Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0D11000g35935418800.0
KLLA0D11022g35935417440.0
Kwal_47.1787239735610501e-142
Kwal_33.145663623578481e-112
YGL039W3483596674e-85
YGL157W3473546623e-84
YOL151W (GRE2)3423576604e-84
Sklu_2327.23463596343e-80
Scas_702.203473606241e-78
YDR541C3443616189e-78
Scas_574.93713566164e-77
CAGL0E05170g3523586128e-77
Scas_674.113463546092e-76
Sklu_2244.23523585954e-74
Scas_538.73473525935e-74
CAGL0E05280g3513555884e-73
Scas_622.143873545792e-71
Scas_550.43433525683e-70
Scas_652.153503565581e-68
Scas_680.63673585424e-66
Scas_630.133493535135e-62
Scas_617.13453565083e-61
Scas_601.53453564771e-56
Kwal_56.238633443584525e-53
KLLA0B14641g1671332572e-26
KLLA0B14663g76711053e-06
YLL056C298401143e-06
YGL001C (ERG26)3492011002e-04
Scas_522.5692190985e-04
Scas_652.19d34159920.002
Sklu_2306.3349207890.004
Kwal_14.77529540880.005
Scas_668.8349216860.010
YBR019C (GAL10)699148850.016
KLLA0E09834g268148810.033
Scas_652.19d134455810.038
Kwal_47.17598346205760.17
YLR290C277101730.37
Kwal_14.244428841700.81
YBR159W34759672.1
CAGL0M08316g964128672.9
KLLA0F08415g688129654.1
KLLA0B06545g14867625.6
AER085C204671647.2
Scas_721.4734446628.0
CAGL0E04554g24073619.4
YJL029C (VPS53)82259629.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D11000g
         (354 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D11000g 938541..939620 similar to sgd|S0005511 Saccharomyce...   728   0.0  
KLLA0D11022g 940600..941679 similar to sgd|S0005511 Saccharomyce...   676   0.0  
Kwal_47.17872                                                         409   e-142
Kwal_33.14566                                                         331   e-112
YGL039W (YGL039W) [1936] chr7 (423965..425011) Protein of unknow...   261   4e-85
YGL157W (YGL157W) [1832] chr7 (209009..210052) Protein of unknow...   259   3e-84
YOL151W (GRE2) [4674] chr15 (43692..44720) alpha-Acetoxy ketone ...   258   4e-84
Sklu_2327.2 YGL157W, Contig c2327 8819-9859                           248   3e-80
Scas_702.20                                                           244   1e-78
YDR541C (YDR541C) [1350] chr4 complement(1519644..1520678) Prote...   242   9e-78
Scas_574.9                                                            241   4e-77
CAGL0E05170g complement(504611..505669) similar to tr|Q12068 Sac...   240   8e-77
Scas_674.11                                                           239   2e-76
Sklu_2244.2 YOL151W, Contig c2244 1821-2879 reverse complement        233   4e-74
Scas_538.7                                                            233   5e-74
CAGL0E05280g complement(511971..513026) similar to tr|Q12068 Sac...   231   4e-73
Scas_622.14                                                           227   2e-71
Scas_550.4                                                            223   3e-70
Scas_652.15                                                           219   1e-68
Scas_680.6                                                            213   4e-66
Scas_630.13                                                           202   5e-62
Scas_617.1                                                            200   3e-61
Scas_601.5                                                            188   1e-56
Kwal_56.23863                                                         178   5e-53
KLLA0B14641g 1287645..1288148 similar to sp|P53183 Saccharomyces...   103   2e-26
KLLA0B14663g 1288500..1288730 similar to sp|Q9UV57 Zygosaccharom...    45   3e-06
YLL056C (YLL056C) [3367] chr12 complement(27409..28305) Protein ...    49   3e-06
YGL001C (ERG26) [1971] chr7 complement(495455..496504) C-3 stero...    43   2e-04
Scas_522.5                                                             42   5e-04
Scas_652.19d                                                           40   0.002
Sklu_2306.3 YGL001C, Contig c2306 4537-5586                            39   0.004
Kwal_14.775                                                            39   0.005
Scas_668.8                                                             38   0.010
YBR019C (GAL10) [212] chr2 complement(276215..278314) UDP-glucos...    37   0.016
KLLA0E09834g complement(872888..873694) similar to sp|Q9ALU7 Ent...    36   0.033
Scas_652.19d1                                                          36   0.038
Kwal_47.17598                                                          34   0.17 
YLR290C (YLR290C) [3681] chr12 complement(717147..717980) Protei...    33   0.37 
Kwal_14.2444                                                           32   0.81 
YBR159W (YBR159W) [344] chr2 (558641..559684) Major 3-ketoreduct...    30   2.1  
CAGL0M08316g 829069..831963 weakly similar to sp|P36003 Saccharo...    30   2.9  
KLLA0F08415g 783785..785851 gi|120930|sp|P09609|GALX_KLULA Kluyv...    30   4.1  
KLLA0B06545g 583095..583541 similar to sp|Q00381 Saccharomyces c...    28   5.6  
AER085C [2590] [Homologous to ScYKL182W (FAS1) - SH] (795193..80...    29   7.2  
Scas_721.47                                                            28   8.0  
CAGL0E04554g 439158..439880 no similarity, hypothetical start          28   9.4  
YJL029C (VPS53) [2881] chr10 complement(388301..390769) Subunit ...    28   9.7  

>KLLA0D11000g 938541..939620 similar to sgd|S0005511 Saccharomyces
           cerevisiae YOL151w GRE2, start by similarity
          Length = 359

 Score =  728 bits (1880), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/354 (100%), Positives = 354/354 (100%)

Query: 1   MSAKVLLTGASGFIALHVLDQLLAAGYEVVGTVRSEEKAEPIKKELAKEHPNGKYQFEVV 60
           MSAKVLLTGASGFIALHVLDQLLAAGYEVVGTVRSEEKAEPIKKELAKEHPNGKYQFEVV
Sbjct: 1   MSAKVLLTGASGFIALHVLDQLLAAGYEVVGTVRSEEKAEPIKKELAKEHPNGKYQFEVV 60

Query: 61  VDIAAPNAFDAVFQKHTDLKYVLHTASPFSFGLTKSNEENYLIPATHGTKSVLESIQKYG 120
           VDIAAPNAFDAVFQKHTDLKYVLHTASPFSFGLTKSNEENYLIPATHGTKSVLESIQKYG
Sbjct: 61  VDIAAPNAFDAVFQKHTDLKYVLHTASPFSFGLTKSNEENYLIPATHGTKSVLESIQKYG 120

Query: 121 KNVEHVIVTSSYAAIMRLDHAGDPNFIHDETSWNPITWEEARENSVTAYIASKKYAEKLA 180
           KNVEHVIVTSSYAAIMRLDHAGDPNFIHDETSWNPITWEEARENSVTAYIASKKYAEKLA
Sbjct: 121 KNVEHVIVTSSYAAIMRLDHAGDPNFIHDETSWNPITWEEARENSVTAYIASKKYAEKLA 180

Query: 181 WDFVKDNNSTFNLTTVNPPYVFGPQKFTFGLAKSSLNTSADIVNQALKTTPEYEGPFNQP 240
           WDFVKDNNSTFNLTTVNPPYVFGPQKFTFGLAKSSLNTSADIVNQALKTTPEYEGPFNQP
Sbjct: 181 WDFVKDNNSTFNLTTVNPPYVFGPQKFTFGLAKSSLNTSADIVNQALKTTPEYEGPFNQP 240

Query: 241 AGLACDVRDVAKLHVLPLGKKEFNGQRLFPVSDTGYGIEEYEKGKFNFEKILRILNEKLP 300
           AGLACDVRDVAKLHVLPLGKKEFNGQRLFPVSDTGYGIEEYEKGKFNFEKILRILNEKLP
Sbjct: 241 AGLACDVRDVAKLHVLPLGKKEFNGQRLFPVSDTGYGIEEYEKGKFNFEKILRILNEKLP 300

Query: 301 ELKGKISPGGIKDNEAELAKLDYYRNKTTTDLTKLTFYKFEDTVYDATKQILDY 354
           ELKGKISPGGIKDNEAELAKLDYYRNKTTTDLTKLTFYKFEDTVYDATKQILDY
Sbjct: 301 ELKGKISPGGIKDNEAELAKLDYYRNKTTTDLTKLTFYKFEDTVYDATKQILDY 354

>KLLA0D11022g 940600..941679 similar to sgd|S0005511 Saccharomyces
           cerevisiae YOL151w GRE2, start by similarity
          Length = 359

 Score =  676 bits (1744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/354 (91%), Positives = 341/354 (96%)

Query: 1   MSAKVLLTGASGFIALHVLDQLLAAGYEVVGTVRSEEKAEPIKKELAKEHPNGKYQFEVV 60
           MSAKVLLTGASGFIALHVLDQLLAAGYEVVGTVRSEEKAEPIKKELAKEHPNGKYQFEVV
Sbjct: 1   MSAKVLLTGASGFIALHVLDQLLAAGYEVVGTVRSEEKAEPIKKELAKEHPNGKYQFEVV 60

Query: 61  VDIAAPNAFDAVFQKHTDLKYVLHTASPFSFGLTKSNEENYLIPATHGTKSVLESIQKYG 120
           VDIAAPNAFDAVFQKHTDLKYVLHTASPFSFGLTKSNEENYLIPATHGTKSVLESIQKYG
Sbjct: 61  VDIAAPNAFDAVFQKHTDLKYVLHTASPFSFGLTKSNEENYLIPATHGTKSVLESIQKYG 120

Query: 121 KNVEHVIVTSSYAAIMRLDHAGDPNFIHDETSWNPITWEEARENSVTAYIASKKYAEKLA 180
           KNVEHV+VTSS+AAI+    +GDP FI+DET+WNP+ WE+ARE++ T+Y+ASKKYAEKLA
Sbjct: 121 KNVEHVVVTSSFAAIVHRHRSGDPTFINDETTWNPVIWEDAREDAATSYVASKKYAEKLA 180

Query: 181 WDFVKDNNSTFNLTTVNPPYVFGPQKFTFGLAKSSLNTSADIVNQALKTTPEYEGPFNQP 240
           WDFVKDNNSTFNLTTVNPPYVFGPQKFTFGLA++SLNTSAD VN+ALKTTPEYEGPFNQP
Sbjct: 181 WDFVKDNNSTFNLTTVNPPYVFGPQKFTFGLARASLNTSADFVNKALKTTPEYEGPFNQP 240

Query: 241 AGLACDVRDVAKLHVLPLGKKEFNGQRLFPVSDTGYGIEEYEKGKFNFEKILRILNEKLP 300
           AG+ACDVRDVAKLHVLPLGKKEFNGQRLFPVSDTGYGIEEYEKGKFNFEKILRILNEKLP
Sbjct: 241 AGVACDVRDVAKLHVLPLGKKEFNGQRLFPVSDTGYGIEEYEKGKFNFEKILRILNEKLP 300

Query: 301 ELKGKISPGGIKDNEAELAKLDYYRNKTTTDLTKLTFYKFEDTVYDATKQILDY 354
           ELKGKISPGGIKDNEAEL+KL YYRNK TTD TKLTFYK EDT+YDA KQILDY
Sbjct: 301 ELKGKISPGGIKDNEAELSKLTYYRNKITTDSTKLTFYKLEDTIYDAAKQILDY 354

>Kwal_47.17872
          Length = 397

 Score =  409 bits (1050), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 193/356 (54%), Positives = 264/356 (74%), Gaps = 2/356 (0%)

Query: 1   MSAKVLLTGASGFIALHVLDQLLAAGYEVVGTVRSEEKAEPIKKELAKEHPNGKYQFEVV 60
           M  KVL++G +GF+ALHVLD LL+  + V+GTVRS+EKA+ ++K   K +P  +   E+V
Sbjct: 37  MDEKVLVSGCNGFLALHVLDVLLSEKFHVIGTVRSQEKADLVQKSFKKLYPYAQLDIELV 96

Query: 61  VDIAAPNAFDAVFQKHTDLKYVLHTASPFSFGLTKSNEENYLIPATHGTKSVLESIQKYG 120
            DI    AFD VF+KH D+++VLHTAS FSFG  +S EE YL+PAT GT+S+LES  K G
Sbjct: 97  KDITQKGAFDGVFEKHPDIQHVLHTASNFSFGHDQSTEETYLVPATKGTRSILESTLKLG 156

Query: 121 KNVEHVIVTSSYAAIMRLDHAGDPNFIHDETSWNPITWEEARENSVTAYIASKKYAEKLA 180
           K V+  ++TSS+A+I+  DHAGD +FIH E +WNPITWE+A+ N  +AY+ASKK AE  A
Sbjct: 157 KQVKRFVLTSSFASILNADHAGDSSFIHTEATWNPITWEQAKGNEFSAYVASKKLAETTA 216

Query: 181 WDFVKDNNST--FNLTTVNPPYVFGPQKFTFGLAKSSLNTSADIVNQALKTTPEYEGPFN 238
           WDF+K++     F LTTV PPY++GPQ F +G+  ++LNTSA+IVN+AL+TTPE++GPF+
Sbjct: 217 WDFLKEHEKEVGFTLTTVCPPYIWGPQVFEWGVQGATLNTSAEIVNKALQTTPEFKGPFD 276

Query: 239 QPAGLACDVRDVAKLHVLPLGKKEFNGQRLFPVSDTGYGIEEYEKGKFNFEKILRILNEK 298
           +P GLACDVRDVA LH+LPL  ++  G+RLFPVS +G     Y+ GKFN +++L +LN++
Sbjct: 277 EPNGLACDVRDVALLHMLPLRNEKLAGERLFPVSGSGIKQHNYKNGKFNLQRVLEVLNKQ 336

Query: 299 LPELKGKISPGGIKDNEAELAKLDYYRNKTTTDLTKLTFYKFEDTVYDATKQILDY 354
            PEL+GKI+ G I+DNE  L  +  + N  T++LT + F   E TV+DA KQILDY
Sbjct: 337 FPELQGKIAKGTIEDNEKALGIVFEFNNDKTSELTGIEFKPLEVTVHDAVKQILDY 392

>Kwal_33.14566
          Length = 362

 Score =  331 bits (848), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 166/357 (46%), Positives = 228/357 (63%), Gaps = 3/357 (0%)

Query: 1   MSAKVLLTGASGFIALHVLDQLLAAGYEVVGTVRSEEKAEPIKKELAKEHPNGKYQFEVV 60
           M  KVL+TGASG+IA+H+++ L +  Y VV TV S E A  I       +P       VV
Sbjct: 1   MDEKVLVTGASGYIAMHIVNILQSERYHVVATVESAEVARRIATSYEHYYPYAVLDVLVV 60

Query: 61  VDIAAPNAFDAVFQKHTDLKYVLHTASPFSFGLTKSNEENYLIPATHGTKSVLESIQKYG 120
            D+ AP+AF+ VFQ+H D+++V+HTA     G  K   E YL+PAT GT++VL+SI+ +G
Sbjct: 61  PDVTAPDAFEPVFQQHPDIRHVIHTAPAAPLGNAKDTREAYLVPATEGTRNVLQSIRNHG 120

Query: 121 KNVEHVIVTSSYAAIMRLDHAGDPNFIHDETSWNPITWEEARENSVTAYIASKKYAEKLA 180
             V  V++TSS+AA+M LDHA DP  +  ETSWNP+TWE A+ ++  AY ASK+ AE+L 
Sbjct: 121 PQVSRVVITSSFAALMDLDHAADPQCVISETSWNPVTWEAAQHSNSKAYAASKRIAEQLV 180

Query: 181 WDFVKD--NNSTFNLTTVNPPYVFGPQKFTFGLAKSSLNTSADIVNQALKTTPEYEGPFN 238
           WD+ ++  ++  F LTTVNPPY+FGP  F + L +   NT+A  + +ALK TP+  GPF 
Sbjct: 181 WDWYREHQHDVRFTLTTVNPPYMFGPHVFDWELERPEWNTTACFIKEALKLTPDSPGPFI 240

Query: 239 QPAGLACDVRDVAKLHVLPLGKKEFNGQRLFPVSDTGYGIEEYEKGKFNFEKILRILNEK 298
           +P G+ CDVRD A +HVLPL   +  GQRLFPV+ TG     YE GKFNF++IL I+N +
Sbjct: 241 KPRGICCDVRDAALIHVLPLRNSDLAGQRLFPVNGTGIKQHSYEDGKFNFQRILDIMNAE 300

Query: 299 LPELKGKISPGGI-KDNEAELAKLDYYRNKTTTDLTKLTFYKFEDTVYDATKQILDY 354
            P ++  I  G     N+  L +L  Y N  T  LT + F  F  ++ DATKQIL +
Sbjct: 301 FPNIRESIPEGNSGAANQENLNQLTRYNNDDTCQLTGMEFKPFALSLRDATKQILQF 357

>YGL039W (YGL039W) [1936] chr7 (423965..425011) Protein of unknown
           function, member of a family (GRE2, YGL039W, YGL157W,
           YDR541C) having similarity to plant
           dihydroflavonol-4-reductases [1047 bp, 348 aa]
          Length = 348

 Score =  261 bits (667), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 156/359 (43%), Positives = 214/359 (59%), Gaps = 33/359 (9%)

Query: 5   VLLTGASGFIALHVLDQLLAAGYEVVGTVRSEEKAEPIKKELAKEHPNGKYQFEVVVDIA 64
           V ++GA+GFIALHV+D LL  GY+V+G+ RS+EK + + K+  K +PN     E+V DIA
Sbjct: 8   VFVSGATGFIALHVVDDLLKTGYKVIGSGRSQEKNDGLLKKF-KSNPN--LSMEIVEDIA 64

Query: 65  APNAFDAVFQKH-TDLKYVLHTASPFSFGLTKSNEENYLIPATHGTKSVLESIQKYGKN- 122
           APNAFD VFQKH  ++K VLH ASP  F  T   E++ LIPA +GTKS+LE+I+ Y  + 
Sbjct: 65  APNAFDKVFQKHGKEIKVVLHIASPVHFNTTDF-EKDLLIPAVNGTKSILEAIKNYAADT 123

Query: 123 VEHVIVTSSYAAIMRLDHAGDPNFIHDETSWNPITWEEARENSVTAYIASKKYAEKLAWD 182
           VE V++TSS AA+       D +F+ +E SWN  TWE  + N+V+AY  SKK+AEK AWD
Sbjct: 124 VEKVVITSSVAALASPGDMKDTSFVVNEESWNKDTWESCQANAVSAYCGSKKFAEKTAWD 183

Query: 183 FVKDNNST--FNLTTVNPPYVFGPQKFTFGLAKSSLNTSADIVNQALKTTP-----EYEG 235
           F+++N S+  F L+T+NP +VFGPQ F   L ++ +N+S+ I+   +          Y G
Sbjct: 184 FLEENQSSIKFTLSTINPGFVFGPQLFADSL-RNGINSSSAIIANLVSYKLGDNFYNYSG 242

Query: 236 PFNQPAGLACDVRDVAKLHVLPLGKKEFNGQRLFPVSDTGYGIEEYEKGKFNFEKILRIL 295
           PF        DVRDV+K H+L   K E  GQRLF   D            F  ++ L IL
Sbjct: 243 PF-------IDVRDVSKAHLLAFEKPECAGQRLFLCEDM-----------FCSQEALDIL 284

Query: 296 NEKLPELKGKISPGGIKDNEAELAK-LDYYRNKTTTDLTKLTFYKFEDTVYDATKQILD 353
           NE+ P+LKGKI+ G        L K      N+ T +L    F KF D + D   Q+L+
Sbjct: 285 NEEFPQLKGKIATGEPGSGSTFLTKNCCKCDNRKTKNLLGFQFNKFRDCIVDTASQLLE 343

>YGL157W (YGL157W) [1832] chr7 (209009..210052) Protein of unknown
           function, member of a family (GRE2, YGL039W, YGL157W,
           YDR541C) having similarity to plant
           dihydroflavonol-4-reductases [1044 bp, 347 aa]
          Length = 347

 Score =  259 bits (662), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 154/354 (43%), Positives = 217/354 (61%), Gaps = 23/354 (6%)

Query: 5   VLLTGASGFIALHVLDQLLAAGYEVVGTVRSEEKAEPIKKELAKEHPNGKYQFEVVVDIA 64
           V ++GA+GFIALH+++ LL AGY V+G+ RS+EK + +   L K + N K   E+V DIA
Sbjct: 7   VFVSGATGFIALHIMNDLLKAGYTVIGSGRSQEKNDGL---LKKFNNNPKLSMEIVEDIA 63

Query: 65  APNAFDAVFQKH-TDLKYVLHTASPFSFGLTKSNEENYLIPATHGTKSVLESIQKYGKN- 122
           APNAFD VF+KH  ++K VLHTASPF F  T + E++ L PA +GTKS+LE+I+KY  + 
Sbjct: 64  APNAFDEVFKKHGKEIKIVLHTASPFHFE-TTNFEKDLLTPAVNGTKSILEAIKKYAADT 122

Query: 123 VEHVIVTSSYAAIMRLDHAGDPNFIHDETSWNPITWEEARENSVTAYIASKKYAEKLAWD 182
           VE VIVTSS AA++        + +  E SWN  TW+  + N+V AY  SKK+AEK AW+
Sbjct: 123 VEKVIVTSSTAALVTPTDMNKGDLVITEESWNKDTWDSCQANAVAAYCGSKKFAEKTAWE 182

Query: 183 FVKDNNST--FNLTTVNPPYVFGPQKFTFGLAKSSLNTSADIVNQALKTTPEYEGPFNQP 240
           F+K+N S+  F L+T+NP +VFGPQ F   L K  +NTS+ IV++ + +  +  G F   
Sbjct: 183 FLKENKSSVKFTLSTINPGFVFGPQMFADSL-KHGINTSSGIVSELIHS--KVGGEFYNY 239

Query: 241 AGLACDVRDVAKLHVLPLGKKEFNGQRLFPVSDTGYGIEEYEKGKFNFEKILRILNEKLP 300
            G   DVRDV+K H++ + K E  GQRL              +G F  ++I+ ILNE+ P
Sbjct: 240 CGPFIDVRDVSKAHLVAIEKPECTGQRLV-----------LSEGLFCCQEIVDILNEEFP 288

Query: 301 ELKGKISPGGIKDNEAELAKLDY-YRNKTTTDLTKLTFYKFEDTVYDATKQILD 353
           +LKGKI+ G      + L K    + N  T  L    FY  +D + D   Q+L+
Sbjct: 289 QLKGKIATGEPATGPSFLEKNSCKFDNSKTKKLLGFQFYNLKDCIVDTAAQMLE 342

>YOL151W (GRE2) [4674] chr15 (43692..44720) alpha-Acetoxy ketone
           reductase involved in diamide tolerance and induced by
           osmotic stress, member of a family (Gre2p, Ygl039p,
           Ygl157p, Ydr541p) with similarity to plant
           dihydroflavonol-4-reductases [1029 bp, 342 aa]
          Length = 342

 Score =  258 bits (660), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 154/357 (43%), Positives = 209/357 (58%), Gaps = 28/357 (7%)

Query: 5   VLLTGASGFIALHVLDQLLAAGYEVVGTVRSEEKAEPIKKELAKEHPNGKYQFEVVVDIA 64
           V ++GA+GFIA H++D LL   Y+V+G+ RS+EKAE + +       N K+  EVV DI+
Sbjct: 3   VFVSGANGFIAQHIVDLLLKEDYKVIGSARSQEKAENLTEAFGN---NPKFSMEVVPDIS 59

Query: 65  APNAFDAVFQKH-TDLKYVLHTASPFSFGLTKSNEENYLIPATHGTKSVLESIQKYGKN- 122
             +AFD VFQKH  D+K VLHTASPF F +T S E + LIPA +G K +L SI+KY  + 
Sbjct: 60  KLDAFDHVFQKHGKDIKIVLHTASPFCFDITDS-ERDLLIPAVNGVKGILHSIKKYAADS 118

Query: 123 VEHVIVTSSYAAIMRLDHAGDPNFIHDETSWNPITWEEARENSVTAYIASKKYAEKLAWD 182
           VE V++TSSYAA+  +    D +   +E SWNP TWE  + + V AY  SKK+AEK AW+
Sbjct: 119 VERVVLTSSYAAVFDMAKENDKSLTFNEESWNPATWESCQSDPVNAYCGSKKFAEKAAWE 178

Query: 183 FVKDNNST--FNLTTVNPPYVFGPQKFTFGLAKSSLNTSADIVNQALKTTPEYEGPFNQP 240
           F+++N  +  F LT VNP YVFGPQ F   + K  LNTS ++VN  +  +PE + P  + 
Sbjct: 179 FLEENRDSVKFELTAVNPVYVFGPQMFDKDV-KKHLNTSCELVNSLMHLSPEDKIP--EL 235

Query: 241 AGLACDVRDVAKLHVLPLGKKEFNGQRLFPVSDTGYGIEEYEKGKFNFEKILRILNEKLP 300
            G   DVRDVAK H++   K+E  GQRL              + +F  + +L ILNE  P
Sbjct: 236 FGGYIDVRDVAKAHLVAFQKRETIGQRLI-----------VSEARFTMQDVLDILNEDFP 284

Query: 301 ELKGKI---SPGGIKDNEAELAKLDYYRNKTTTDLTKLTFYKFEDTVYDATKQILDY 354
            LKG I    PG    +    A LD   NK +  L    F   ++T+ D   QIL +
Sbjct: 285 VLKGNIPVGKPGSGATHNTLGATLD---NKKSKKLLGFKFRNLKETIDDTASQILKF 338

>Sklu_2327.2 YGL157W, Contig c2327 8819-9859
          Length = 346

 Score =  248 bits (634), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 154/359 (42%), Positives = 220/359 (61%), Gaps = 26/359 (7%)

Query: 1   MSAK--VLLTGASGFIALHVLDQLLAAGYEVVGTVRSEEKAEPIKKELAKEHPNGKYQFE 58
           MS+K  V ++GASG+IALHV+++LL AGY+V+G+ RS++KA  ++K+    +PN K    
Sbjct: 1   MSSKPTVFVSGASGYIALHVVNELLNAGYKVIGSTRSDKKAAEVEKKFGN-NPNLKTV-- 57

Query: 59  VVVDIAAPNAFDAVFQKH-TDLKYVLHTASPFSFGLTKSNEENYLIPATHGTKSVLESIQ 117
           +V DIA P AFD  F+++ +++K VLH ASPF F  T+  E++ L+PA +GTKS+LES++
Sbjct: 58  IVPDIAEPGAFDHAFEEYGSEIKVVLHVASPFFFDTTEY-EKDLLLPAVNGTKSILESVK 116

Query: 118 KYG-KNVEHVIVTSSYAAIMRLDHAGDPNFIHDETSWNPITWEEARENSVTAYIASKKYA 176
           KY  + VE+V+VTSS AAI+      +PN +  E  WN  TWE A  + VTAY ASKK+A
Sbjct: 117 KYAPQTVENVVVTSSLAAIVSPKRMAEPNALVTEKDWNDTTWEGAGADPVTAYCASKKFA 176

Query: 177 EKLAWDFVKDNNST--FNLTTVNPPYVFGPQKFTFGLAKSSLNTSADIVNQALKTTPEYE 234
           E+ AW F+++N S   F LTTVNP YVFGPQ  +       LNTS +++N  + + P   
Sbjct: 177 EEAAWKFLEENKSIVKFRLTTVNPGYVFGPQ-LSSDSVGDVLNTSCELINGIVHSKP--- 232

Query: 235 GPFNQP-AGLACDVRDVAKLHVLPLGKKEFNGQRLFPVSDTGYGIEEYEKGKFNFEKILR 293
           G   QP +G   DVRDVAK H+L   K+E  G+RL  V           +G F+ +++  
Sbjct: 233 GSEIQPISGPYIDVRDVAKAHLLAFEKEETFGKRLMLV-----------EGAFSLQQVAD 281

Query: 294 ILNEKLPELKGKISPGGIKDNEAELAKLDYYRNKTTTDLTKLTFYKFEDTVYDATKQIL 352
           I+NE+ P+LKG ++ G     E  L K   Y    T  +        ++TVYD   QIL
Sbjct: 282 IINEEFPQLKGNVTTGEPGTGEELLNKSAKYDPSKTKAILGFKLRNLKETVYDTVDQIL 340

>Scas_702.20
          Length = 347

 Score =  244 bits (624), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 151/360 (41%), Positives = 204/360 (56%), Gaps = 24/360 (6%)

Query: 1   MSAK--VLLTGASGFIALHVLDQLLAAGYEVVGTVRSEEKAEPIKKELAKEHPNGKYQFE 58
           MSAK  V ++GA+G+IALHV+D LL  GY V+G+VRS+EKA+ I KE + +        E
Sbjct: 1   MSAKATVFVSGATGYIALHVVDNLLKEGYSVIGSVRSQEKADHILKEFSND---CNLTLE 57

Query: 59  VVVDIAAPNAFDAVFQKH-TDLKYVLHTASPFSFGLTKSNEENYLIPATHGTKSVLESIQ 117
           +V DI+A +AFD VF++H  D+K V+HTASP  F   K  +++ LIPA +GTKS+LESI+
Sbjct: 58  IVPDISALDAFDDVFKRHGKDIKVVIHTASPVVFD-PKDLDKDLLIPAINGTKSILESIK 116

Query: 118 KYGKN-VEHVIVTSSYAAIMRLDHAGDPNFIHDETSWNPITWEEARENSVTAYIASKKYA 176
           KY  + VE+V++TSS AA  +     D     DE SWN IT EEA E    AY ASK +A
Sbjct: 117 KYAADTVENVVITSSLAAQRKPSETNDSTVTIDENSWNNITMEEAHECVRNAYSASKVFA 176

Query: 177 EKLAWDFVKDNNST--FNLTTVNPPYVFGPQKFTFGLAKSSLNTSADIVNQALKTTPEYE 234
           EK AW+F+K+N     F LTTV P +VFGPQ F    +KS  N + +IV        E E
Sbjct: 177 EKAAWEFLKNNADVVKFKLTTVMPGFVFGPQTFV-DRSKSKFNHTIEIVRAIANAKTEDE 235

Query: 235 GPFNQPAGLACDVRDVAKLHVLPLGKKEFNGQRLFPVSDTGYGIEEYEKGKFNFEKILRI 294
               Q +G   DVRDVA+ H+L   KKE  G+RL                 F  + IL +
Sbjct: 236 --LYQCSGTYVDVRDVARAHLLAFQKKECAGERL-----------SLSTSMFCTQSILNV 282

Query: 295 LNEKLPELKGKISPGGIKDNEAELAKLDYYRNKTTTDLTKLTFYKFEDTVYDATKQILDY 354
           +NE  P+LKGKI+ G        L  +  + N  T  L    F     ++ D   Q+ ++
Sbjct: 283 INEDFPQLKGKITEGDPASENETLDNMMSFNNDKTKKLLGFDFIPLRKSIDDTVNQLFEF 342

>YDR541C (YDR541C) [1350] chr4 complement(1519644..1520678) Protein
           with high similarity to S. cerevisiae Gre2p, which is an
           alpha-acetoxy ketone reductase that is involved in
           diamide tolerance and is induced by osmotic stress [1035
           bp, 344 aa]
          Length = 344

 Score =  242 bits (618), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 149/361 (41%), Positives = 204/361 (56%), Gaps = 32/361 (8%)

Query: 1   MSAKVLLTGASGFIALHVLDQLLAAGYEVVGTVRSEEKAEPIKKELAKEHPNGKYQFEVV 60
           MS  VL++GASGFIALH+L QLL   Y+V+GTVRS EK   + ++  + +PN     E+V
Sbjct: 1   MSNTVLVSGASGFIALHILSQLLKQDYKVIGTVRSHEKEAKLLRQF-QHNPN--LTLEIV 57

Query: 61  VDIAAPNAFDAVFQKH-TDLKYVLHTASPFSFGLTKSNEENYLIPATHGTKSVLESIQKY 119
            DI+ PNAFD V QK   +++YVLHTASPF +  T+  E++ LIPA  GTK++L SI+KY
Sbjct: 58  PDISHPNAFDKVLQKRGREIRYVLHTASPFHYDTTEY-EKDLLIPALEGTKNILNSIKKY 116

Query: 120 GKN-VEHVIVTSSYAAIMRLDHAGDPNFIHDETSWNPITWEEARENSVTAYIASKKYAEK 178
             + VE V+VTSS  AI+ L    DP+ +  E SWN  TWE  + + + AY ASKK+AEK
Sbjct: 117 AADTVERVVVTSSCTAIITLAKMDDPSVVFTEESWNEATWESCQIDGINAYFASKKFAEK 176

Query: 179 LAWDFVKDNNS--TFNLTTVNPPYVFGPQKFTFGLAKSSLNTSADIVNQALKT-----TP 231
            AW+F K+N     F LTTVNP  +FGPQ F   +    LNTS +++N  + T      P
Sbjct: 177 AAWEFTKENEDHIKFKLTTVNPSLLFGPQLFDEDV-HGHLNTSCEMINGLIHTPVNASVP 235

Query: 232 EYEGPFNQPAGLACDVRDVAKLHVLPLGKKEFNGQRLFPVSDTGYGIEEYEKGKFNFEKI 291
           ++   F        DVRDVA  H+    K+   G+RL   +           GKF  + I
Sbjct: 236 DFHSIF-------IDVRDVALAHLYAFQKENTAGKRLVVTN-----------GKFGNQDI 277

Query: 292 LRILNEKLPELKGKISPGGIKDNEAELAKLDYYRNKTTTDLTKLTFYKFEDTVYDATKQI 351
           L ILNE  P+L+G I  G     +  + +     N  T  +    F    ++V+D   QI
Sbjct: 278 LDILNEDFPQLRGLIPLGKPGTGDQVIDRGSTTDNSATRKILGFEFRSLHESVHDTAAQI 337

Query: 352 L 352
           L
Sbjct: 338 L 338

>Scas_574.9
          Length = 371

 Score =  241 bits (616), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 155/356 (43%), Positives = 213/356 (59%), Gaps = 28/356 (7%)

Query: 5   VLLTGASGFIALHVLDQLLAAGYEVVGTVRSEEKAEPIKKELAKEHPNGKYQFEVVVDIA 64
           V ++GASGFIALHV++ LL AGY+V+G+ RS+EK + +  +  K HP+      +V DI+
Sbjct: 32  VFVSGASGFIALHVVNDLLNAGYKVIGSARSQEKCDQLLAKF-KNHPS--LSMVIVPDIS 88

Query: 65  APNAFDAVFQKH-TDLKYVLHTASPFSFGLTKSNEENYLIPATHGTKSVLESIQKYG-KN 122
             NAFD VF+K+  ++K VLHTASPF F +    E++ LIPA +GTKS+L +I++Y  + 
Sbjct: 89  DLNAFDDVFKKYGKEIKIVLHTASPFRFDVNDY-EKDLLIPALNGTKSILNAIKQYAAQT 147

Query: 123 VEHVIVTSSYAAIMRLDHAGDPNFIHDETSWNPITWEEARENSVTAYIASKKYAEKLAWD 182
           VE V++TSS AA +   +  D +   DETSWN  TWE  + + V+AY ASK +AEK AWD
Sbjct: 148 VERVVITSSMAAQLNTIYMNDKSITVDETSWNDATWEGCQTDPVSAYCASKGFAEKAAWD 207

Query: 183 FVKDNNST--FNLTTVNPPYVFGPQKFTFGLAKSSLNTSADIVNQALKTTPEYEGPFNQP 240
           F+K+N     F L+TV P YVFGPQ F    +K  LNTS++I+NQ +    + E    Q 
Sbjct: 208 FLKENKDQVKFKLSTVLPVYVFGPQLFP-EPSKKVLNTSSEIINQIVNADKDTE--LMQM 264

Query: 241 AGLACDVRDVAKLHVLPLGKKEFNGQRLFPVSDTGYGIEEYEKGKFNFEKILRILNEKLP 300
            G   DVRDVAK H+L   K E  G+RL     + YG      G F+ +  L I+NE  P
Sbjct: 265 NGGFIDVRDVAKAHLLAFQKDECAGERL-----SLYG------GMFSTQDFLDIINEDFP 313

Query: 301 ELKGKI---SPGGIKDNEAELAKLDYYRNKTTTDLTKLTFYKFEDTVYDATKQILD 353
           +LKGKI    PG  KD      K++   N+ T  L    F    D V  + +QIL+
Sbjct: 314 QLKGKIPVGKPGTGKDVIENSYKIN---NERTKKLLGFEFINKRDCVDASVQQILE 366

>CAGL0E05170g complement(504611..505669) similar to tr|Q12068
           Saccharomyces cerevisiae YOL151w GRE2, start by
           similarity
          Length = 352

 Score =  240 bits (612), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 150/358 (41%), Positives = 205/358 (57%), Gaps = 30/358 (8%)

Query: 5   VLLTGASGFIALHVLDQLLAAGYEVVGTVRSEEKAEPIKKELAKEHPNGKYQFEVVVDIA 64
           V ++GA+GFIA HV+ QLL   Y+V+G+VRS EK + +K  + K    G + +E+V DI+
Sbjct: 10  VFVSGATGFIAQHVVRQLLDQNYKVIGSVRSAEKGDHLKNVIFK---GGDFNYEIVKDIS 66

Query: 65  APNAFDAVFQKH-TDLKYVLHTASPFSFGLTKSNEENYLIPATHGTKSVLESIQKYG-KN 122
            P AFD VF+KH  D+K VLHTASPF F  T   E++ LIPA +GTK +LESI+KY  + 
Sbjct: 67  DPTAFDHVFEKHGKDIKVVLHTASPFHFNTTDI-EKDLLIPAVNGTKGILESIKKYAAQT 125

Query: 123 VEHVIVTSSYAA---IMRLDHAGDPNFIHDETSWNPITWEEARENSVTAYIASKKYAEKL 179
           VE V+VTSS+AA    + + +A D +    E SWN  TWE  + + +  Y  SKK+AEK 
Sbjct: 126 VERVVVTSSFAANTSTVDMFYAKDSSKTITEESWNQDTWESCQSDPIRGYCGSKKFAEKA 185

Query: 180 AWDFVKDNNST--FNLTTVNPPYVFGPQKFTFGLAKSSLNTSADIVNQALKTTPEYEGPF 237
           AWDF   N  +  F L+ +NP YVFGPQ +     K  LNTS++++N  +    + + P 
Sbjct: 186 AWDFYNANKDSVKFKLSIINPVYVFGPQNYV-EPGKKILNTSSEVINSLVHL--KKDDPL 242

Query: 238 NQPAGLACDVRDVAKLHVLPLGKKEFNGQRLFPVSDTGYGIEEYEKGKFNFEKILRILNE 297
            + AG   DVRDVAK H+L   K E   QRL               G F  + +L I+NE
Sbjct: 243 PEFAGGHIDVRDVAKAHILAFQKDELIEQRLM-----------LHAGLFTTQTLLDIINE 291

Query: 298 KLPELKGKISPG--GIKDNEAELAKLDYYRNKTTTDLTKLTFYKFEDTVYDATKQILD 353
           + PELKGKI  G  G  + +  L  +D   N  T  L    F   +  +YD   QIL+
Sbjct: 292 QFPELKGKIPAGKPGTGNPDDALTPVD---NSKTKKLLGFEFIDLKKDLYDTISQILE 346

>Scas_674.11
          Length = 346

 Score =  239 bits (609), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 148/354 (41%), Positives = 212/354 (59%), Gaps = 24/354 (6%)

Query: 5   VLLTGASGFIALHVLDQLLAAGYEVVGTVRSEEKAEPIKKELAKEHPNGKYQFEVVVDIA 64
           V ++GA+GFIALH+++ LL AGY V+G+ RS+EK     K L K   N     EVV DI+
Sbjct: 7   VFVSGATGFIALHIVNDLLNAGYRVIGSARSQEKC---GKLLEKFGNNPSLSMEVVKDIS 63

Query: 65  APNAFDAVFQKHT-DLKYVLHTASPFSFGLTKSNEENYLIPATHGTKSVLESIQKYG-KN 122
             NAFD VF+KH  D+  VLHTASPF F  T+  E++ +IPA +GTKS+  +I+KYG + 
Sbjct: 64  DLNAFDEVFKKHAKDITIVLHTASPFRFDTTEY-EKDLIIPAVNGTKSIFNAIKKYGAQT 122

Query: 123 VEHVIVTSSYAAIMRLDHAGDPNFIHDETSWNPITWEEARENSVTAYIASKKYAEKLAWD 182
           VE V+VTSS AA ++  +      I DE++WN   W     ++VTAY ASK +AE++AWD
Sbjct: 123 VERVVVTSSGAAQIQPAYCNRDGLIVDESTWNDCAWANCTTDAVTAYCASKTFAERVAWD 182

Query: 183 FVKDNNST--FNLTTVNPPYVFGPQKFTFGLAKSSLNTSADIVNQALKTTPEYEGPFNQP 240
           F+++N     F L+TV P  VFGPQ F    +K++LNTS++I+N+ + T  + E  ++Q 
Sbjct: 183 FLRENKGQVKFKLSTVMPVNVFGPQMFP-EPSKTTLNTSSEIINKLVHTNKDTE--WDQF 239

Query: 241 AGLACDVRDVAKLHVLPLGKKEFNGQRLFPVSDTGYGIEEYEKGKFNFEKILRILNEKLP 300
            G   DVRDV++ H+    K+E  G+RL     + +G      G F  + IL I+N+  P
Sbjct: 240 NGGYIDVRDVSRAHLCAFEKEECAGERL-----SLFG------GMFATQDILDIINDDFP 288

Query: 301 ELKGKISPGGIKDNEAELAKLDY-YRNKTTTDLTKLTFYKFEDTVYDATKQILD 353
           +LKGKI P G      EL    +   N+ T  L    F     +V D+ +QIL+
Sbjct: 289 QLKGKI-PVGRPGTGKELTTKGFQINNERTKILLGFEFIGLRQSVDDSVRQILE 341

>Sklu_2244.2 YOL151W, Contig c2244 1821-2879 reverse complement
          Length = 352

 Score =  233 bits (595), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 132/358 (36%), Positives = 213/358 (59%), Gaps = 25/358 (6%)

Query: 1   MSAKVLLTGASGFIALHVLDQLLAA-GYEVVGTVRSEEKAEPIKKELAKEHPNGKYQFEV 59
           MS  V ++GA+GFIA +V+D+LL    Y+V+G+ RS+EKA+    +L  +  N     E+
Sbjct: 8   MSTTVFVSGATGFIAQYVIDELLKTEKYKVIGSARSQEKAD----KLLSQFSNSNLSMEI 63

Query: 60  VVDIAAPNAFDAVFQKHT-DLKYVLHTASPFSFGLTKSNEENYLIPATHGTKSVLESIQK 118
           V +IA P+AFD +F K+  D+K VLHTASPF F  +K  +++ LIPA +GT S+L++++K
Sbjct: 64  VPNIAEPDAFDHIFAKYAKDIKVVLHTASPFFFE-SKDFDKDLLIPAVNGTSSILKAVKK 122

Query: 119 YGKN-VEHVIVTSSYAAIMRLDHAGDPNFIHDETSWNPITWEEARENSVTAYIASKKYAE 177
           Y  N VE V++TSSYAA+   +       + +E SWN ++WEEA+++ + AY ASK +AE
Sbjct: 123 YAANTVERVVITSSYAAVCTFNEDSQKGNVINEESWNTMSWEEAKKDGIAAYCASKAFAE 182

Query: 178 KLAWDFVKDNNS--TFNLTTVNPPYVFGPQKFTFGLAKSSLNTSADIVNQALKTTPEYEG 235
           +  W+F ++N +   F L+T+NP +VFGPQ F   +A + LNTS +++N+ + ++ + E 
Sbjct: 183 RFVWEFFEENKNELKFKLSTINPVFVFGPQLFNESVA-AQLNTSCELINKIVHSSSDSE- 240

Query: 236 PFNQPA-GLACDVRDVAKLHVLPLGKKEFNGQRLFPVSDTGYGIEEYEKGKFNFEKILRI 294
             +Q   G   DVRDVAK H+    + +  GQRL    +           +F  + +  I
Sbjct: 241 -IDQTLFGGYIDVRDVAKAHICAFEQDDCIGQRLILAEE-----------RFTMQTLADI 288

Query: 295 LNEKLPELKGKISPGGIKDNEAELAKLDYYRNKTTTDLTKLTFYKFEDTVYDATKQIL 352
           +N+  P+L+ KI+ G  K +   L+++    N  +  L    F   + +V D   Q+L
Sbjct: 289 INQDFPQLRSKIAIGKPKSDVQVLSRIATLDNSKSRKLLGFDFIPLKQSVDDTVSQLL 346

>Scas_538.7
          Length = 347

 Score =  233 bits (593), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 146/352 (41%), Positives = 200/352 (56%), Gaps = 22/352 (6%)

Query: 5   VLLTGASGFIALHVLDQLLAAGYEVVGTVRSEEKAEPIKKELAKEHPNGKYQFEVVVDIA 64
           V ++GA+GFIALHV+D+LL  GY+V+G+ RS+EK + +   L K + N     E+V DI+
Sbjct: 7   VFVSGATGFIALHVVDKLLREGYKVIGSARSQEKCDEL---LQKFNYNPSISTEIVPDIS 63

Query: 65  APNAFDAVFQKHT-DLKYVLHTASPFSFGLTKSNEENYLIPATHGTKSVLESIQKYG-KN 122
              AFD VF+KH  ++K VLHTASPF F +    E++ LIPA +GTKSVL +I+KYG ++
Sbjct: 64  NLAAFDDVFKKHGHEIKIVLHTASPFRFDVN-DYEKDLLIPAVNGTKSVLNAIKKYGAQS 122

Query: 123 VEHVIVTSSYAAIMRLDHAGDPNFIHDETSWNPITWEEARENSVTAYIASKKYAEKLAWD 182
           VE V+VTSS AA + +  A   + +  E SWN  TWE  + + +  Y ASK +AE+ AWD
Sbjct: 123 VERVVVTSSVAAQINIKGANRDDLVLTEESWNDATWENCQTDPMAVYCASKTFAERAAWD 182

Query: 183 FVKDNNS--TFNLTTVNPPYVFGPQKFTFGLAKSSLNTSADIVNQALKTTPEYEGPFNQP 240
           F+++N     F L+TV P YVFGPQ F    +K  LNTS++I+NQ +    + E    Q 
Sbjct: 183 FIRENKDQVIFKLSTVLPVYVFGPQLFP-EPSKKELNTSSEIINQIVHADKDTE--LMQL 239

Query: 241 AGLACDVRDVAKLHVLPLGKKEFNGQRLFPVSDTGYGIEEYEKGKFNFEKILRILNEKLP 300
            G   DVRDVAK H+L   K E   QRL               G F  +  L I+NE   
Sbjct: 240 NGGFIDVRDVAKAHLLAFQKDECASQRL-----------SLHGGMFATQDFLDIINEDFS 288

Query: 301 ELKGKISPGGIKDNEAELAKLDYYRNKTTTDLTKLTFYKFEDTVYDATKQIL 352
           +L+GKI  G     +   +K     N  T  L    F    + V D+  QIL
Sbjct: 289 QLRGKIPVGKPGTGKLITSKGYQINNDKTKKLLGFPFIGLRECVDDSVSQIL 340

>CAGL0E05280g complement(511971..513026) similar to tr|Q12068
           Saccharomyces cerevisiae YOL151w GRE2, start by
           similarity
          Length = 351

 Score =  231 bits (588), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 144/355 (40%), Positives = 200/355 (56%), Gaps = 27/355 (7%)

Query: 5   VLLTGASGFIALHVLDQLLAAGYEVVGTVRSEEKAEPIKKELAKEHPNGKYQFEVVVDIA 64
           V ++GASGFIA H++ QLL   Y+V+G+VRS EK + +K  + K   +  + +E+V DIA
Sbjct: 10  VFVSGASGFIAQHIIRQLLDQNYKVIGSVRSTEKGDNLKNAIFK---SANFNYEIVKDIA 66

Query: 65  APNAFDAVFQKH-TDLKYVLHTASPFSFGLTKSNEENYLIPATHGTKSVLESIQKY-GKN 122
             NAFD VF+KH  D+K VLHTASP +F  T+  E++ LIPA +GTK +LESI+KY  + 
Sbjct: 67  DLNAFDPVFEKHGKDIKVVLHTASPLNFTTTEY-EKDLLIPAVNGTKGILESIKKYAAQT 125

Query: 123 VEHVIVTSSYAAIMRLDHAGDPNFIHDETSWNPITWEEARENSVTAYIASKKYAEKLAWD 182
           VE V+VTSS+A+        +      E SWN  +WE  + ++V AY  SKK+AE+ AW+
Sbjct: 126 VERVVVTSSFASHTSTVDMCNTKGKITEDSWNQDSWENCQTDAVRAYFGSKKFAEEAAWE 185

Query: 183 FVKDNNST--FNLTTVNPPYVFGPQKFTFGLAKSSLNTSADIVNQALKTTPEYEGPFNQP 240
           F+  N     F L TV+P YVFGPQ       K  LN S++++NQ +    + + P  Q 
Sbjct: 186 FLNKNKDAVKFKLATVDPVYVFGPQNH-IEPGKKVLNVSSEVINQLVHL--KKDDPLPQV 242

Query: 241 AGLACDVRDVAKLHVLPLGKKEFNGQRLFPVSDTGYGIEEYEKGKFNFEKILRILNEKLP 300
           A    DVRD+AK H+L   K E  GQRL               G F  + +L  +NE+ P
Sbjct: 243 ACGYIDVRDIAKAHILAFQKDELIGQRLL-----------LHSGLFTVQTLLDAINEQFP 291

Query: 301 ELKGKISPGGIKDNEAE--LAKLDYYRNKTTTDLTKLTFYKFEDTVYDATKQILD 353
           EL+GKI  G    N+ E  L  +D   N  T  L    F   +  + D   QIL+
Sbjct: 292 ELRGKIPAGEPGSNKPEDLLTPID---NTKTKKLLGFEFRDLKTIIQDTVSQILE 343

>Scas_622.14
          Length = 387

 Score =  227 bits (579), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 138/354 (38%), Positives = 205/354 (57%), Gaps = 22/354 (6%)

Query: 5   VLLTGASGFIALHVLDQLLAAGYEVVGTVRSEEKAEPIKKELAKEHPNGKYQFEVVVDIA 64
           V ++G +GF+A  +   LL AGY+V+G+VRS+++   I + +    P       +V DI+
Sbjct: 49  VFVSGCNGFVATRITVDLLKAGYKVIGSVRSQDE---IDQFIPHFKPTDALTLVIVEDIS 105

Query: 65  APNAFDAVFQKH-TDLKYVLHTASPFSFGLTKSNEENYLIPATHGTKSVLESIQKYGKN- 122
              +FD VF+++  ++KYVLHTASPF    T+   ++ LIPA +GT+++LE+I+KY  + 
Sbjct: 106 VLGSFDEVFKQYGKEIKYVLHTASPFIIDTTEY-VKDLLIPAVNGTQAILEAIKKYAADS 164

Query: 123 VEHVIVTSSYAAIMRLDHAGDPNFIHDETSWNPITWEEARENSVTAYIASKKYAEKLAWD 182
           VE V++TSS+AA        D +    E SWNP TW++ + + +TAY ASK +AEK AW 
Sbjct: 165 VERVVITSSFAAQAGPKQWYDNSLTITEESWNPSTWDDCQVDGMTAYCASKVFAEKEAWK 224

Query: 183 FVKDNNST--FNLTTVNPPYVFGPQKFTFGLAKSSLNTSADIVNQALKTTPEYEGPFNQP 240
           F+KDN S   F +TT+NP +V+GPQ F F   K  +NTS+ I+N  + +  E +   N+ 
Sbjct: 225 FLKDNESQVKFKITTINPGFVYGPQTF-FDPKKKIMNTSSQIINHIVHSKKETD--INEI 281

Query: 241 AGLACDVRDVAKLHVLPLGKKEFNGQRLFPVSDTGYGIEEYEKGKFNFEKILRILNEKLP 300
            G   DVRD++K H+L   KKE  G+RL  VS           G F+ + +L I+NE  P
Sbjct: 282 FGPFVDVRDISKGHILAFQKKELIGKRLSMVS-----------GMFSSQGVLDIVNEDFP 330

Query: 301 ELKGKISPGGIKDNEAELAKLDYYRNKTTTDLTKLTFYKFEDTVYDATKQILDY 354
           +LKGKI  G    +   +AK     N  T  L    F   +  + D  KQIL+Y
Sbjct: 331 QLKGKIPVGKPGTDATLIAKHCTVINDETKKLLGFEFIDLKQCIDDTVKQILEY 384

>Scas_550.4
          Length = 343

 Score =  223 bits (568), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 138/352 (39%), Positives = 199/352 (56%), Gaps = 21/352 (5%)

Query: 5   VLLTGASGFIALHVLDQLLAAGYEVVGTVRSEEKAEPIKKELAKEHPNGKYQFEVVVDIA 64
           V ++GA+GF+A H+++QLL   ++V+G+VRS+ KA+ + ++    + N     EVV DI+
Sbjct: 3   VFISGATGFVAQHIINQLLEQNFKVIGSVRSQAKADKLLRQF---NSNKNLSLEVVEDIS 59

Query: 65  APNAFDAVFQKH-TDLKYVLHTASPFSFGLTKSNEENYLIPATHGTKSVLESIQKYG-KN 122
              AFD VF KH  ++KYVLHT+SPF F      E++ LIPA +GTK +L SI KY   N
Sbjct: 60  NLAAFDEVFSKHGKEIKYVLHTSSPF-FTECDDYEKDLLIPALNGTKGILNSILKYAADN 118

Query: 123 VEHVIVTSSYAAIMRLDHAGDPNFIHDETSWNPITWEEARENSVTAYIASKKYAEKLAWD 182
           VE V++TSS AA+       DP++ +DE SWNP +++EA  +   AY  SKK+AE+ AW+
Sbjct: 119 VERVVITSSIAAMFDFTRDLDPSYFYDENSWNPDSYQEALTDGGHAYNGSKKFAERYAWN 178

Query: 183 FVKD--NNSTFNLTTVNPPYVFGPQKFTFGLAKSSLNTSADIVNQALKTTPEYEGPFNQP 240
           FV++  N   F LTTVNP YVFGPQ F   +  + LNTS +++N+ L  +   +   N  
Sbjct: 179 FVQEHKNEIKFKLTTVNPCYVFGPQLFDENVT-AKLNTSCELINKLLHLSAG-DAVDNFF 236

Query: 241 AGLACDVRDVAKLHVLPLGKKEFNGQRLFPVSDTGYGIEEYEKGKFNFEKILRILNEKLP 300
            G   DVRDVAK H+L    +    +RL  +S            +FN + IL I+NE   
Sbjct: 237 VGNFVDVRDVAKAHLLGFENQNLVDKRLLLIS-----------SRFNAQDILDIMNEDFK 285

Query: 301 ELKGKISPGGIKDNEAELAKLDYYRNKTTTDLTKLTFYKFEDTVYDATKQIL 352
            L+G++  G          K     N  T +L    F   + T+ D   QIL
Sbjct: 286 TLEGQLPAGVPHTGALHQWKGAIADNSKTKELLGFEFIPLKKTIDDMVTQIL 337

>Scas_652.15
          Length = 350

 Score =  219 bits (558), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 138/356 (38%), Positives = 197/356 (55%), Gaps = 21/356 (5%)

Query: 3   AKVLLTGASGFIALHVLDQLLAAGYEVVGTVRSEEKAEPIKKELAKEHPNGKYQFEVVVD 62
           + V ++GASGFIA H++  LL   Y+V+G+VRS EKAE +   L+  + N     E+V D
Sbjct: 6   STVFVSGASGFIAQHIISLLLEQNYKVIGSVRSNEKAEHV---LSNFNHNPNLTLEIVKD 62

Query: 63  IAAPNAFDAVFQKHTD-LKYVLHTASPFSFGLTKSNEENYLIPATHGTKSVLESIQKYG- 120
           +A+  AFD VF+KH D +K VLH ASP  F +  + E++ LIPA +G KS+L +I KY  
Sbjct: 63  LASLTAFDEVFKKHGDEIKIVLHAASPVVFQV-DNFEKDILIPAVNGVKSMLNAILKYAP 121

Query: 121 KNVEHVIVTSSYAAIMRLDHAGDPNFIHDETSWNPITWEEARENSVTAYIASKKYAEKLA 180
           + VE +I TSS  A        +     DET+WN  TWE  + N++ AY ASK +AEK A
Sbjct: 122 QTVERLIYTSSIVAQFNPCGENEKGMKLDETTWNDATWENCQTNAINAYSASKTFAEKAA 181

Query: 181 WDFVKD--NNSTFNLTTVNPPYVFGPQKFTFGLAKSSLNTSADIVNQALKTTPEYEGP-F 237
           W+F+K   N   F LTT+ P YV GPQ     L+   LN S++++N  +    E + P  
Sbjct: 182 WEFMKKHGNEVKFKLTTILPSYVLGPQ-LKIDLSNGKLNLSSELINSIVHAREESQLPTL 240

Query: 238 NQPAGLACDVRDVAKLHVLPLGKKEFNGQRLFPVSDTGYGIEEYEKGKFNFEKILRILNE 297
           +   G   DVRDVAK  +L   K E  G+RL   S           G F+ ++IL ++++
Sbjct: 241 SSRLGYFIDVRDVAKAELLAFQKDECIGKRLSLTS-----------GTFSIQRILNVIHK 289

Query: 298 KLPELKGKISPGGIKDNEAELAKLDYYRNKTTTDLTKLTFYKFEDTVYDATKQILD 353
             PEL GK+  G     E     +  + N+ T       F  F+ +V D+T+QILD
Sbjct: 290 DFPELNGKVPVGAPDLVEESADDIFDFSNEETKKALGFEFIDFKTSVDDSTRQILD 345

>Scas_680.6
          Length = 367

 Score =  213 bits (542), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 137/358 (38%), Positives = 204/358 (56%), Gaps = 29/358 (8%)

Query: 5   VLLTGASGFIALHVLDQLLAAGYEVVGTVRSEEKAEPIKKELAKEHPNGKYQFEVVVDIA 64
           V ++GASGFIA H++  LL   Y+V+G+VRS+EKA+ +   L+  + N     E+V D+A
Sbjct: 25  VFVSGASGFIAQHIIKLLLEQDYKVIGSVRSQEKAKHV---LSNFNHNPNLNLEIVKDLA 81

Query: 65  APNAFDAVFQKH-TDLKYVLHTASPFSFGLTKSNEENYLIPATHGTKSVLESIQKYG-KN 122
              AFD VFQKH  ++K VLH ASP +F +    E++ LIPA +G KS+L +I KY  + 
Sbjct: 82  DLTAFDEVFQKHGKEIKIVLHPASPVTFEVNDL-EKDVLIPAVNGVKSILNAILKYAPQT 140

Query: 123 VEHVIVTSSYAAIMRLDHAG--DPNFIHDETSWNPITWEEARENSVTAYIASKKYAEKLA 180
           VE V+ TSS  A+ + + AG    + + DE SWN  TWE  + ++V AY  SK +AE+ A
Sbjct: 141 VERVVYTSS--AMAQFNPAGKFSKDTLIDENSWNDATWENCQIDAVNAYSGSKAFAERAA 198

Query: 181 WDFVKD--NNSTFNLTTVNPPYVFGPQKFTFGLAKSSLNTSADIVNQALKTTPEYEGP-F 237
           WDF+K+  N   F LTTV P YV GPQ     ++K  LN+S++++N  +  T + E P F
Sbjct: 199 WDFMKEHGNEVKFKLTTVLPTYVLGPQ-MKIDVSKGKLNSSSELINAVVHATSDAELPSF 257

Query: 238 NQPAGLACDVRDVAKLHVLPLGKKEFNGQRLFPVSDTGYGIEEYEKGKFNFEKILRILNE 297
           N   G+  DVRDVAK  +L   K     +RL               G +  + +L ++++
Sbjct: 258 NPMMGVFVDVRDVAKAELLAFQKDGCIDKRL-----------SLAAGVYTLQDVLDLVHK 306

Query: 298 KLPELKGKISPG--GIKDNEAELAKLDYYRNKTTTDLTKLTFYKFEDTVYDATKQILD 353
             PEL GK+  G  G++   A+  +L  + N  T  +    F  F+ + +D+  QILD
Sbjct: 307 DFPELNGKVPAGNPGVRGVTAD--ELFSFNNDETKKVLGFKFIDFQKSAHDSIAQILD 362

>Scas_630.13
          Length = 349

 Score =  202 bits (513), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 128/353 (36%), Positives = 194/353 (54%), Gaps = 21/353 (5%)

Query: 5   VLLTGASGFIALHVLDQLLAAGYEVVGTVRSEEKAEPIKKELAKEHPNGKYQFEVVVDIA 64
           +L++GA GFIALH+++ LL  GY V+G+VR+ E+A  + K+    + N K    VV DI+
Sbjct: 9   ILVSGADGFIALHIVNDLLQKGYTVIGSVRNPEEAALLMKDF---NNNPKLIPVVVEDIS 65

Query: 65  APNAFDAVFQKH-TDLKYVLHTASPFSFGLTKSNEENYLIPATHGTKSVLESIQKYG-KN 122
             N+FD VFQ++ + +K VLH ASP  F  +     + LIPA +GT +VL +I++Y  ++
Sbjct: 66  KLNSFDHVFQEYGSQIKGVLHVASPVHFE-SSDVVNDLLIPALNGTTAVLNAIKEYAPQS 124

Query: 123 VEHVIVTSSYAAIMRLDHAGDPNFIHDETSWNPITWEEARENSVTAYIASKKYAEKLAWD 182
           VE V++TSS+A  +      D N +  E SWN  TWE  + + ++AY ASKK+AEK AWD
Sbjct: 125 VEKVVITSSFAGFVSPKQMADKNTVVTEDSWNDSTWENCQSDPISAYCASKKFAEKAAWD 184

Query: 183 FVKDNNS--TFNLTTVNPPYVFGPQKFTFGLAKSSLNTSADIVNQALKTTPEYEGPFNQP 240
           F++   S   F L  ++P +VFGPQ F+ G+ K  +N S +I+N+ +      + PF + 
Sbjct: 185 FLEKYKSEVKFELAVISPGWVFGPQLFSRGV-KPVMNVSCEIINKIVHARSIDDVPF-EM 242

Query: 241 AGLACDVRDVAKLHVLPLGKKEFNGQRLFPVSDTGYGIEEYEKGKFNFEKILRILNEKLP 300
            G   DVRD AK H+  L     NG RL              +G F  ++IL I++   P
Sbjct: 243 MGPYIDVRDTAKAHIFALENDSCNGHRLI-----------LNEGFFTAQEILDIVHNDFP 291

Query: 301 ELKGKISPGGIKDNEAELAKLDYYRNKTTTDLTKLTFYKFEDTVYDATKQILD 353
           E+   I  G     +  L +     N  T  +    F   ++TV D   QI++
Sbjct: 292 EVGKDIPMGNPGTGKKLLEERFTADNSKTRKILGFPFRDLKETVDDTVAQIIE 344

>Scas_617.1
          Length = 345

 Score =  200 bits (508), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 131/356 (36%), Positives = 194/356 (54%), Gaps = 24/356 (6%)

Query: 3   AKVLLTGASGFIALHVLDQLLAAGYEVVGTVRSEEKAEPIKKELAKEHPNGKYQFEVVVD 62
           + V ++GASGFIA +++  LL   Y+V+G+VRS  KA+ +         N    F ++ D
Sbjct: 6   STVFVSGASGFIAQNIIKLLLEQNYKVIGSVRSNNKAKQVHSTFEN---NPSLSFVIIED 62

Query: 63  IAAPNAFDAVFQKH-TDLKYVLHTASPFSFGLTKSNEENYLIPATHGTKSVLESIQKYG- 120
           ++   AFD VF+K+  D+K VLHTASP +F  T   E+  LIPA +G KS+L +I KY  
Sbjct: 63  LSKLTAFDEVFKKYGKDIKIVLHTASPVTFQATDL-EKGILIPAVNGVKSILNAILKYAP 121

Query: 121 KNVEHVIVTSSYAAIMRLDHAGDPNFIHDETSWNPITWEEARENSVTAYIASKKYAEKLA 180
           + VE  + TSS  A +        N   +E SWN  TWE ++ +S+TAY ASK +AE+ A
Sbjct: 122 QTVERFVYTSSVLAQVNPTWTDFKNVTINEKSWNDSTWEGSQVDSLTAYSASKAFAERAA 181

Query: 181 WDFVKD--NNSTFNLTTVNPPYVFGPQKFTFGLAKSSLNTSADIVNQALKTTPEYEGP-F 237
           WDF+K+  N   F LTTV P +VFGP+    G     LN S +I+   +  T E + P  
Sbjct: 182 WDFMKEYGNEVKFKLTTVLPSFVFGPE-VKIG---PKLNLSGEILKTIIHATSEKQLPSV 237

Query: 238 NQPAGLACDVRDVAKLHVLPLGKKEFNGQRLFPVSDTGYGIEEYEKGKFNFEKILRILNE 297
           +    ++ DVRDVA+ H+L   K+E  G+RL  V +            F  + IL +++ 
Sbjct: 238 DTVLRVSVDVRDVARAHMLAFQKEECIGKRLSLVENV-----------FTLQDILDLIHT 286

Query: 298 KLPELKGKISPGGIKDNEAELAKLDYYRNKTTTDLTKLTFYKFEDTVYDATKQILD 353
             P+L G +       NE    +L  + N  +  +    FY F+ +V+D+ KQILD
Sbjct: 287 DFPDLSGNVPVRAPVSNEKMPKELFGFNNDESKKILGFKFYDFKTSVHDSIKQILD 342

>Scas_601.5
          Length = 345

 Score =  188 bits (477), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 128/356 (35%), Positives = 188/356 (52%), Gaps = 29/356 (8%)

Query: 5   VLLTGASGFIALHVLDQLLAAGYEVVGTVRSEEKAEPIKKELAKEHPNGKYQFEVVVDIA 64
           V ++GA+GFIA +++  LL   Y+V+G+VRSEEK + +   LA    N     E+V D+A
Sbjct: 8   VFVSGATGFIAKYIIKLLLDQNYKVIGSVRSEEKGQEV---LADFDHNANLSIEIVKDLA 64

Query: 65  APNAFDAVFQKH-TDLKYVLHTASPFSFGLTKSNEENYLIPATHGTKSVLESIQKYG-KN 122
           +  AFD VF+KH  D++ VLHTASP +F +    E++ LIPA +G KS+L +I ++  + 
Sbjct: 65  SLTAFDEVFKKHGKDIQIVLHTASPVTFQVDDV-EKDILIPAVNGVKSILNAILQFAPQT 123

Query: 123 VEHVIVTSSYAAIMRLDHAGDPNFIHDETSWNPITWEEARENSVTAYIASKKYAEKLAWD 182
           VE  ++TSS AA +        + I  E SWN  TWE  + +S++AY  SK +AEK AWD
Sbjct: 124 VERFVLTSSLAAQINPLAPDSKDKIITEKSWNDATWEGCQTDSMSAYAGSKTFAEKAAWD 183

Query: 183 FVKD--NNSTFNLTTVNPPYVFGPQ---KFTFGLAKSSLNTSADIVNQALKTTPEYEGPF 237
           F+K+  N     ++ V P +VFGPQ    F+ G  +SS+     I+N  L   P +    
Sbjct: 184 FMKEHGNEVKMKMSAVLPSFVFGPQLKMDFSSGHLRSSMEFINSIINGKL-PPPMFS--- 239

Query: 238 NQPAGLACDVRDVAKLHVLPLGKKEFNGQRLFPVSDTGYGIEEYEKGKFNFEKILRILNE 297
              AG   DVRDVAK  +    K E  G+RL   SD            +  + IL  +++
Sbjct: 240 ---AGAFIDVRDVAKAELAAFQKDECIGKRLALESDM-----------YTVQDILDYIHK 285

Query: 298 KLPELKGKISPGGIKDNEAELAKLDYYRNKTTTDLTKLTFYKFEDTVYDATKQILD 353
             PEL   +  G     +  L     + N  T  +    F   E T++D+ KQI D
Sbjct: 286 NFPELAKIVQVGKPGSRDEALKNSFKFNNDETKKVLGFQFIPLETTLHDSLKQIDD 341

>Kwal_56.23863
          Length = 344

 Score =  178 bits (452), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 123/358 (34%), Positives = 186/358 (51%), Gaps = 26/358 (7%)

Query: 1   MSAKVLLTGASGFIALHVLDQLLA-AGYEVVGTVRSEEKAEPIKKELAKEHPNGKYQFEV 59
           M+  VL+TGA+ ++A H+++ LL  + Y V+GTVRS EKA     +L++   + + + EV
Sbjct: 3   MAETVLITGANNYVAQHIINVLLKNSNYNVIGTVRSNEKA----VKLSENFNSDRLKCEV 58

Query: 60  VVDIAAPNAFDAVFQKH-TDLKYVLHTASPFSFGLTKSNEENYLIPATHGTKSVLESIQK 118
           V D+ + NAFD VF K+ T + +V+HTASP +F  T    E  + PA  G KS+L SI++
Sbjct: 59  VSDMGSQNAFDEVFSKYYTKITHVIHTASPVNFQATDYYSE-VINPAVEGMKSLLNSIKR 117

Query: 119 YGKN-VEHVIVTSSYAAIMRLDHAGDPNFIHDETSWNPITWEEARENSVTAYIASKKYAE 177
           Y    V+ V+V SSY A++ +          +E SWNP    +   +   AY ASK  AE
Sbjct: 118 YSSYLVKRVVVLSSYPALIPMADDTKAGLKINEESWNPFETGDPIHSPQEAYAASKTLAE 177

Query: 178 KLAWDFVKDNNST-FNLTTVNPPYVFGPQKFTFGLAKSSLNTSADIVNQAL--KTTPEYE 234
           K AW F+++N S  F LTT+ P +++GPQ F F  AK     S +   Q +  K     +
Sbjct: 178 KAAWKFMEENTSVQFELTTIQPAFIWGPQVF-FSEAKKRTPGSCEFFTQIIESKVDDAID 236

Query: 235 GPFNQPAGLACDVRDVAKLHVLPLGKKEFNGQRLFPVSDTGYGIEEYEKGKFNFEKILRI 294
              + P     DVRDVA+ H+L L K    G+RL   +           G+ N + +   
Sbjct: 237 KSVSYP---VVDVRDVAQAHLLALKKANLGGKRLILYA-----------GRCNNQILADT 282

Query: 295 LNEKLPELKGKISPGGIKDNEAELAKLDYYRNKTTTDLTKLTFYKFEDTVYDATKQIL 352
           +N    EL+G+I+ G     EA +       +  + +L    F    +T+ D T QIL
Sbjct: 283 INAHFDELRGRIARGDQGSGEALITNAATLNDTKSKELLGFQFRSISETIIDTTTQIL 340

>KLLA0B14641g 1287645..1288148 similar to sp|P53183 Saccharomyces
           cerevisiae YGL039w, hypothetical start
          Length = 167

 Score =  103 bits (257), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 92/133 (69%), Gaps = 7/133 (5%)

Query: 5   VLLTGASGFIALHVLDQLLAAGYEVVGTVRSEEKAEPIKKELAKEHPNGKYQFEVVVDIA 64
           VL++GASG+IA H +  LL  GY+V+GTVR++EKA+ +    A+   +     E+V ++A
Sbjct: 23  VLVSGASGYIAQHTIRILLEKGYKVIGTVRTQEKADSV----AQLFNSDNLVLELVPELA 78

Query: 65  APNAFDAVFQKH-TDLKYVLHTASPFSFGLTKSNEENYLIPATHGTKSVLESIQKYGKN- 122
             +AFD VF+K+ T +K+V+HTASP  + +T   E   L+PA +GT+SVLESI+K+  + 
Sbjct: 79  KIDAFDHVFEKYNTQIKHVIHTASPVRYNMTDF-ENEMLLPAINGTRSVLESIKKFSADS 137

Query: 123 VEHVIVTSSYAAI 135
           VE V+ TSS +A+
Sbjct: 138 VETVVYTSSISAL 150

>KLLA0B14663g 1288500..1288730 similar to sp|Q9UV57
           Zygosaccharomyces rouxii Ketoreductase, hypothetical
           start
          Length = 76

 Score = 45.1 bits (105), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 36/71 (50%), Gaps = 6/71 (8%)

Query: 285 KFNFEKILRILNEKLPELKGKIS---PGGIKDNEAELAKLDYYRNKTTTDLTKLTFYKFE 341
           +F  + +   +NE  PELKGKIS   PG  KD  A  +K   Y N  T  L    F  FE
Sbjct: 4   RFALQDVADFINENYPELKGKISVGNPGAGKDIVATTSK---YDNSKTRKLLGFEFVPFE 60

Query: 342 DTVYDATKQIL 352
            +V D+  QIL
Sbjct: 61  QSVTDSVNQIL 71

>YLL056C (YLL056C) [3367] chr12 complement(27409..28305) Protein
          possibly involved in cell detoxification or stress
          response [897 bp, 298 aa]
          Length = 298

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/40 (57%), Positives = 30/40 (75%)

Query: 4  KVLLTGASGFIALHVLDQLLAAGYEVVGTVRSEEKAEPIK 43
          KV +TGASGFI   VL +L+++G+EVVG  RS+E A  IK
Sbjct: 2  KVFITGASGFIGSAVLSELISSGHEVVGLARSDEAAAKIK 41

>YGL001C (ERG26) [1971] chr7 complement(495455..496504) C-3 sterol
           dehydrogenase, C-4 decarboxylase, required for
           ergosterol biosynthesis [1050 bp, 349 aa]
          Length = 349

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 52/201 (25%), Positives = 86/201 (42%), Gaps = 23/201 (11%)

Query: 5   VLLTGASGFIALHVLDQLLAAGYEV-VGTVRSEEKAEPIKKELAKEHPNGKYQFEVVVDI 63
           VL+ G SGF+ LH++ Q      +  +      +  E + K+      + K+      D+
Sbjct: 7   VLIIGGSGFLGLHLIQQFFDINPKPDIHIFDVRDLPEKLSKQFTFNVDDIKFHKG---DL 63

Query: 64  AAPNAFDAVFQKHTDLKYVLHTASPFSFGLTKSNEENYLIPATHGTKSVLESIQKYGKNV 123
            +P+  +    + +    V+H ASP    +   N + Y I    GT++V++  +K G N+
Sbjct: 64  TSPDDMENAINE-SKANVVVHCASP----MHGQNPDIYDIVNVKGTRNVIDMCKKCGVNI 118

Query: 124 EHVIVTSSYAAIMRLDHAGDPNFIHDETSWNPITWEEARENSVTAYIASKKYAEKLAWDF 183
             ++ TSS   I      G      DET W PI      E  + AY  +K  AE +    
Sbjct: 119 --LVYTSSAGVIFN----GQDVHNADET-W-PIP-----EVPMDAYNETKAIAEDMVLK- 164

Query: 184 VKDNNSTFNLTTVNPPYVFGP 204
             D +S F    + P  +FGP
Sbjct: 165 ANDPSSDFYTVALRPAGIFGP 185

>Scas_522.5
          Length = 692

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 83/190 (43%), Gaps = 19/190 (10%)

Query: 4   KVLLTGASGFIALHVLDQLLAAGYE--VVGTVRSEEKAEPIKKELAKEHPNGKYQFEVVV 61
           KVL+TG +G+I  H + +L+  GYE  +V  + +       + E+  +H    Y+    V
Sbjct: 7   KVLVTGGAGYIGSHTVVELIENGYECVIVDNLCNSSYDAVARLEILTKHHIPFYK----V 62

Query: 62  DIAAPNAFDAVFQKHTDLKYVLHTASPFSFGLTKSNEENYLIPATHGTKSVLESIQKYGK 121
           D+      + VFQ+H  +  V+H A   + G +      Y      GT  +LE + KY  
Sbjct: 63  DLCDAEGLEKVFQEHK-IDSVIHFAGLKAVGESTQIPLRYYHNNILGTLVLLELMGKY-- 119

Query: 122 NVEHVIVTSSYAAIMRLDHAGDPNFIHDETSWNPITWEEARENSVTAYIASKKYAEKLAW 181
           +V+ ++ +SS  A +  D    P+ I       PI  EE        Y  +K   E +  
Sbjct: 120 DVKKLVFSSS--ATVYGDATRFPDMI-------PIP-EECPLGPTNPYGQTKLAIEHILH 169

Query: 182 DFVKDNNSTF 191
           D    +N T+
Sbjct: 170 DLYNSDNKTW 179

>Scas_652.19d
          Length = 341

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 30/59 (50%)

Query: 2  SAKVLLTGASGFIALHVLDQLLAAGYEVVGTVRSEEKAEPIKKELAKEHPNGKYQFEVV 60
          S   L+TG +  I   V+  L +    ++  VRS EK E  KKE  +++PN K    VV
Sbjct: 41 SKTALITGTNTGIGFEVMKLLYSKNCNIIAVVRSAEKGEAAKKEAIEKYPNSKGSISVV 99

>Sklu_2306.3 YGL001C, Contig c2306 4537-5586
          Length = 349

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 57/207 (27%), Positives = 96/207 (46%), Gaps = 31/207 (14%)

Query: 3   AKVLLTGASGFIALHVLDQL--LAAGYEV-VGTVRSEEKAEPIKKELAKEHPNGKYQFEV 59
           + VLL G SGF+ LH++ Q   L    ++ V  VR      P+ ++L+K+      +   
Sbjct: 5   SSVLLIGGSGFLGLHLVQQFYDLTPKPDIHVFDVR------PLPEKLSKQFTFNPSEIAF 58

Query: 60  -VVDIAAP-NAFDAVFQKHTDLKYVLHTASPFSFGLTKSNEENYLIPATHGTKSVLESIQ 117
              D+ +P +  +A+   + D+  V+H+ASP    +  +++E Y      GT+++L+  +
Sbjct: 59  HKGDLTSPEDVGEAIKSSNADV--VVHSASP----IHGNSQEVYEKVNVQGTRNLLDVAK 112

Query: 118 KYGKNVEHVIVTSSYAAIMRLDHAGDPNFIHDETSWNPITWEEARENSVTAYIASKKYAE 177
             G  V+ V+ TSS   I      G      DET W PI      E  +  Y  +K  AE
Sbjct: 113 NCG--VKAVVYTSSAGVIFN----GQDVHNADET-W-PIP-----EVPMDGYNETKAIAE 159

Query: 178 KLAWDFVKDNNSTFNLTTVNPPYVFGP 204
           ++  +   D  S F    + P  +FGP
Sbjct: 160 EMVLN-ANDPKSNFLTVALRPAGIFGP 185

>Kwal_14.775
          Length = 295

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 26/40 (65%)

Query: 4  KVLLTGASGFIALHVLDQLLAAGYEVVGTVRSEEKAEPIK 43
          KV +TG SGFI   V+ +LL  G+ VV   RS+E A+ ++
Sbjct: 2  KVFVTGGSGFIGTGVVSELLHLGHTVVALSRSQESADKLR 41

>Scas_668.8
          Length = 349

 Score = 37.7 bits (86), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 57/216 (26%), Positives = 95/216 (43%), Gaps = 49/216 (22%)

Query: 3   AKVLLTGASGFIALHVLDQLLAAGYEV-------VGTVRSEEKAEPIKKELAKEHPNGKY 55
           + VLL G SGF+ LH++ Q     YE+       V  VR      P+ ++L+ +     +
Sbjct: 5   SSVLLIGGSGFLGLHLIQQF----YELSPRPSIHVFDVR------PLPEKLSNQ-----F 49

Query: 56  QF---EVVVDIAAPNAFDAVFQ--KHTDLKYVLHTASPFSFGLTKSNEENYLIPATHGTK 110
            F   ++ V I    +F+ V +  K +    V+H+ASP    +   N+E Y +    GT+
Sbjct: 50  TFKLDDIQVHIGDLTSFEDVQKAIKVSGANVVVHSASP----MHGQNKEIYDLVNVKGTR 105

Query: 111 SVLESIQKYGKNVEHVIVTSSYAAIMRLDHAGDPNFIHDETSWNPITWEEARENSVTAYI 170
           +V++  +    NV  ++ TSS   I       +   +H+     PI      E  + AY 
Sbjct: 106 NVIDVCKN--TNVNILVYTSSAGVIF------NGQDVHNADERWPIP-----EVPMDAYN 152

Query: 171 ASKKYAEKLAWDFVKDNNSTFNLTTV--NPPYVFGP 204
            +K  AE +    +K N+      TV   P  +FGP
Sbjct: 153 ETKFTAEDMV---LKSNDPENGFLTVALRPAGIFGP 185

>YBR019C (GAL10) [212] chr2 complement(276215..278314) UDP-glucose
           4-epimerase, catalyzes a step in galactose metabolism
           [2100 bp, 699 aa]
          Length = 699

 Score = 37.4 bits (85), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 69/148 (46%), Gaps = 11/148 (7%)

Query: 2   SAKVLLTGASGFIALHVLDQLLAAGYE-VVGTVRSEEKAEPIKK-ELAKEHPNGKYQFEV 59
           S  VL+TG +G+I  H + +L+  GY+ VV    S    + + + E+  +H    Y+   
Sbjct: 11  SKIVLVTGGAGYIGSHTVVELIENGYDCVVADNLSNSTYDSVARLEVLTKHHIPFYE--- 67

Query: 60  VVDIAAPNAFDAVFQKHTDLKYVLHTASPFSFGLTKSNEENYLIPATHGTKSVLESIQKY 119
            VD+      + VF+++  +  V+H A   + G +      Y      GT  +LE +Q+Y
Sbjct: 68  -VDLCDRKGLEKVFKEY-KIDSVIHFAGLKAVGESTQIPLRYYHNNILGTVVLLELMQQY 125

Query: 120 GKNVEHVIVTSSYAAIMRLDHAGDPNFI 147
             NV   + +SS  A +  D    PN I
Sbjct: 126 --NVSKFVFSSS--ATVYGDATRFPNMI 149

>KLLA0E09834g complement(872888..873694) similar to sp|Q9ALU7
           Enterobacter cloacae Putative oxidoreductase, start by
           similarity
          Length = 268

 Score = 35.8 bits (81), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 65/148 (43%), Gaps = 32/148 (21%)

Query: 5   VLLTGASGFIALHVLDQLLAAGYEVVGTVRSEEKAEPIKKELAKEHPNGKYQFEVV-VDI 63
           +L+TGAS  I L + + L +AGYEV GT R                P  +Y F+++ +DI
Sbjct: 6   ILITGASTGIGLSIAETLRSAGYEVFGTSRK------------GSIPGKEYSFKMIKLDI 53

Query: 64  ----AAPNAFDAVFQKHTDLKYVLHTAS---------PFSFGLTKSNEENYLIPATHGTK 110
               +  +A + V +K   +  +++ A            S  L K+  E         T+
Sbjct: 54  TDEESVKSAVNEVIEKAGRIDVLVNNAGIAFKWAAVEECSTDLAKTIFETNFFGVHRMTR 113

Query: 111 SVLESI--QKYGKNVEHVIVTSSYAAIM 136
           +VL  +  Q++GK    +I  SS   IM
Sbjct: 114 AVLPHMREQRHGK----IINISSMGGIM 137

>Scas_652.19d1
          Length = 344

 Score = 35.8 bits (81), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 29/55 (52%)

Query: 6  LLTGASGFIALHVLDQLLAAGYEVVGTVRSEEKAEPIKKELAKEHPNGKYQFEVV 60
          ++TG +  I  HV++ L      V+G VR++ K E  KKE+   +P  K    ++
Sbjct: 45 VVTGCNTGIGKHVVELLYQKNCNVIGVVRTDAKGEEAKKEIIANNPKSKGNITII 99

>Kwal_47.17598
          Length = 346

 Score = 33.9 bits (76), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 49/205 (23%), Positives = 86/205 (41%), Gaps = 27/205 (13%)

Query: 3   AKVLLTGASGFIALHVLDQLLAAGYEVVGTVRSEEKAEPIKKELAKEHPNGKYQFEV-VV 61
           + VLL G +GF+ LH++++           V       P+  +L+K+         V + 
Sbjct: 2   SSVLLIGGAGFLGLHLIEKFYNISPRPAVHVFD---VRPLPDKLSKQFTFDPKDITVHIG 58

Query: 62  DIAAPNAFDAVFQKHTDLKYVLHTASPFSFGLTKSNEENYLIPATHGTKSVLESIQKYGK 121
           D+ +    +    + ++   V+H+ASP    +   ++E Y      GTK++L   ++ G 
Sbjct: 59  DLTSEKDVEKAL-RVSNASIVVHSASP----MHGCSQEIYEKVNVEGTKNLLLVSKRLG- 112

Query: 122 NVEHVIVTSSYAAIMRLD--HAGDPNFIHDETSWNPITWEEARENSVTAYIASKKYAEKL 179
            V+  + TSS   I      H GD        +W PI      E  +  Y  +K  AEK+
Sbjct: 113 -VKAFVYTSSAGVIFNGQDIHNGD-------ETW-PIP-----EVPMDGYNETKAVAEKM 158

Query: 180 AWDFVKDNNSTFNLTTVNPPYVFGP 204
             D   + +  F    + P  +FGP
Sbjct: 159 VLD-ANNESEGFLTIALRPAGIFGP 182

>YLR290C (YLR290C) [3681] chr12 complement(717147..717980) Protein
           of unknown function, has moderate similarity to
           uncharacterized C. albicans Orf6.8461p [834 bp, 277 aa]
          Length = 277

 Score = 32.7 bits (73), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 48/101 (47%), Gaps = 12/101 (11%)

Query: 1   MSAKVLLTGASGFIALHVLDQLLAAGYEVVGTVRSEEKAEPIKKELAKEHPNGKYQFEVV 60
           M  K+++ G +GF+   +  + + +GY+VV   RS +   P   EL  +    + Q+   
Sbjct: 1   MIPKLIVFGGNGFLGKRICQEAVTSGYQVVSVSRSGKA--PHSNELNDKQWMQEVQW-TA 57

Query: 61  VDIAAPNAFDAVFQKHTDLKYVLHTASPFSFGLTKSNEENY 101
            DI  P+++  +    T+   V+H     S G+   N ENY
Sbjct: 58  ADIFKPDSYHELLNNATN---VVH-----SLGILLEN-ENY 89

>Kwal_14.2444
          Length = 288

 Score = 31.6 bits (70), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 23/41 (56%)

Query: 6  LLTGASGFIALHVLDQLLAAGYEVVGTVRSEEKAEPIKKEL 46
          ++TGAS  I   +  QL + GY+V    R E++ E + KE 
Sbjct: 8  VVTGASSGIGYELTRQLASKGYKVYAAARREQRLETLAKEF 48

>YBR159W (YBR159W) [344] chr2 (558641..559684) Major 3-ketoreductase
           of the fatty acid elongase system involved in synthesis
           of very long chain fatty acids [1044 bp, 347 aa]
          Length = 347

 Score = 30.4 bits (67), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 7/59 (11%)

Query: 7   LTGASGFIALHVLDQLLAAGYEVVGTVRSEEKAEPIKKELAKEHPNGKYQFEVVVDIAA 65
           +TGAS  I      Q+   G+ +V   R++ K E ++KEL  +H        VVV I A
Sbjct: 67  ITGASDGIGKEFARQMAKRGFNLVLISRTQSKLEALQKELEDQH-------HVVVKILA 118

>CAGL0M08316g 829069..831963 weakly similar to sp|P36003
           Saccharomyces cerevisiae YKL171w, hypothetical start
          Length = 964

 Score = 30.4 bits (67), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 28/128 (21%), Positives = 57/128 (44%), Gaps = 9/128 (7%)

Query: 143 DPNFIHDETSWNPITWEEARENSVTAYIASKKYAEKLAWDFVKDNNSTFNLTTVNPPYVF 202
           D N IHD+T +  +T  +A   S  ++  + K ++K++   V+   S+ + T ++    F
Sbjct: 759 DRNVIHDDTPFEILTARQASRRSFESH--NSKKSQKMSTVSVESLPSSPSATPLDNVNAF 816

Query: 203 GP------QKFTFGLAKSSLNTSADIVNQALKTTPEYEGPFNQPAGLACDVRDVA-KLHV 255
            P      + F+  +  S+  T + ++       PE   P   P G   D+  +   ++ 
Sbjct: 817 DPCSLDAQRHFSLSVENSNTKTPSSLIGSLPYAAPELLVPEPSPLGPGADIWALGVTMYT 876

Query: 256 LPLGKKEF 263
           + +GK  F
Sbjct: 877 MLMGKLPF 884

>KLLA0F08415g 783785..785851 gi|120930|sp|P09609|GALX_KLULA
           Kluyveromyces lactis GAL10 bifunctional protein
           [Includes: UDP-glucose 4-epimerase (Galactowaldenase);
           Aldose 1-epimerase (Mutarotase)], start by similarity
          Length = 688

 Score = 29.6 bits (65), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 58/129 (44%), Gaps = 9/129 (6%)

Query: 5   VLLTGASGFIALHVLDQLLAAGYE--VVGTVRSEEKAEPIKKELAKEHPNGKYQFEVVVD 62
            L+TG +G+I  H + +L  AGY+  VV  + +       + EL      G+      +D
Sbjct: 7   CLVTGGAGYIGSHTVVELCEAGYKCIVVDNLSNSSYESVARMELL----TGQEIKFAKID 62

Query: 63  IAAPNAFDAVFQKHTDLKYVLHTASPFSFGLTKSNEENYLIPATHGTKSVLESIQKYGKN 122
           +      + +F  +  +  VLH A   + G +      Y      GT ++LE ++ +  +
Sbjct: 63  LCELEPLNKLFDDY-KIDSVLHFAGLKAVGESTQIPLTYYFNNIVGTINLLECMKSH--D 119

Query: 123 VEHVIVTSS 131
           V+ ++ +SS
Sbjct: 120 VKKLVFSSS 128

>KLLA0B06545g 583095..583541 similar to sp|Q00381 Saccharomyces
           cerevisiae YJR058c APS2 AP-2 complex subunit, sigma2
           subunit, 17 KD, start by similarity
          Length = 148

 Score = 28.5 bits (62), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 30/67 (44%), Gaps = 2/67 (2%)

Query: 73  FQKHTDLKYVLHTASPFSFGLTKSNEENYLIPATHGTKSVLESIQKYGKNVEHVIVTSSY 132
           F KHT L Y  +    F  G+ K +EE   +   H    VL+S   +G   E  I+ + Y
Sbjct: 57  FSKHTKLVYKGYAGLYFVMGVDKQDEELIYLSQIHLFVEVLDSF--FGNVCELDILFNFY 114

Query: 133 AAIMRLD 139
              + +D
Sbjct: 115 KTYLVMD 121

>AER085C [2590] [Homologous to ScYKL182W (FAS1) - SH] (795193..801333)
            [6141 bp, 2046 aa]
          Length = 2046

 Score = 29.3 bits (64), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 31/71 (43%), Gaps = 13/71 (18%)

Query: 28   EVVGTVRSEEKAEPIKKELAKEHPNGKYQFEVVVDIAAPNAFDAVFQKHTDLKYVLHTAS 87
            EVVGT++   K  P+ +        GKY           + F+  FQK TD  YV+   S
Sbjct: 1387 EVVGTIKKSGK--PVIEVTTSFLYRGKY-----------SDFENTFQKSTDPVYVIQINS 1433

Query: 88   PFSFGLTKSNE 98
            P    + KS E
Sbjct: 1434 PKDIAVLKSKE 1444

>Scas_721.47
          Length = 344

 Score = 28.5 bits (62), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 26/46 (56%)

Query: 5   VLLTGASGFIALHVLDQLLAAGYEVVGTVRSEEKAEPIKKELAKEH 50
            ++TGAS  I     +Q+ A G+ +V   R+  K E +K+E  K++
Sbjct: 65  CVVTGASDGIGKEFANQMAARGFNLVLISRTLSKLEALKEEFEKKY 110

>CAGL0E04554g 439158..439880 no similarity, hypothetical start
          Length = 240

 Score = 28.1 bits (61), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 29/73 (39%), Gaps = 11/73 (15%)

Query: 18  VLDQLLAAGYEVVGTVRSEEKAEPIKKELAKEHPNGK-----------YQFEVVVDIAAP 66
           +LD   ++    V T+ S +K     K   K H   +             FE +  I+  
Sbjct: 80  ILDNKNSSQIRTVPTLCSSDKLSRCDKSTMKYHKKSESDEFEQFTSPDLHFEAIDSISVN 139

Query: 67  NAFDAVFQKHTDL 79
           N  D V++ HTDL
Sbjct: 140 NISDNVYESHTDL 152

>YJL029C (VPS53) [2881] chr10 complement(388301..390769) Subunit of
           the VFT (Sac2p-Vps53p-Luv1p) complex, involved in
           protein sorting in the late Golgi [2469 bp, 822 aa]
          Length = 822

 Score = 28.5 bits (62), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 25/59 (42%)

Query: 243 LACDVRDVAKLHVLPLGKKEFNGQRLFPVSDTGYGIEEYEKGKFNFEKILRILNEKLPE 301
           L CD    A++    L K  F  + +F V D    +E   +    F+KIL   N K  +
Sbjct: 210 LDCDTSTRAQMIDWCLDKLLFEMKEIFRVDDEAGSLENLSRRYIYFKKILNNFNSKFAD 268

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.133    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,521,730
Number of extensions: 580371
Number of successful extensions: 1517
Number of sequences better than 10.0: 63
Number of HSP's gapped: 1362
Number of HSP's successfully gapped: 63
Length of query: 354
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 251
Effective length of database: 13,030,455
Effective search space: 3270644205
Effective search space used: 3270644205
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 62 (28.5 bits)