDIKTANILIDH-----KGVVKIADF 227

Query: 221 GMAKLY 226
           G+A+ Y
Sbjct: 228 GLARNY 233

>Kwal_56.22788
          Length = 515

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 63/139 (45%), Gaps = 17/139 (12%)

Query: 172 TVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYR---- 227
           TV   A ++   +  LH   ++YRD+KP+N L+      +   + L DFG++K+      
Sbjct: 238 TVAFYAAEISCALRFLHKRGVVYRDLKPENCLLD-----ERGHLVLTDFGLSKVSASDDS 292

Query: 228 ----DPKTKQH--IPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQL 281
               D  T  H         S+ GT  Y +     G+  ++  D  +LG + F  L G+ 
Sbjct: 293 ADGGDVNTNGHEGESVCTLHSIIGTPEYCAPEILEGKPYTQNCDWYSLGCLIFDMLIGKP 352

Query: 282 PWQGL--KAANNKLKYEKI 298
           P+ G+  K   NK+  +KI
Sbjct: 353 PYTGVNHKVILNKILKDKI 371

>CAGL0K02167g complement(191468..194956) similar to sp|P38990
           Saccharomyces cerevisiae YER129w
           Serine/threonine-protein kinase, start by similarity
          Length = 1162

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 49/190 (25%), Positives = 85/190 (44%), Gaps = 46/190 (24%)

Query: 184 IEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPK---TKQHIPYREK 240
           +E LH   +I+RDIKP N L+      +  +V + DFG++          + + I   E 
Sbjct: 272 LEYLHYQGIIHRDIKPANLLLS-----ETGIVKISDFGVSLAASSSNVDGSDETIDELEL 326

Query: 241 KSLSGTARYMSINTHLG----------REQ-------SRRDDMEALGHVFFYFLRGQLPW 283
              +GT  + +    LG          RE+       S + D+ ALG   +  + G LP+
Sbjct: 327 AKTAGTPAFFAPEICLGEDAFEKYQLDREELFKGSCISFKIDIWALGVTLYCLVFGMLPF 386

Query: 284 QGLKAANNKLK-YEKIGEKKRSTNVYDLSQGLPVQFGRYLEIVRN---LGFEETPDYEGY 339
                ++ +L+ +EKI        V D     PV+F +Y ++++N   L   E  +YE  
Sbjct: 387 ----VSSFELELFEKI--------VND-----PVKFPKYSDMLKNNQVLQMTEEAEYEAA 429

Query: 340 RKLLLSVLDE 349
           + LL  +L++
Sbjct: 430 KDLLTRLLEK 439

>Kwal_33.14167
          Length = 838

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 68/143 (47%), Gaps = 24/143 (16%)

Query: 164 CGRRFSIKTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMA 223
            G    ++ V + A +M+  ++ +HD  +++ D+KP NF+  +       ++ +IDFG+A
Sbjct: 607 SGMPLDVEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVK------GILKIIDFGIA 660

Query: 224 KLYRDPKTKQHIPYREKKSLSGTARYMSIN-------TH-LGREQSR-----RDDMEALG 270
                P+   +I YRE +   GT  YM+         TH    EQSR       D+ + G
Sbjct: 661 NAV--PEHTVNI-YRETQ--IGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSCG 715

Query: 271 HVFFYFLRGQLPWQGLKAANNKL 293
            + +  + G+ P+ G +  N  L
Sbjct: 716 CIIYQMIYGRPPYGGFQGQNRLL 738

>YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase
           kinase kinase essential for late nuclear division [2925
           bp, 974 aa]
          Length = 974

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 52/220 (23%), Positives = 88/220 (40%), Gaps = 19/220 (8%)

Query: 74  GLHYKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLKDEYRTYKILS--GSE 131
            + Y + + IG GS+GV+++ +N   +  VAIK E    +  +L D      +L      
Sbjct: 22  SVQYHLKQVIGRGSYGVVYKAINKHTDQVVAIK-EVVYENDEELNDIMAEISLLKNLNHN 80

Query: 132 GIPQAYYFGQEGLHNILVIDLLGP-SLEDLFDWCGRRFSIKTVVHVAIQMITLIEELHDH 190
            I + + F ++     ++++     SL  L        S         Q +  ++ LH  
Sbjct: 81  NIVKYHGFIRKSYELYILLEYCANGSLRRLISRSSTGLSENESKTYVTQTLLGLKYLHGE 140

Query: 191 DLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYM 250
            +I+RDIK  N L+   N      V L DFG++ +                +L+GT  +M
Sbjct: 141 GVIHRDIKAANILLSADNT-----VKLADFGVSTIVNSSAL----------TLAGTLNWM 185

Query: 251 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAAN 290
           +      R  S   D+ +LG      L    P+  L  AN
Sbjct: 186 APEILGNRGASTLSDIWSLGATVVEMLTKNPPYHNLTDAN 225

>AFR205C [3397] [Homologous to ScYKL139W (CTK1) - SH]
           (805583..806956) [1374 bp, 457 aa]
          Length = 457

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 83/185 (44%), Gaps = 21/185 (11%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIK---FEPRKTDAPQLKDEYRTYKILSGSE-- 131
           Y+   ++GEG++G +++  N+  N  VA+K    E  +   P      R  K+L   +  
Sbjct: 122 YQRITQVGEGTYGKVYKCRNIYTNKLVALKKLRLETERDGFP--ITSIREIKLLQHCQHE 179

Query: 132 ---GIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELH 188
               I +     Q+ ++  ++ +     L  L       FS     H+  Q++  +E LH
Sbjct: 180 NVSTIAEIMCEAQKTVY--MIFEYADNDLSGLLMNKEIHFSDANCKHLFRQLLKGMEYLH 237

Query: 189 DHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMA-KLYRDPKTKQHIP---YREKKSLS 244
           +  +++RDIK  N LI      +   + + DFG+A K+ ++P     +    YR  + L 
Sbjct: 238 ECRILHRDIKGSNILID-----NRGNLKITDFGLARKMKQEPDYTNRVITLWYRPPELLL 292

Query: 245 GTARY 249
           GT RY
Sbjct: 293 GTTRY 297

>KLLA0E14828g complement(1323743..1324675)
           gi|27526973|emb|CAD36964.1 Kluyveromyces lactis
           serine/threonine-protein kinase KIN28, start by
           similarity
          Length = 310

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 79/189 (41%), Gaps = 25/189 (13%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLKD-----EYRTYKILSGSE 131
           Y   KK GEG++ V++ G        +A+K    +    Q KD       R  K L   +
Sbjct: 10  YTKEKKAGEGTYAVVYLGTKKSTGRSIAVK----EIKTSQFKDGLDMSALREVKFLQELK 65

Query: 132 GIPQA----YYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEEL 187
            +        +   + L+  LV++ L   LE +       FS   +    +  +  +   
Sbjct: 66  HVNVIELVDVFMANDNLN--LVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHC 123

Query: 188 HDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPK---TKQHIP--YREKKS 242
           H + +++RD+KP+N L+     PD  +  + DFG+A+L   P+   T   +   YR  + 
Sbjct: 124 HRNFILHRDLKPNNLLLA----PDGQL-KIADFGLARLMASPQEILTSNVVTRWYRAPEL 178

Query: 243 LSGTARYMS 251
           L G   Y S
Sbjct: 179 LFGAKHYTS 187

>CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 893

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 57/225 (25%), Positives = 95/225 (42%), Gaps = 49/225 (21%)

Query: 76  HYKIGKKIGEGSFGVLFEGVNMINNVPVAIK-------------FEPRKTDAPQLKDEYR 122
           +YKI K+IGEGSFG ++   +      V +K             F  R+ D P +    +
Sbjct: 41  NYKIQKQIGEGSFGKVYLATHRPTKQKVVLKTGDKSDPNVVREVFYHRQFDYPYIT---K 97

Query: 123 TYKILSGSEGIPQA--YYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFS-IKTVVHVAIQ 179
            Y+++     +  A  Y  G+E   ++L    L P+LE     C   F+ I   VH A  
Sbjct: 98  LYEVIVTETKVWMALEYCPGKELYDHLLSKSRL-PTLE-----CAELFAQITGAVHYA-- 149

Query: 180 MITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYRE 239
                   H  + ++RD+K +N L+ +          L DFG     R+  TK  +    
Sbjct: 150 --------HTLNCVHRDLKLENVLLDKNGN-----AKLTDFGFT---RESMTKAVL---- 189

Query: 240 KKSLSGTARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPW 283
            +++ GT  YM+      +     + D+ +LG + +  L G LP+
Sbjct: 190 -ETVCGTTVYMAPEMIQHKPYDGFKVDIWSLGVILYTLLCGCLPF 233

>Scas_667.18
          Length = 437

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 83/175 (47%), Gaps = 48/175 (27%)

Query: 77  YKIGKKIGEGSFGVLFEGV---NMINNVPVAIKFEPRKTDAPQ----LKDEYRTYKILSG 129
           YKI K +G+GS+GV+   +   N  N  PVAIK   + T+  Q    LK   R  K ++ 
Sbjct: 78  YKIIKVLGKGSYGVVCSAMDNKNPANAYPVAIK---KVTNIFQKEILLKRAIRELKFMN- 133

Query: 130 SEGIPQAYYFGQEGLHNILVIDLLGP--------SLEDLFDWCGRRFSIKTVVHVAI--- 178
                  ++ G + + N++ ++++            ++L D     + +  V+H +I   
Sbjct: 134 -------FFQGHKNIVNLIDLEIINENSPYDGLYCYQELID-----YDLAKVIHSSIKLT 181

Query: 179 ---------QMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAK 224
                    Q+++ ++ +H  D+I+RD+KP N L       + N+  + DFG+A+
Sbjct: 182 EFHIQYFMYQILSGLKYIHSADVIHRDLKPGNILCTL----NGNL-KICDFGLAR 231

>Scas_721.132
          Length = 584

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 61/262 (23%), Positives = 104/262 (39%), Gaps = 61/262 (23%)

Query: 75  LHYKIGKKIGEGSFG--VLFEGVN-----MINNVPVAIKFEPRKTD-----APQLKDEY- 121
           L +K  KKIGEG+F   +L+E ++     M+      IK+    TD      PQ  D   
Sbjct: 260 LRWKKVKKIGEGNFSDVLLYESLDQTDPKMMQIAVKRIKYPVEVTDITFRGTPQYNDTLS 319

Query: 122 RTYKILSGSEGIPQAYYFGQ----EGLHNILVI-------DLLG-----PSLEDLFDWCG 165
           R    L+   G+ +   +       G++N + +       DLL      P  + +  +C 
Sbjct: 320 RLESSLTRELGVLKLLDYPCIVKLYGINNPIFVQSKTPLRDLLAKNPALPPCDMIMSYCS 379

Query: 166 R------------RFSIKTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRP------ 207
                           I  +  +  +++  +  LHD+++I+RD+K +N L+  P      
Sbjct: 380 GGDLLAAISRCLGELDIWLIQRLFTELVMAVNYLHDNNIIHRDLKLENILLKYPLEHIIA 439

Query: 208 --NQP---DANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSINTHLGRE-QS 261
             + P     NM+ L DFG+         KQ  P     +  G+  Y+S    +G     
Sbjct: 440 LKDSPVFTSLNMIELADFGLC--------KQIQPGELCTARCGSEDYVSPEILMGVPYDG 491

Query: 262 RRDDMEALGHVFFYFLRGQLPW 283
              D  ALG + +  L  +LP+
Sbjct: 492 HLTDTWALGVILYSILEDRLPF 513

>KLLA0A06776g 612115..614517 some similarities with sp|P36003
           Saccharomyces cerevisiae YKL171w singleton, hypothetical
           start
          Length = 800

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 76/173 (43%), Gaps = 22/173 (12%)

Query: 75  LHYKIGKKIGEGSFGVLFEGV----------NMINNVPVAIKFEPRKTDAPQLKDEYRTY 124
           L +++GK IG G++G++ E            N        IKF+  ++   Q+  E   +
Sbjct: 408 LGHRLGKIIGFGAWGMIRECFPSTDESQNQNNTCCKAMKIIKFKDNRSVKRQVLREISIW 467

Query: 125 KILSGSEGIPQAYYFGQEGLHNILVIDLL--GPSLEDLFDW--CGR-----RFSIKTVVH 175
             LS +  +P   +   + L    + D +  G   + +  W  CG      R   +    
Sbjct: 468 SKLSHNNILPLTKWKLDDDLVAYCLTDKIDHGTLYDLVVSWGECGNSKISLRERCQATSA 527

Query: 176 VAIQMITLIEELHDHDLIYRDIKPDNFLIGR--PNQPDANMVHLIDFGMAKLY 226
           +A+Q+I  ++ +H   + + DIK +N L+ +   N  D  +V L DFGM+  Y
Sbjct: 528 LALQLIDAVQYMHSKFIAHGDIKLENCLLEKKSENYKDWKLV-LCDFGMSHFY 579

>Scas_653.25
          Length = 666

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 51/227 (22%), Positives = 97/227 (42%), Gaps = 36/227 (15%)

Query: 79  IGKKIGEGSFGVLFEGVNMINNVPVAIK-FEPRKTDAPQLKDEYRTYK--ILSGSEGIPQ 135
           + +K+G G+ G + +  N  N+   A+K F+P        + + R  K  ILS     P 
Sbjct: 271 VTQKLGSGANGCVVQLQNHSNDKRFAMKTFKPNPNGETTKQYQKRCIKEFILSSHLSHPN 330

Query: 136 AYYFGQEGLHNILVIDLL-GPS--LEDLFDWCGRRFS--IKTVVHVAI---------QMI 181
                      I  +D+   PS  + ++ +WC   F   + +  H+           Q+ 
Sbjct: 331 I----------IETLDIFYNPSGQISEIMEWCPHDFFNIVMSRTHLLTRRETFCYFKQLC 380

Query: 182 TLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIP-YREK 240
             +  LH   + +RD+K DN +I         ++ LIDFG A +++  K+ +  P     
Sbjct: 381 NGVRYLHTLGIAHRDLKLDNCVITY-----NGILKLIDFGSATIFQLNKSTEEKPELIPS 435

Query: 241 KSLSGTARYMSINTHLGRE---QSRRDDMEALGHVFFYFLRGQLPWQ 284
           + + G+  Y++    L +E    +   D+ +LG +F   +  + PW+
Sbjct: 436 RGIVGSDPYLAPEVLLSKEIPYDASLADVWSLGIIFCAIMLKRFPWR 482

>ABL011C [581] [Homologous to ScYLR362W (STE11) - SH]
           (378259..380364) [2106 bp, 701 aa]
          Length = 701

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 58/233 (24%), Positives = 95/233 (40%), Gaps = 39/233 (16%)

Query: 80  GKKIGEGSFGVLFEGVNMINNVPVAIK---FEP---------------------RKTDAP 115
           G +IG GSFG ++ G+N      +A+K    EP                     + TD P
Sbjct: 418 GARIGSGSFGSVYLGMNAHTGELMAVKQVELEPTTVMASSDDKKSHPSSNAVVKKLTDPP 477

Query: 116 QLKDEYRTYKI----LSGSEGIPQAYYFGQEGLH-NILVIDLLGPSLEDLFDWCGRRFSI 170
           Q      + K+        E I   Y   QEG + NI +  + G S+  + +  G  F  
Sbjct: 478 QDGGRASSTKMNLLKELHHENIVTYYGSSQEGGNLNIFLEYVPGGSVSSMLNSYG-PFEE 536

Query: 171 KTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPK 230
             V +   Q +  +  LH  ++I+RDIK  N LI          V + DFG++K      
Sbjct: 537 PLVKNFTRQTLVGLTYLHRKNIIHRDIKGANLLIDIKGS-----VKITDFGISKKLSPLN 591

Query: 231 TKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 283
            KQ+    ++ SL G+  +M+         + + D+ ++G V      G+ P+
Sbjct: 592 KKQN----KRASLQGSVYWMAPEVVKQVVTTEKADIWSVGCVVVEMFTGKHPF 640

>CAGL0L12474g complement(1345044..1345952) highly similar to
           sp|P17157 Saccharomyces cerevisiae YPL031c
           cyclin-dependent protein kinase, start by similarity
          Length = 302

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 51/239 (21%), Positives = 99/239 (41%), Gaps = 21/239 (8%)

Query: 76  HYKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLKDEYRTYKILS--GSEGI 133
            +K  +K+G G++  +++G+N    V VA+K     ++        R   ++     + I
Sbjct: 5   QFKQLEKLGNGTYATVYKGLNKSTGVYVALKEVKLDSEEGTPSTAIREISLMKELKHDNI 64

Query: 134 PQAYYFGQEGLHNILVIDLLGPSLEDLFDW-----CGRRFSIKTVVHVAIQMITLIEELH 188
            + Y          LV + +   L+   D        R   +  V +   Q++  +   H
Sbjct: 65  VRLYDVIHTENKLTLVFEYMDNDLKKYMDSRTVGNAPRGLEMNLVKYFQWQLLEGLAFCH 124

Query: 189 DHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTAR 248
           ++ +++RD+KP N LI +  Q     + L DFG+A+ +        IP     S   T  
Sbjct: 125 ENKILHRDLKPQNLLITKRGQ-----LKLGDFGLARAF-------GIPVNTFSSEVVTLW 172

Query: 249 YMSINTHLG-REQSRRDDMEALGHVFFYFLRGQLPWQGLKAANN-KLKYEKIGEKKRST 305
           Y + +  +G R  S   D+ + G +    + G+  + G       KL ++K+G    +T
Sbjct: 173 YRAPDVLMGSRTYSTSIDIWSCGCILAEMITGKPLFPGTNDEEQLKLIFDKMGTPNETT 231

>Scas_598.6
          Length = 790

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 52/112 (46%), Gaps = 14/112 (12%)

Query: 173 VVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANM-VHLIDFGMAKLYRDPKT 231
           + ++  +    ++ LHD  +I+RDIK DN L+      D N  V + DFG      D ++
Sbjct: 618 IAYIVRETCQGLKFLHDKHIIHRDIKSDNVLL------DNNARVKITDFGFCAKLTDQRS 671

Query: 232 KQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 283
           K       + ++ GT  +M+      RE   + D+ +LG +    L  + P+
Sbjct: 672 K-------RATMVGTPYWMAPEVVKQREYDEKVDVWSLGIMTIEMLESEPPY 716

>KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732.1
            Kluyveromyces lactis protein kinase C, start by
            similarity
          Length = 1161

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 58/121 (47%), Gaps = 14/121 (11%)

Query: 166  RRFSIKTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKL 225
            RR S++     A +++  ++  HD+ +IYRD+K +N L+     P+ + + + D+G+   
Sbjct: 929  RRLSVRRAKFYAAEVLLSLKYFHDNGVIYRDLKLENILLT----PEGH-IKIADYGLC-- 981

Query: 226  YRDPKTKQHIPYREKKS-LSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 284
                  K ++ Y  K S   GT  +M+     G+  ++  D    G + +  L  Q P+ 
Sbjct: 982  ------KDNMWYGNKTSTFCGTPEFMAPEILKGQAYTKAVDWWTFGVLLYQMLLCQSPFS 1035

Query: 285  G 285
            G
Sbjct: 1036 G 1036

>Kwal_26.9032
          Length = 591

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 46/204 (22%), Positives = 90/204 (44%), Gaps = 29/204 (14%)

Query: 77  YKIGKKIGEGSFGVLFEGVNMINNVPVAIKF-EPRKTDAPQLKDEYRTYKILSGSEG--- 132
           Y + +K+G G F  ++   + ++N  VA+K     K       DE +  + +S  +G   
Sbjct: 105 YVVVRKLGWGHFSTVWLAKDTVSNAHVAMKIVRSDKVYTEAALDEIKLLRRVSTRDGSSS 164

Query: 133 ------------IPQAYYFGQEGLHNILVIDLLGPSLEDLF-DWCGRRFSIKTVVHVAIQ 179
                       +    + G  G H ++V ++LG +L  L   +  R   +  V  +A Q
Sbjct: 165 SLYDSSQHILSLLDSFNHTGPNGEHVVMVFEVLGENLLALIKKYEHRGIPVMYVKQIAKQ 224

Query: 180 MITLIEELH-DHDLIYRDIKPDNFLIGRPN-QPDANMVHLIDFGMAKLYRDPKTKQHIPY 237
           ++  ++ +H    +I+ DIKP+N L+   + +    MV ++D    K  RD +  Q    
Sbjct: 225 LLLGLDYMHRKCGVIHTDIKPENVLMEVGDVEAIVRMVEILD----KRRRDQRKSQ---- 276

Query: 238 REKKSLSGTARYMSINTHLGREQS 261
             +K++  +  + S+ TH  R  +
Sbjct: 277 --RKAVRTSIDHPSVTTHSARSSA 298

>YKL048C (ELM1) [3211] chr11 complement(346859..348781)
           Serine/threonine protein kinase that regulates
           pseudohyphal growth [1923 bp, 640 aa]
          Length = 640

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 60/143 (41%), Gaps = 33/143 (23%)

Query: 184 IEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPY------ 237
           +E LH    I+RDIKP N L+      +  +  L DFG         T Q +P+      
Sbjct: 247 LEYLHSQGCIHRDIKPSNILLDE----EEKVAKLSDFGSCIF-----TPQSLPFSDANFE 297

Query: 238 ----REKKSLSGTARYMSIN-THLGREQSRRD--------DMEALGHVFFYFLRGQLPWQ 284
               RE   + GT  +++    HLG   S+RD        D+ +LG   +  L  +LP+ 
Sbjct: 298 DCFQRELNKIVGTPAFIAPELCHLG--NSKRDFVTDGFKLDIWSLGVTLYCLLYNELPFF 355

Query: 285 GLKAANNKLKYEKIGEKKRSTNV 307
           G    N    Y KI E   S+ +
Sbjct: 356 G---ENEFETYHKIIEVSLSSKI 375

>ACR196C [1243] [Homologous to ScYDL159W (STE7) - SH]
           (692321..693913) [1593 bp, 530 aa]
          Length = 530

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 43/98 (43%), Gaps = 14/98 (14%)

Query: 188 HDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTA 247
            D+ +I+RDIKP N LI          V + DFG++K   D      +         GT+
Sbjct: 328 QDYKIIHRDIKPSNILIN-----SKGFVKICDFGVSKKMIDSIADTFV---------GTS 373

Query: 248 RYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQG 285
            YMS     G   + + D+ +LG +    + G+ P  G
Sbjct: 374 TYMSPERIQGSCYNTKGDVWSLGLMIIELVTGEFPLGG 411

>Sklu_1851.1 YJL106W, Contig c1851 2732-4783 reverse complement
          Length = 683

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 51/199 (25%), Positives = 82/199 (41%), Gaps = 55/199 (27%)

Query: 77  YKIGKKIGEGSFGVLFEG-----VNMIN------------------------NVPVAIKF 107
           Y++ +++G GSFG +        +NMIN                        N  VAIK 
Sbjct: 71  YELVQELGNGSFGSVTLAKAKFNINMINGYQNTLMDQRLIPNVSEENFYNKENGVVAIK- 129

Query: 108 EPRKTDAPQLKDEYRTYKI-----LSGSEGIPQAYYF----GQEGLHNILVIDLLGPSLE 158
               T  P L D  R  +I     +   + + Q Y       Q  LH  +V++ L  +L 
Sbjct: 130 -TMMTRLPTLNDYTRVREIKFILAMPAHKHLVQIYELFIDNAQYQLH--IVMECLEQNLY 186

Query: 159 DLFDWCGRR-FSIKTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQ-------- 209
            L     R  FS+ T+  +  Q++  I  +H H+  +RDIKP+N LI   N+        
Sbjct: 187 QLMRQRKRNVFSLPTLKSILSQILAGIRHIHQHNFFHRDIKPENILISPANRYYSKSWLQ 246

Query: 210 ----PDANMVHLIDFGMAK 224
                +  +V + D+G+A+
Sbjct: 247 EGHFRENYVVKIADYGLAR 265

>ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH]
           (1386601..1388079) [1479 bp, 492 aa]
          Length = 492

 Score = 42.4 bits (98), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 61/126 (48%), Gaps = 20/126 (15%)

Query: 159 DLFDWCGRRFSIKTV-----VHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDAN 213
           DLF +  ++  +  +     + +  Q++  ++ LH   +++RD+K DN L+  P +P + 
Sbjct: 243 DLFSYLAKKDCLAPISETEALVIVYQILQALKFLHSKGIVHRDLKLDNILLCTP-EPCSR 301

Query: 214 MVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMS------INTHLGREQSRRDDME 267
           +V L DFG+AK     + + H       ++ GT  Y +      ++ +  R  SR   ME
Sbjct: 302 IV-LADFGIAKDLPSTRVRMH-------TIVGTPEYCAPEVGFRVDRNSYRNFSRTASME 353

Query: 268 ALGHVF 273
             G+ F
Sbjct: 354 QQGYDF 359

>KLLA0C17160g 1498959..1501454 similar to sp|P53104 Saccharomyces
           cerevisiae YGL180w APG1 essential for autophagocytosis,
           start by similarity
          Length = 831

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 65/276 (23%), Positives = 120/276 (43%), Gaps = 73/276 (26%)

Query: 76  HYKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLKDEYRTYKILSGSEGIPQ 135
           +Y + K+IG+GSF V+++G+++ +   +AIK   R     +LK++    K+L   E +  
Sbjct: 20  NYSVEKEIGKGSFAVVYKGLSLRDGRNIAIKAVSRS----KLKNK----KLLENLE-VEI 70

Query: 136 AYYFGQEGLHNILVIDLLGPS-----------LEDLFDWCGRRFS-------IKTV---- 173
           A     +  H + +ID    S           L DL  +  +R +       IKTV    
Sbjct: 71  AILKKIKHPHIVGLIDCERTSSDFYLIMEYCALGDLTFFIKKRKNLVLKHPLIKTVFEHY 130

Query: 174 ---------------VHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRP----NQP---- 210
                          V+   Q+ + ++ L   +L++RDIKP N L+  P    N P    
Sbjct: 131 PPPSTEHNGLNRVLVVNYLQQLSSALKFLRSKNLVHRDIKPQNLLLCTPLLDYNDPKTFH 190

Query: 211 --------DANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSR 262
                   +  ++ + DFG A+    P T         ++L G+  YM+      ++ + 
Sbjct: 191 ELGFVGIYNLPILKIADFGFARFL--PNTSL------AETLCGSPLYMAPEILNYQKYNA 242

Query: 263 RDDMEALGHVFFYFLRGQLPWQGLKAANNKLKYEKI 298
           + D+ ++G V +    G+ P+   KA+N+   ++KI
Sbjct: 243 KADLWSVGTVLYEMCCGRPPF---KASNHLELFQKI 275

>YPL140C (MKK2) [5306] chr16 complement(287513..289033) MAP kinase
           kinase (MEK) serine/threonine protein kinase, involved
           in cell wall integrity (low-osmolarity) pathway [1521
           bp, 506 aa]
          Length = 506

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 56/127 (44%), Gaps = 14/127 (11%)

Query: 165 GRRFSIKTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAK 224
           G R S + +  +A  ++  +  LH+  +I+RDIKP N L+    +     + L DFG++ 
Sbjct: 311 GGRISERVIGKIAESVLRGLSYLHERKVIHRDIKPQNILLNEKGE-----IKLCDFGVSG 365

Query: 225 LYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 284
              +             + +GT+ YM+     G+  S   D+ +LG        G+ P++
Sbjct: 366 EAVNSLA---------MTFTGTSFYMAPERIQGQPYSVTCDVWSLGLTLLEVAGGRFPFE 416

Query: 285 GLKAANN 291
             K   N
Sbjct: 417 SDKITQN 423

>Scas_477.5
          Length = 703

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 71/154 (46%), Gaps = 12/154 (7%)

Query: 131 EGIPQAYYFGQEGLH-NILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELHD 189
           E I   Y   QEG + NI +  + G S+  + +  G  F    +V+   Q++  +  LH+
Sbjct: 501 ENIVTYYGSSQEGPNLNIFLEYVPGGSVSSMLNNYGP-FEESLIVNFIRQVLIGVAYLHN 559

Query: 190 HDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARY 249
            ++I+RDIK  N LI          V + DFG++K    P +KQ     ++ SL G+  +
Sbjct: 560 KNIIHRDIKGANILIDT-----KGCVKITDFGISKKL-SPLSKQD----KRASLQGSVYW 609

Query: 250 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 283
           M+         + + D+ + G V      G+ P+
Sbjct: 610 MAPEVVKQTATTEKADIWSTGCVVIEMFTGKHPF 643

>CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces
           cerevisiae YOR231w MKK1 ser/thr protein kinase or
           sp|P32491 Saccharomyces cerevisiae YPL140c MKK2, start
           by similarity
          Length = 467

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 59/133 (44%), Gaps = 17/133 (12%)

Query: 154 GPSLEDLFDWC---GRRFSIKTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQP 210
           G SLE ++      G R S K +  ++  ++  +  LH+  +I+RDIKP N L+    Q 
Sbjct: 263 GKSLEAIYKELLSRGGRISEKVLGKISEAVLRGLSYLHEKKVIHRDIKPQNILLNEDGQ- 321

Query: 211 DANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALG 270
               V L DFG++    +             + +GT+ YM+     G+  S   D+ +LG
Sbjct: 322 ----VKLCDFGVSGEAVNSLA---------TTFTGTSYYMAPERIQGQPYSVTCDVWSLG 368

Query: 271 HVFFYFLRGQLPW 283
                  +G  P+
Sbjct: 369 LTILEVAQGHFPF 381

>CAGL0M11748g 1167306..1168649 highly similar to sp|P32485
           Saccharomyces cerevisiae YLR113w HOG1, start by
           similarity
          Length = 447

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 74/161 (45%), Gaps = 14/161 (8%)

Query: 83  IGEGSFGVLFEGVNMINNVPVAIK--FEPRKTDAPQLKDEYRTYKILSG--SEGIPQAYY 138
           +G G+FG++    + + N  VAIK   +P  T A   K  YR  K+L     E +     
Sbjct: 29  VGMGAFGLVCSATDTLTNQQVAIKKIMKPFAT-AVLAKRTYRELKLLKHLRHENLICLQD 87

Query: 139 FGQEGLHNI-LVIDLLGPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELHDHDLIYRDI 197
                L +I  V +L G  L  L     R    + V +   Q++  ++ +H   +++RD+
Sbjct: 88  IFLSPLEDIYFVTELQGTDLHRLLQ--TRPLEKQFVQYFHYQILRGLKYVHSAGVVHRDL 145

Query: 198 KPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYR 238
           KP N LI          + + DFG+A++ +DP+   ++  R
Sbjct: 146 KPSNILINENCD-----LKICDFGLARI-QDPQMTGYVSTR 180

>CAGL0M08360g complement(833220..835520) some similarities with
           sp|P38970 Saccharomyces cerevisiae YJL165c ser/thr
           protein kinase, hypothetical start
          Length = 766

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 43/187 (22%), Positives = 89/187 (47%), Gaps = 32/187 (17%)

Query: 140 GQEGLHNIL-VIDLL--GPSLEDLFDWC--GRRFSIKTVVHVAI--------------QM 180
           G++   NIL +IDLL    +  ++ ++C  G  +S+ T     I              Q+
Sbjct: 528 GEQSAPNILSIIDLLEYNDTFIEVMEFCPAGDLYSLLTARKNKIGKPLHPLEADCFMKQL 587

Query: 181 ITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREK 240
           +  I+ +HDH + + D+KP+N L+  PN     ++ + DFG + +++    ++H+ +  +
Sbjct: 588 LKGIQFMHDHGVAHCDLKPENILL-HPN----GLLKICDFGTSCVFQT-AWERHVHF--Q 639

Query: 241 KSLSGTARYMSINTHLGREQ--SRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLK---Y 295
             L G+  Y++   +  +++   R  D  ++G V+   + G   W+      + L    Y
Sbjct: 640 TGLQGSEPYVAPEEYNPKKEYDPRLVDCWSIGIVYCTMIMGHYLWRNAARGKDSLYDSFY 699

Query: 296 EKIGEKK 302
           E++  KK
Sbjct: 700 EEMASKK 706

>Kwal_14.1273
          Length = 415

 Score = 42.0 bits (97), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 49/219 (22%), Positives = 88/219 (40%), Gaps = 35/219 (15%)

Query: 82  KIGEGSFGVLFEGVNMINNVPVAIKF-----EPRKTD--APQLKDEYRTYKIL-SGSEGI 133
           KI  GSF  ++   +      VA+K      EP      A  +  E    ++L +G   +
Sbjct: 7   KIQSGSFSTVYRAYDTERARDVALKILKKPSEPAMASKLATLVGSELEVLRVLGTGHPNV 66

Query: 134 PQAYYFGQEGLHNILVIDLLGPSLEDLFD----WCGRRFSIKTV----VHVAIQMITLIE 185
                F +     + V++       DL+D    W  +R S + V      V +Q+ + IE
Sbjct: 67  CALLDFYERETCYVFVMEYAARG--DLYDVIRGW--KRHSAERVPVELARVVLQLCSAIE 122

Query: 186 ELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSG 245
             H   + +RDIKP+N L+       A  V L D+G++       T+  +    +    G
Sbjct: 123 YAHSCGIAHRDIKPENVLLD-----SAGNVKLADWGLS-------TRMRVSCDTRI---G 167

Query: 246 TARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 284
           T +Y++   +     +   D  +LG    + + G  P++
Sbjct: 168 TEKYLAPEAYASPHDTFLADFWSLGVTLLFVMFGACPFK 206

>Scas_201.1*
          Length = 274

 Score = 41.6 bits (96), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 26/117 (22%), Positives = 62/117 (52%), Gaps = 9/117 (7%)

Query: 167 RFSIKTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLY 226
           +F+    V++ +Q++  ++ +H  ++++RD+KP+N L   P+  D + + + DFG+AK  
Sbjct: 130 KFTEVDAVNIMVQLLDAVKYIHSQNIVHRDLKPENVLYLDPS--DESQLVIADFGIAK-- 185

Query: 227 RDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 283
            + K+   + ++     +G+  Y++          +  D+ +LG + +  L G  P+
Sbjct: 186 -ELKSNDDLIFKG----AGSLGYVAPEVLTKEGHGKPCDIWSLGVITYTLLSGYSPF 237

>Sklu_2442.21 YLR248W, Contig c2442 39541-41052 reverse complement
          Length = 503

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 59/261 (22%), Positives = 96/261 (36%), Gaps = 63/261 (24%)

Query: 75  LHYKIGKKIGEGSFGVLFEGVN---------MINNVPVAIKF------------EPRKTD 113
           L YK+  K+GEG+F  ++  +            N   VA+K             + + + 
Sbjct: 71  LDYKLINKVGEGAFSKVYRAIPQQDRSRKFLTKNYKQVAVKVISKQELTSQSNTKNKTST 130

Query: 114 APQLKDEYRTYKILSGSEGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGR--RFSIK 171
             Q+  E   +K +S  E I     F + G    ++ +LL     ++F    R   FS  
Sbjct: 131 KEQVLKEITIHKTVSSCENIVSFVDFQETGHFYFIIQELLSGG--EVFGEIVRLTYFSED 188

Query: 172 TVVHVAIQMITLIEELHDHDLIYRDIKPDNFL------IGRPNQP--------------- 210
              HV  Q+   ++ +H   +++RDIKP+N L      I  PNQ                
Sbjct: 189 LSRHVIRQLALAVKHMHSLGIVHRDIKPENLLFEPIEFIPSPNQKFRKSDDPGSKQDEGV 248

Query: 211 --------DANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSR 262
                      ++ L DFG++K      T         K+  GT  Y +         S 
Sbjct: 249 FRPGIGGGGIGIIKLADFGLSKQIYSTNT---------KTPCGTVGYTAPEVVKDERYSM 299

Query: 263 RDDMEALGHVFFYFLRGQLPW 283
           + DM  +G V +  L G  P+
Sbjct: 300 KVDMWGIGCVLYTVLCGFPPF 320

>Scas_640.16
          Length = 505

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 53/119 (44%), Gaps = 14/119 (11%)

Query: 165 GRRFSIKTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAK 224
           G R S K +  ++  ++  +  LH+  +I+RDIKP N L     Q     V L DFG++ 
Sbjct: 307 GGRISEKVLGKISESVLRGLSYLHEQKVIHRDIKPQNILFNEKGQ-----VKLCDFGVSG 361

Query: 225 LYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 283
              +             + +GT+ YM+     G+  S   D+ +LG       +G+ P+
Sbjct: 362 EAVNSLA---------TTFTGTSFYMAPERIQGQPYSVTCDIWSLGLTILEVAQGRFPF 411

>Sklu_2211.5 YBL105C, Contig c2211 10237-13764
          Length = 1175

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/121 (23%), Positives = 58/121 (47%), Gaps = 14/121 (11%)

Query: 166  RRFSIKTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKL 225
            +R S++     A +++  ++  HD+ ++YRD+K +N L+     P+ + + + D+G+   
Sbjct: 943  QRLSVRRAKFYAAEVLLALKYFHDNGVVYRDLKLENILLT----PEGH-IKIADYGLC-- 995

Query: 226  YRDPKTKQHIPYREKKS-LSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 284
                  K  + Y  K S   GT  +M+      +E ++  D  A G + +  L  Q P+ 
Sbjct: 996  ------KDEMWYGNKTSTFCGTPEFMAPEILKEQEYTKSVDWWAFGVLLYQMLLCQSPFS 1049

Query: 285  G 285
            G
Sbjct: 1050 G 1050

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.137    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 15,432,235
Number of extensions: 681579
Number of successful extensions: 2469
Number of sequences better than 10.0: 584
Number of HSP's gapped: 2229
Number of HSP's successfully gapped: 592
Length of query: 528
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 422
Effective length of database: 12,926,601
Effective search space: 5455025622
Effective search space used: 5455025622
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)