Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0D10978g27026613050.0
Sklu_1881.12592646166e-80
Scas_654.182722745403e-68
AFR041C2572665375e-68
Kwal_33.146032572705151e-64
CAGL0J05962g2932804962e-61
YNL155W2742844664e-57
AGR296W9828800.007
Kwal_55.2166811424800.009
KLLA0F16214g11828800.010
CAGL0L10186g17323770.042
YOR052C15023730.13
Scas_698.4412323680.49
YKR017C55158619.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D10978g
         (266 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D10978g 936863..937675 similar to sp|P53899 Saccharomyces c...   507   0.0  
Sklu_1881.1 YNL155W, Contig c1881 336-1115 reverse complement         241   6e-80
Scas_654.18                                                           212   3e-68
AFR041C [3233] [Homologous to ScYNL155W - SH] (508245..509018) [...   211   5e-68
Kwal_33.14603                                                         202   1e-64
CAGL0J05962g complement(562367..563248) similar to sp|P53899 Sac...   195   2e-61
YNL155W (YNL155W) [4442] chr14 (342516..343340) Protein predicte...   184   4e-57
AGR296W [4607] [Homologous to ScYOR052C - SH] complement(1289161...    35   0.007
Kwal_55.21668                                                          35   0.009
KLLA0F16214g complement(1503855..1504211) some similarities with...    35   0.010
CAGL0L10186g complement(1094808..1095329) some similarities with...    34   0.042
YOR052C (YOR052C) [4862] chr15 complement(426773..427225) Protei...    33   0.13 
Scas_698.44                                                            31   0.49 
YKR017C (YKR017C) [3272] chr11 complement(471337..472992) Protei...    28   9.0  

>KLLA0D10978g 936863..937675 similar to sp|P53899 Saccharomyces
           cerevisiae YNL155w singleton, start by similarity
          Length = 270

 Score =  507 bits (1305), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/266 (92%), Positives = 246/266 (92%)

Query: 1   MTKEVGMLDVGTHCSFCRQTDFLPFHCSACNGDFCANHRLKEDHHCESLKIGKNSRSSVT 60
           MTKEVGMLDVGTHCSFCRQTDFLPFHCSACNGDFCANHRLKEDHHCESLKIGKNSRSSVT
Sbjct: 1   MTKEVGMLDVGTHCSFCRQTDFLPFHCSACNGDFCANHRLKEDHHCESLKIGKNSRSSVT 60

Query: 61  VSIPXXXXXXVTPKKDNGGSFFQSLLPARAPDRIKTMMQEDNSKPPVDNLKSKLFNSKTS 120
           VSIP      VTPKKDNGGSFFQSLLPARAPDRIKTMMQEDNSKPPVDNLKSKLFNSKTS
Sbjct: 61  VSIPAAAAAAVTPKKDNGGSFFQSLLPARAPDRIKTMMQEDNSKPPVDNLKSKLFNSKTS 120

Query: 121 SSRVAIDKLRHFFAKNGXXXXXXXXXXXXXXANKLIQVTKMKRTAKGDDSIPVANRIYAW 180
           SSRVAIDKLRHFFAKNG              ANKLIQVTKMKRTAKGDDSIPVANRIYAW
Sbjct: 121 SSRVAIDKLRHFFAKNGKLFESKKSTTKFSSANKLIQVTKMKRTAKGDDSIPVANRIYAW 180

Query: 181 CYVVADSSDKKPIANEVFINKMWPIGRALDSLASVLNVKNSNIDHSISTDEKLFLYKGDA 240
           CYVVADSSDKKPIANEVFINKMWPIGRALDSLASVLNVKNSNIDHSISTDEKLFLYKGDA
Sbjct: 181 CYVVADSSDKKPIANEVFINKMWPIGRALDSLASVLNVKNSNIDHSISTDEKLFLYKGDA 240

Query: 241 STQHLLPSSARVNATIQEGDTLYLVR 266
           STQHLLPSSARVNATIQEGDTLYLVR
Sbjct: 241 STQHLLPSSARVNATIQEGDTLYLVR 266

>Sklu_1881.1 YNL155W, Contig c1881 336-1115 reverse complement
          Length = 259

 Score =  241 bits (616), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 124/264 (46%), Positives = 164/264 (62%), Gaps = 18/264 (6%)

Query: 3   KEVGMLDVGTHCSFCRQTDFLPFHCSACNGDFCANHRLKEDHHCESLKIGKNSRSSVTVS 62
           +E GML+VGTHC +CRQ DFLPFHC+ CNGDFC+ HRLKE HHC  L   + ++ +    
Sbjct: 6   RETGMLEVGTHCGYCRQIDFLPFHCTYCNGDFCSTHRLKESHHCNWLLEQEKTKQNA--- 62

Query: 63  IPXXXXXXVTPKKDNGGSFFQSLLPARAPDRIKTMMQEDNSKPPVDNLKSKLFNSKTSSS 122
                       ++  G +FQ+LLP ++  R+K   Q + S     ++K  L  +K  S 
Sbjct: 63  --------CNLGRNGNGEYFQALLPEKSNIRLK---QNNESHSNSTSIKDHLVKNKNKS- 110

Query: 123 RVAIDKLRHFFAKNGXXXXXXXXXXXXXXANKLIQVTKMKRTAKGDDSIPVANRIYAWCY 182
             A++KL+ FF+KN               +NK I ++KMKRTAKGD  IPV+NRIY W Y
Sbjct: 111 --ALEKLKKFFSKNEKAFSKGKFSTKTSPSNKTILLSKMKRTAKGDSKIPVSNRIYVWVY 168

Query: 183 VVADSSDKKPIANEVFINKMWPIGRALDSLASVLNVKNSNIDHSISTDEKLFLYKGDAST 242
           +VAD +DK P  +E+FINK+WP+GR LD +A  L+VKN N  H  ST EKLFLYK D ++
Sbjct: 169 LVADENDK-PTKHEIFINKVWPMGRVLDYVAQQLDVKNVNSKHDASTKEKLFLYKEDPAS 227

Query: 243 QHLLPSSARVNATIQEGDTLYLVR 266
             LL  S RV  T+ +GDTLYLVR
Sbjct: 228 PLLLDPSCRVANTLHDGDTLYLVR 251

>Scas_654.18
          Length = 272

 Score =  212 bits (540), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 113/274 (41%), Positives = 157/274 (57%), Gaps = 25/274 (9%)

Query: 3   KEVGMLDVGTHCSFCRQTDFLPFHCSACNGDFCANHRLKEDHHCESLKIGKNSRSSVTVS 62
           +E GMLDVGTHC+FCR+ DFLPFHCS C+ DFC+NHRL+E H+CESL+  +  + S T  
Sbjct: 8   RETGMLDVGTHCAFCRELDFLPFHCSGCDKDFCSNHRLRESHYCESLQQRQEEKPSSTSH 67

Query: 63  IPXXXXXXVTPKKDNGGSFFQSLLPARAPDRIKTMMQEDNSKPPVDNLKSKLFNSKTSSS 122
           +            DNGG FF+SLLP +   R+  +    N+       + +   S  ++S
Sbjct: 68  VKVA---------DNGGKFFKSLLPEKGYIRVNNVPNNSNNNTVPRKTEGRTIRSTLNNS 118

Query: 123 RVAIDKLRHFFAKNGXXXXXXXXXXXXXXANKLIQVTKMKRTAKGDDSIPVANRIYAWCY 182
             A+ KL+HFF KN                NK++++  +K+ AKGD  IP++NRIY WCY
Sbjct: 119 --ALTKLKHFFQKN-HNKQNKLQRMKIFKPNKIVELNNLKKLAKGDSKIPLSNRIYIWCY 175

Query: 183 VVADSSDKKPIANEVFINKMWPIGRALDSLASVLNVKNSNIDHSISTDEKLFLYK----- 237
            V + +D K   + VFINK+WP+GR LD LA  LNVKN N     +T EKL+LYK     
Sbjct: 176 CVENGNDNK---SAVFINKIWPLGRVLDYLAKQLNVKNINNSFKATTKEKLYLYKEEIVK 232

Query: 238 -----GDASTQHLLPSSARVNATIQEGDTLYLVR 266
                 D    H++  S R +  +++ D +YLVR
Sbjct: 233 AKTNESDEVNFHMVNLSGRASEELKDLDVIYLVR 266

>AFR041C [3233] [Homologous to ScYNL155W - SH] (508245..509018) [774
           bp, 257 aa]
          Length = 257

 Score =  211 bits (537), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 111/266 (41%), Positives = 157/266 (59%), Gaps = 22/266 (8%)

Query: 3   KEVGMLDVGTHCSFCRQTDFLPFHCSACNGDFCANHRLKEDHHCESLKIGKNSRSSVTVS 62
           +E GMLDVG HC +CRQ DFLPFHC+ CN DFC+ HR +E HHC++L        +   +
Sbjct: 4   RETGMLDVGKHCQYCRQIDFLPFHCTLCNSDFCSVHRTQEAHHCKAL-------LAPGAA 56

Query: 63  IPXXXXXXVTPKKDNGGSFFQSLLPARAPDRIKTMMQEDNSKPPVD-NLKSKLFNSKTSS 121
            P       +  K     +F++LLP +A  R+K   QE + KP    ++K +L    +++
Sbjct: 57  TPASRSRSSSQAKGEREVYFKALLPDKAAVRVK---QETSEKPAQGTSIKDRLVQRNSTN 113

Query: 122 SRVAIDKLRHFFAKNGXXXXXXXXXXXXXXANKLIQVTKMKRTAKGDDSIPVANRIYAWC 181
              A+DKL+ FFAK                +NK+IQV K+KRTAKGDD IP  NR+Y WC
Sbjct: 114 ---ALDKLKRFFAK----YSSKRKNMNLSASNKVIQVAKIKRTAKGDDKIPHPNRVYIWC 166

Query: 182 YVVADSSDKKPIANEVFINKMWPIGRALDSLASVLNVKNSNIDHSISTDEKLFLYKGDAS 241
           Y + +S+   P  +++FIN+ WP+GR LD L+  ++VKN N+     + EKL+LYK    
Sbjct: 167 YYIDESN---PKEHDIFINRQWPLGRVLDYLSHHMDVKNVNLSAHAGSGEKLYLYKRVKE 223

Query: 242 TQ-HLLPSSARVNATIQEGDTLYLVR 266
            +  +L  S RVN  I+EGD LYL+R
Sbjct: 224 NEWKMLDPSGRVNGNIEEGDALYLIR 249

>Kwal_33.14603
          Length = 257

 Score =  202 bits (515), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 112/270 (41%), Positives = 165/270 (61%), Gaps = 28/270 (10%)

Query: 4   EVGMLDVGTHCSFCRQTDFLPFHCSACNGDFCANHRLKEDHHC-----ESLKIGKNSRSS 58
           E GMLDVGTHC+FCRQ DFLPFHC  C GDFC +HR +E H C     ES   G  ++S 
Sbjct: 2   ETGMLDVGTHCTFCRQLDFLPFHCKFCEGDFCGSHRSQEAHRCPKILKESSAAGNTTKSG 61

Query: 59  VTVSIPXXXXXXVTPKKDNGGSFFQSLLPARAPDRIKTMMQEDN-SKPPVDNLKSKLFNS 117
                         P +++ G +F +LLP +A  R+K  ++  + +K    +++S+L   
Sbjct: 62  -------------EPVRNSNGEYFSTLLPEKAHIRVKQAVEAPSVAKGNNSSVRSRL--- 105

Query: 118 KTSSSRVAIDKLRHFFAKNGXXXXXXXXXXXXXXANKLIQVTKMKRTAKGDDSIPVANRI 177
           + S +R A++KL+ FF +                AN++I+V K+K+TAKGD  IPV NR+
Sbjct: 106 EASGNRSALEKLKSFFGRR--SGSKAGSLTKARPANRIIEVAKLKKTAKGDPKIPVVNRV 163

Query: 178 YAWCYVVADSSDKKPIANEVFINKMWPIGRALDSLASVLNVKNSNIDHSISTD-EKLFLY 236
           Y +C+ V ++ D+  + +E+FINK+WP+GRALD +AS L V+N N +H  S+D E+LFLY
Sbjct: 164 YVFCFSV-EAQDEN-VKHELFINKVWPVGRALDYIASQLAVRNVN-NHVQSSDKERLFLY 220

Query: 237 KGDASTQHLLPSSARVNATIQEGDTLYLVR 266
                T   L +++R+   I++GDTLYLVR
Sbjct: 221 CDKNGTPSNLDTASRIANIIKDGDTLYLVR 250

>CAGL0J05962g complement(562367..563248) similar to sp|P53899
           Saccharomyces cerevisiae YNL155w, hypothetical start
          Length = 293

 Score =  195 bits (496), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 111/280 (39%), Positives = 152/280 (54%), Gaps = 24/280 (8%)

Query: 3   KEVGMLDVGTHCSFCRQTDFLPFHCSACNGDFCANHRLKEDHHCESLKIGKNSRSSVTVS 62
           KE GMLDVGTHC +CRQ DFLPFHC  C+GDFC+ HR KE HHC+ L        +    
Sbjct: 19  KETGMLDVGTHCQYCRQLDFLPFHCKLCDGDFCSEHRSKESHHCKWLLDHPEELENNGAR 78

Query: 63  IPXXXXXXVTPKKDNGGSFFQSLLPARAPDRIKTMMQEDNSKPPVDNLKSKLFNSKTSSS 122
            P       +  K NGG FFQSLLP +A  R+K+      +      L S    +K   S
Sbjct: 79  SPP------SSSKSNGGKFFQSLLPEKAHIRVKSPSPSSTTSQSPVKLGSSGVTTKNKPS 132

Query: 123 RV----------AIDKLRHFFAKNGXXXXXXXXXXXXXXANKLIQVTKMKRTAKGDDSIP 172
                       A++KL +FF +                +N+L++++ +K+TAKGD  IP
Sbjct: 133 ETTKIRSTLNPAALNKLLNFFKRT--KSDPKTKKKVSTSSNRLVELSTLKKTAKGDSKIP 190

Query: 173 VANRIYAWCYVVA---DSSDKKPIAN-EVFINKMWPIGRALDSLASVLNVKNSNIDHSIS 228
           V NRIY +C V+    ++SD   +    ++INK+WP+GRALD L+  L+V N N +   +
Sbjct: 191 VQNRIYIYCQVILGEDETSDTLGLTKVPLYINKIWPVGRALDYLSQQLHVTNVNGNVDTT 250

Query: 229 TDEKLFLYKGDASTQHL--LPSSARVNATIQEGDTLYLVR 266
             EKLFLYK D        + +S RVN  +++ DTLYLVR
Sbjct: 251 KGEKLFLYKYDEKLNEYVGIETSGRVNVLVKDLDTLYLVR 290

>YNL155W (YNL155W) [4442] chr14 (342516..343340) Protein predicted
           to have structural similarity to disulfide
           oxidoreductases [825 bp, 274 aa]
          Length = 274

 Score =  184 bits (466), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 117/284 (41%), Positives = 157/284 (55%), Gaps = 42/284 (14%)

Query: 1   MTKEVGMLDVGTHCSFCRQTDFLPFHCSACNGDFCANHRLKEDHHCESL----KIGKNSR 56
           + KE GMLDVG HC++CRQ DFLPFHCS CN DFC+NHRLKEDHHC  L    ++ K  +
Sbjct: 5   IEKETGMLDVGKHCAYCRQLDFLPFHCSFCNEDFCSNHRLKEDHHCRWLLEHEEVHKTEK 64

Query: 57  SSVTVSIPXXXXXXVTPKKDNGGS------FFQSLLPARAPDRIKTMMQEDNSKPPVDNL 110
           S               P K   GS      +F+SLLP RA  RI+ + +        +  
Sbjct: 65  S---------------PSKSRDGSSSNDEAYFKSLLPERASVRIQRVSETREPLRGSNTA 109

Query: 111 K-SKLFNSKTSSSRVAIDKLRHFFAKNGXXXXXXXXXXX-XXXANKLIQVTKMKRTAKGD 168
           K S   NSKT      +DK+  FF +N                +NK+IQ+  +K+ AKGD
Sbjct: 110 KVSSTLNSKT------LDKIFKFFQRNEKRKSNNKSKKNFGSSSNKIIQLANLKKIAKGD 163

Query: 169 DSIPVANRIYAWCYVVADSSDKKPIANE-----VFINKMWPIGRALDSLASVLNVKNSNI 223
             IP+ NRIY WCY+V    D+  IA E     ++INKMWP+GRA+D L+  LNVK+S +
Sbjct: 164 PKIPMQNRIYIWCYLV--DGDETDIAKEDTRMPLYINKMWPVGRAMDYLSIQLNVKSSTL 221

Query: 224 DHSISTDEKLF--LYKGDASTQHLLPSSARVNATIQEGDTLYLV 265
            +S S D+     L +G   + + + +S RV   I++ DTLYLV
Sbjct: 222 TNSSSNDKFQLCKLKEGKQVSFYNIGASLRVTNEIKDLDTLYLV 265

>AGR296W [4607] [Homologous to ScYOR052C - SH]
          complement(1289161..1289457) [297 bp, 98 aa]
          Length = 98

 Score = 35.4 bits (80), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 17/28 (60%)

Query: 27 CSACNGDFCANHRLKEDHHCESLKIGKN 54
          C  C+G FC+ HRL E+H C  L+  K 
Sbjct: 49 CQFCDGQFCSRHRLMENHTCRGLRTCKE 76

>Kwal_55.21668
          Length = 114

 Score = 35.4 bits (80), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 16/24 (66%)

Query: 27 CSACNGDFCANHRLKEDHHCESLK 50
          C  C G FC+ HRL E+H C+ LK
Sbjct: 65 CQFCQGHFCSRHRLMENHSCQGLK 88

>KLLA0F16214g complement(1503855..1504211) some similarities with
          sgd|S0005578 Saccharomyces cerevisiae YOR052c,
          hypothetical start
          Length = 118

 Score = 35.4 bits (80), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%)

Query: 27 CSACNGDFCANHRLKEDHHCESLKIGKN 54
          C+ C+G FC+ HRL E+H C+ LK  K+
Sbjct: 69 CNFCDGHFCSKHRLLENHQCQGLKSCKD 96

>CAGL0L10186g complement(1094808..1095329) some similarities with
           tr|Q08422 Saccharomyces cerevisiae YOR052c, hypothetical
           start
          Length = 173

 Score = 34.3 bits (77), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 16/23 (69%)

Query: 27  CSACNGDFCANHRLKEDHHCESL 49
           C+ C G +C+ HRL E+H CE L
Sbjct: 124 CNFCKGHYCSRHRLMENHACEGL 146

>YOR052C (YOR052C) [4862] chr15 complement(426773..427225) Protein
           containing an AN1-like zinc finger domain [453 bp, 150
           aa]
          Length = 150

 Score = 32.7 bits (73), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 15/23 (65%)

Query: 27  CSACNGDFCANHRLKEDHHCESL 49
           C+ C G FC+ HRL E+H C  L
Sbjct: 101 CNFCKGHFCSKHRLMENHACNGL 123

>Scas_698.44
          Length = 123

 Score = 30.8 bits (68), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 11/23 (47%), Positives = 14/23 (60%)

Query: 27 CSACNGDFCANHRLKEDHHCESL 49
          C  C   +C+ HRL E+H CE L
Sbjct: 74 CRFCQRQYCSKHRLMENHACEGL 96

>YKR017C (YKR017C) [3272] chr11 complement(471337..472992) Protein
           of unknown function, has a TRIAD composite zinc finger
           domain [1656 bp, 551 aa]
          Length = 551

 Score = 28.1 bits (61), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 14/58 (24%), Positives = 29/58 (50%), Gaps = 3/58 (5%)

Query: 169 DSIPVANR---IYAWCYVVADSSDKKPIANEVFINKMWPIGRALDSLASVLNVKNSNI 223
           +S+ V N    +  W + VA  SD      ++F++    +  A++SL+ +L +K   +
Sbjct: 455 ESLKVLNEGRTVLKWSFAVAYYSDASHNLTKIFVDNQMLLANAVESLSELLQIKTPEV 512

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.131    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,861,435
Number of extensions: 298922
Number of successful extensions: 946
Number of sequences better than 10.0: 15
Number of HSP's gapped: 921
Number of HSP's successfully gapped: 15
Length of query: 266
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 166
Effective length of database: 13,134,309
Effective search space: 2180295294
Effective search space used: 2180295294
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 60 (27.7 bits)