Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0D10197g85684339360.0
Sklu_2397.884886522380.0
Kwal_27.968884187521240.0
Scas_626.683985419080.0
AAL175W88387718430.0
YML099C (ARG81)88087417590.0
CAGL0H06875g7022034846e-51
KLLA0F10373g348421336e-08
AFL033W382461329e-08
YBR240C (THI2)450481283e-07
Scas_597.4475441275e-07
Kwal_14.1631443621266e-07
Kwal_26.6732676381133e-05
CAGL0C01199g922331114e-05
CAGL0F05357g601371081e-04
CAGL0B03421g1355501071e-04
Scas_674.12*909281062e-04
YDR207C (UME6)836391043e-04
ADR404C875511043e-04
Sklu_2064.2922341025e-04
YMR280C (CAT8)1433501027e-04
Sklu_2376.6922371017e-04
AGL091W866331017e-04
Kwal_55.20722827431018e-04
KLLA0A10329g63952990.001
KLLA0F14322g71760990.001
KLLA0D00484g100439990.001
AGL099C74739980.001
Scas_663.1294442980.001
Scas_717.3390474980.002
AGL206C73547980.002
KLLA0F20680g78739980.002
YLR256W (HAP1)150251980.002
Kwal_26.709583837980.002
Scas_596.470133970.002
YDR213W (UPC2)91344970.002
Sklu_2434.1098340970.002
Scas_573.4147851970.002
Kwal_56.2456675589970.002
KLLA0A04169g77577960.003
ADR405C80740960.003
Sklu_1373.260838960.003
Scas_556.6102233960.003
Kwal_23.317861143950.003
KLLA0C16489g72830950.003
Kwal_26.680594440950.003
KLLA0D01452g144548950.004
KLLA0C17050g95535950.004
Scas_521.289037950.004
KLLA0F09559g65836950.004
KLLA0A06039g65739940.004
KLLA0F22990g125327950.004
CAGL0J07150g102243940.005
CAGL0L04400g98741940.005
YLR228C (ECM22)81433940.005
KLLA0A03421g88044940.005
CAGL0K05841g137233940.005
YOR363C (PIP2)99633940.005
Kwal_23.652959838930.005
YCR106W (RDS1)83237940.005
KLLA0F02387g72740940.005
YDR421W (ARO80)95041940.006
CAGL0F07865g84433930.006
YLR014C (PPR1)90437930.006
Scas_550.5*83228930.006
AGR061C61240930.007
AFR117C115235930.007
ACL058W81746930.007
Scas_696.44116441930.007
Scas_711.3193234920.008
CAGL0E05434g81651920.008
YOR172W (YRM1)78638910.010
ADR403C97034910.010
YLL054C76944910.011
Kwal_23.642573536910.011
Scas_721.9486933910.011
Scas_679.2677533910.012
Kwal_23.312278833910.012
AFR096W85251900.013
KLLA0D10153g65545900.015
AGL233C87238890.017
YLR278C134129890.018
Kwal_55.2067425240870.018
Scas_590.2117230890.019
Kwal_23.290588137890.019
YAL051W (OAF1)106242890.020
Kwal_27.10232120941890.020
KLLA0D05038g67381890.020
ABL121C128529890.021
KLLA0F00572g59733880.021
Sklu_2191.271835880.024
Kwal_14.2619116737880.024
AGL361C69642880.027
KLLA0D12650g65133870.028
KLLA0D11286g67849870.029
KLLA0A03443g97534870.033
Kwal_34.1575162828870.035
Sklu_2296.691951870.036
Kwal_47.1768185445870.037
CAGL0M12298g99428860.044
CAGL0A00451g110767860.044
KLLA0F22880g116452860.048
Sklu_2321.390637850.051
Kwal_56.2467064341850.052
KLLA0C04620g126938850.054
Scas_709.42374112840.055
YBL066C (SEF1)105736850.056
Scas_657.385623850.062
KLLA0D00396g36137830.070
KLLA0F19602g60338830.081
KLLA0C10923g77545830.087
YOR337W (TEA1)75940830.089
Scas_720.5889029830.091
Scas_625.5114184830.092
KLLA0E19701g68137830.098
AFR171W61229830.099
YJL089W (SIP4)82938830.10
ADR199C94439830.11
YLR266C (PDR8)70128820.12
KLLA0A09119g108238820.12
CAGL0H01507g79432820.12
Scas_702.7111370820.12
CAGL0G09757g142329820.12
YGL013C (PDR1)106852820.13
Sklu_2301.151737810.14
Scas_526.3110961820.14
YPR196W47029810.15
YOR162C (YRR1)81041810.15
Scas_659.1075730810.16
KLLA0E20405g113856810.17
Sklu_2411.1168738810.17
YKL038W (RGT1)117047810.18
AGR369W105156810.18
ACR241C79538800.19
CAGL0D03850g83432800.20
Scas_715.3111536800.22
CAGL0I07755g105340800.25
YKL015W (PUT3)97940800.25
CAGL0M03025g125452800.26
KLLA0D09977g63434790.26
CAGL0D02904g88733790.31
AFL160C64843780.38
CAGL0A04455g109836780.38
KLLA0F02750g114843780.38
CAGL0L03377g120933780.39
Kwal_47.1723394873780.41
Scas_449.163650770.42
ACL195C10936720.42
Sklu_1622.277829770.43
CAGL0K11902g83135770.45
Sklu_1973.177732770.50
Kwal_47.1808974527770.51
CAGL0L04576g86570770.56
KLLA0F04213g76829770.56
YDR034C (LYS14)79035770.57
Scas_709.5175974760.57
YER031C (YPT31)22354740.57
AGR280C110628760.61
AAL057C80932760.62
YOR380W (RDR1)54657760.65
KLLA0A01804g94576760.65
KLLA0A02585g37029750.66
YHR056C (RSC30)88330760.66
YKL222C70530760.67
Scas_699.793537760.70
KLLA0F18084g86029760.72
ADR365W70144750.82
KLLA0F13904g57956750.82
Scas_630.1470141750.86
Scas_588.1183570750.89
CAGL0H00396g94032750.91
KLLA0C19228g59129740.95
Scas_661.2374129750.96
KLLA0F10835g75629750.96
Kwal_27.10852104656751.0
ACR028C60129741.1
YMR019W (STB4)94944741.1
CAGL0M02651g46240731.2
Scas_702.7d97835741.3
Kwal_56.2305877529731.3
YPL248C (GAL4)88129731.3
YPL133C (RDS2)44655731.4
YGR288W (MAL13)47329731.4
YBR297W (MAL33)46843731.5
ABL099W80029731.6
Sklu_2268.287525731.6
CAGL0F09229g83533731.6
Kwal_23.351457930721.6
Scas_638.14104337721.8
Kwal_14.81956832721.9
YDL170W (UGA3)52829721.9
Scas_669.863733722.1
Kwal_26.744871436722.1
AFL031W51736712.3
Scas_680.2573829712.3
YHR178W (STB5)74353712.3
CAGL0M05907g89137712.9
Kwal_47.1686274343703.0
Scas_720.48117962703.5
Kwal_23.653755244703.5
Scas_700.4040735693.6
YNR063W60733694.2
Kwal_14.163645633694.2
Kwal_33.1393479734694.3
CAGL0K09394g22154675.5
Scas_712.4121954666.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D10197g
         (843 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D10197g complement(861726..864296) similar to sp|P05085 Sac...  1520   0.0  
Sklu_2397.8 YML099C, Contig c2397 9784-12330                          866   0.0  
Kwal_27.9688                                                          822   0.0  
Scas_626.6                                                            739   0.0  
AAL175W [12] [Homologous to ScYML099C (ARG81) - NSH] complement(...   714   0.0  
YML099C (ARG81) [3872] chr13 complement(74398..77040) Component ...   682   0.0  
CAGL0H06875g complement(682518..684626) some similarities with s...   191   6e-51
KLLA0F10373g 957948..958994 some similarities with sp|P38141 Sac...    56   6e-08
AFL033W [3160] [Homologous to ScYBR240C (THI2) - SH] complement(...    55   9e-08
YBR240C (THI2) [419] chr2 complement(700447..701799) Zinc-finger...    54   3e-07
Scas_597.4                                                             54   5e-07
Kwal_14.1631                                                           53   6e-07
Kwal_26.6732                                                           48   3e-05
CAGL0C01199g complement(121944..124712) similar to tr|Q12151 Sac...    47   4e-05
CAGL0F05357g 541830..543635 some similarities with sp|P39001 Sac...    46   1e-04
CAGL0B03421g complement(336071..340138) similar to sp|P12351 Sac...    46   1e-04
Scas_674.12*                                                           45   2e-04
YDR207C (UME6) [1046] chr4 complement(865005..867515) Global tra...    45   3e-04
ADR404C [2144] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C (...    45   3e-04
Sklu_2064.2 , Contig c2064 873-3641                                    44   5e-04
YMR280C (CAT8) [4234] chr13 complement(827027..831328) Transcrip...    44   7e-04
Sklu_2376.6 , Contig c2376 12573-15341 reverse complement              44   7e-04
AGL091W [4220] [Homologous to ScYLR228C (ECM22) - SH; ScYDR213W ...    44   7e-04
Kwal_55.20722                                                          44   8e-04
KLLA0A10329g 903873..905792 some similarities with ca|CA6113|IPF...    43   0.001
KLLA0F14322g 1328925..1331078 gi|32440908|emb|CAE00852.1 Kluyver...    43   0.001
KLLA0D00484g 44879..47893 no similarity, hypothetical start            43   0.001
AGL099C [4213] [Homologous to ScYDR207C (UME6) - SH] (516587..51...    42   0.001
Scas_663.12                                                            42   0.001
Scas_717.33                                                            42   0.002
AGL206C [4106] [Homologous to NOHBY] (311846..314053) [2208 bp, ...    42   0.002
KLLA0F20680g 1924148..1926511 weakly similar to sp|P39001 Saccha...    42   0.002
YLR256W (HAP1) [3650] chr12 (646417..650925) Transcription facto...    42   0.002
Kwal_26.7095                                                           42   0.002
Scas_596.4                                                             42   0.002
YDR213W (UPC2) [1051] chr4 (889744..892485) Sterol regulatory el...    42   0.002
Sklu_2434.10 YAL051W, Contig c2434 22765-25716                         42   0.002
Scas_573.4                                                             42   0.002
Kwal_56.24566                                                          42   0.002
KLLA0A04169g complement(376273..378600) similar to sgd|S0004218 ...    42   0.003
ADR405C [2145] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C (...    42   0.003
Sklu_1373.2 YDR207C, Contig c1373 1069-2895                            42   0.003
Scas_556.6                                                             42   0.003
Kwal_23.3178                                                           41   0.003
KLLA0C16489g 1444456..1446642 some similarities with ca|CA2184|I...    41   0.003
Kwal_26.6805                                                           41   0.003
KLLA0D01452g 124018..128355 gi|3228691|gb|AAC23607.1 Kluyveromyc...    41   0.004
KLLA0C17050g 1490472..1493339 some similarities with ca|CA3454|I...    41   0.004
Scas_521.2                                                             41   0.004
KLLA0F09559g complement(876719..878695) some similarities with s...    41   0.004
KLLA0A06039g 557368..559341 weakly similar to sp|P36023 Saccharo...    41   0.004
KLLA0F22990g 2134385..2138146 similar to sp|P12351 Saccharomyces...    41   0.004
CAGL0J07150g complement(686734..689802) similar to sp|P39720 Sac...    41   0.005
CAGL0L04400g complement(511762..514725) similar to tr|Q12340 Sac...    41   0.005
YLR228C (ECM22) [3628] chr12 complement(600021..602465) Sterol r...    41   0.005
KLLA0A03421g 308414..311056 weakly similar to sp|P39720 Saccharo...    41   0.005
CAGL0K05841g 572315..576433 similar to sp|P12351 Saccharomyces c...    41   0.005
YOR363C (PIP2) [5140] chr15 complement(1020218..1023208) Transcr...    41   0.005
Kwal_23.6529                                                           40   0.005
YCR106W (RDS1) [627] chr3 (310954..313452) Protein with similari...    41   0.005
KLLA0F02387g complement(213669..215852) similar to sp|P47988 Sac...    41   0.005
YDR421W (ARO80) [1245] chr4 (1312028..1314880) Positive transcri...    41   0.006
CAGL0F07865g complement(768270..770804) similar to tr|Q12151 Sac...    40   0.006
YLR014C (PPR1) [3432] chr12 complement(172267..174981) Transcrip...    40   0.006
Scas_550.5*                                                            40   0.006
AGR061C [4371] [Homologous to ScYLR098C (CHA4) - SH] (831058..83...    40   0.007
AFR117C [3309] [Homologous to ScYLR256W (HAP1) - SH] (646832..65...    40   0.007
ACL058W [991] [Homologous to NOHBY] complement(261723..264176) [...    40   0.007
Scas_696.44                                                            40   0.007
Scas_711.31                                                            40   0.008
CAGL0E05434g 532577..535027 similar to sp|P47988 Saccharomyces c...    40   0.008
YOR172W (YRM1) [4969] chr15 (654210..656570) Protein with simila...    40   0.010
ADR403C [2143] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C (...    40   0.010
YLL054C (YLL054C) [3369] chr12 complement(32894..35203) Protein ...    40   0.011
Kwal_23.6425                                                           40   0.011
Scas_721.94                                                            40   0.011
Scas_679.26                                                            40   0.012
Kwal_23.3122                                                           40   0.012
AFR096W [3288] [Homologous to ScYJL089W (SIP4) - SH] complement(...    39   0.013
KLLA0D10153g 858016..859983 weakly similar to sp|P35995 Saccharo...    39   0.015
AGL233C [4079] [Homologous to ScYKL222C - NSH; ScYOR172W - NSH] ...    39   0.017
YLR278C (YLR278C) [3671] chr12 complement(700001..704026) Protei...    39   0.018
Kwal_55.20674                                                          38   0.018
Scas_590.2                                                             39   0.019
Kwal_23.2905                                                           39   0.019
YAL051W (OAF1) [17] chr1 (48565..51753) Transcription factor req...    39   0.020
Kwal_27.10232                                                          39   0.020
KLLA0D05038g 433653..435674 weakly similar to sp|P40971 Saccharo...    39   0.020
ABL121C [471] [Homologous to ScYMR280C (CAT8) - SH] (170784..174...    39   0.021
KLLA0F00572g complement(42710..44503) some similarities with ca|...    39   0.021
Sklu_2191.2 YKL222C, Contig c2191 6517-8673 reverse complement         39   0.024
Kwal_14.2619                                                           39   0.024
AGL361C [3951] [Homologous to NOHBY] (24101..26191) [2091 bp, 69...    39   0.027
KLLA0D12650g complement(1073580..1075535) weakly similar to ca|C...    38   0.028
KLLA0D11286g complement(964642..966678) no similarity, hypotheti...    38   0.029
KLLA0A03443g 311628..314555 weakly similar to sp|P39720 Saccharo...    38   0.033
Kwal_34.15751                                                          38   0.035
Sklu_2296.6 YJL089W, Contig c2296 12179-14938 reverse complement       38   0.036
Kwal_47.17681                                                          38   0.037
CAGL0M12298g complement(1225753..1228737) similar to sp|P39720 S...    38   0.044
CAGL0A00451g 47557..50880 similar to sp|P12383 Saccharomyces cer...    38   0.044
KLLA0F22880g 2123577..2127071 some similarities with ca|CA3639|I...    38   0.048
Sklu_2321.3 YLR014C, Contig c2321 8747-11467                           37   0.051
Kwal_56.24670                                                          37   0.052
KLLA0C04620g complement(422705..426514) weakly similar to sp|Q05...    37   0.054
Scas_709.42                                                            37   0.055
YBL066C (SEF1) [131] chr2 complement(96906..100079) Protein with...    37   0.056
Scas_657.3                                                             37   0.062
KLLA0D00396g complement(36277..37362) some similarities with ca|...    37   0.070
KLLA0F19602g complement(1814949..1816760) similar to sp|P43634 S...    37   0.081
KLLA0C10923g complement(939148..941475) similar to sp|P07272 Sac...    37   0.087
YOR337W (TEA1) [5116] chr15 (954339..956618) Ty1 enhancer activa...    37   0.089
Scas_720.58                                                            37   0.091
Scas_625.5                                                             37   0.092
KLLA0E19701g complement(1739869..1741914) some similarities with...    37   0.098
AFR171W [3363] [Homologous to NOHBY] complement(752592..754430) ...    37   0.099
YJL089W (SIP4) [2826] chr10 (265842..268331) Transcriptional act...    37   0.10 
ADR199C [1940] [Homologous to ScYDR421W (ARO80) - SH] (1048530.....    37   0.11 
YLR266C (PDR8) [3660] chr12 complement(675621..677726) Zn[2]-Cys...    36   0.12 
KLLA0A09119g complement(797533..800781) weakly similar to sp|P12...    36   0.12 
CAGL0H01507g complement(147689..150073) similar to sp|Q06639 Sac...    36   0.12 
Scas_702.7                                                             36   0.12 
CAGL0G09757g 930351..934622 some similarities with sp|Q05854 Sac...    36   0.12 
YGL013C (PDR1) [1960] chr7 complement(469095..472301) Zinc-finge...    36   0.13 
Sklu_2301.1 , Contig c2301 1246-2795 reverse complement                36   0.14 
Scas_526.3                                                             36   0.14 
YPR196W (YPR196W) [5609] chr16 (931370..932782) Positive regulat...    36   0.15 
YOR162C (YRR1) [4961] chr15 complement(639560..641992) Transcrip...    36   0.15 
Scas_659.10                                                            36   0.16 
KLLA0E20405g <1805948..1809364 gi|3024604|sp|P87164|SEF1_KLULA K...    36   0.17 
Sklu_2411.11 YMR019W, Contig c2411 20506-22569 reverse complement      36   0.17 
YKL038W (RGT1) [3220] chr11 (365248..368760) Protein involved in...    36   0.18 
AGR369W [4680] [Homologous to ScYBL066C (SEF1) - SH] complement(...    36   0.18 
ACR241C [1288] [Homologous to ScYKR064W - SH] (784358..786745) [...    35   0.19 
CAGL0D03850g 384689..387193 weakly similar to sp|Q06639 Saccharo...    35   0.20 
Scas_715.3                                                             35   0.22 
CAGL0I07755g complement(745315..748476) similar to tr|Q12180 Sac...    35   0.25 
YKL015W (PUT3) [3241] chr11 (408187..411126) Transcription facto...    35   0.25 
CAGL0M03025g complement(341849..345613) similar to sp|P39113 Sac...    35   0.26 
KLLA0D09977g complement(841852..843756) weakly similar to sp|P40...    35   0.26 
CAGL0D02904g complement(302952..305615) similar to sp|P07272 Sac...    35   0.31 
AFL160C [3035] [Homologous to ScYPL248C (GAL4) - SH] (130842..13...    35   0.38 
CAGL0A04455g 432854..436150 similar to sp|P34228 Saccharomyces c...    35   0.38 
KLLA0F02750g complement(250368..253814) some similarities with s...    35   0.38 
CAGL0L03377g complement(382932..386561) some similarities with s...    35   0.39 
Kwal_47.17233                                                          35   0.41 
Scas_449.1                                                             34   0.42 
ACL195C [854] [Homologous to NOHBY] (19204..19533) [330 bp, 109 aa]    32   0.42 
Sklu_1622.2 YDR034C, Contig c1622 1522-3858                            34   0.43 
CAGL0K11902g complement(1148381..1150876) similar to sp|P40971 S...    34   0.45 
Sklu_1973.1 YDR303C, Contig c1973 815-3148 reverse complement          34   0.50 
Kwal_47.18089                                                          34   0.51 
CAGL0L04576g 526960..529557 similar to tr|Q12340 Saccharomyces c...    34   0.56 
KLLA0F04213g 400673..402979 similar to sp|P40971 Saccharomyces c...    34   0.56 
YDR034C (LYS14) [885] chr4 complement(509732..512104) Transcript...    34   0.57 
Scas_709.51                                                            34   0.57 
YER031C (YPT31) [1456] chr5 complement(214075..214746) GTP-bindi...    33   0.57 
AGR280C [4591] [Homologous to ScYLR278C - SH] (1266918..1270238)...    34   0.61 
AAL057C [130] [Homologous to ScYDR303C (RSC3) - SH; ScYHR056C (R...    34   0.62 
YOR380W (RDR1) [5153] chr15 (1051286..1052926) Protein with simi...    34   0.65 
KLLA0A01804g complement(159689..162526) similar to sgd|S0002829 ...    34   0.65 
KLLA0A02585g complement(226562..227674) some similarities with c...    33   0.66 
YHR056C (RSC30) [2344] chr8 complement(215184..217835) Component...    34   0.66 
YKL222C (YKL222C) [3053] chr11 complement(3504..5621) Protein wi...    34   0.67 
Scas_699.7                                                             34   0.70 
KLLA0F18084g complement(1652031..1654613) no similarity, hypothe...    34   0.72 
ADR365W [2106] [Homologous to ScYOR337W (TEA1) - SH] complement(...    33   0.82 
KLLA0F13904g complement(1287758..1289497) some similarities with...    33   0.82 
Scas_630.14                                                            33   0.86 
Scas_588.11                                                            33   0.89 
CAGL0H00396g complement(37005..39827) similar to sp|P08638 Sacch...    33   0.91 
KLLA0C19228g 1713787..1715562 similar to sp|P53749 Saccharomyces...    33   0.95 
Scas_661.23                                                            33   0.96 
KLLA0F10835g 997512..999782 no similarity, hypothetical start          33   0.96 
Kwal_27.10852                                                          33   1.0  
ACR028C [1076] [Homologous to NOHBY] (408701..410506) [1806 bp, ...    33   1.1  
YMR019W (STB4) [3983] chr13 (312155..315004) Sin3p-binding prote...    33   1.1  
CAGL0M02651g complement(304583..305971) similar to sp|P19541 Sac...    33   1.2  
Scas_702.7d                                                            33   1.3  
Kwal_56.23058                                                          33   1.3  
YPL248C (GAL4) [5202] chr16 complement(79711..82356) Transcripti...    33   1.3  
YPL133C (RDS2) [5312] chr16 complement(299887..301227) Protein w...    33   1.4  
YGR288W (MAL13) [2233] chr7 (1070298..1071719) Maltose pathway r...    33   1.4  
YBR297W (MAL33) [474] chr2 (800479..801885) Maltose fermentation...    33   1.5  
ABL099W [493] [Homologous to ScYDR034C (LYS14) - SH] complement(...    33   1.6  
Sklu_2268.2 YKR064W, Contig c2268 4260-6887 reverse complement         33   1.6  
CAGL0F09229g complement(908186..910693) weakly similar to sp|P39...    33   1.6  
Kwal_23.3514                                                           32   1.6  
Scas_638.14                                                            32   1.8  
Kwal_14.819                                                            32   1.9  
YDL170W (UGA3) [701] chr4 (156319..157905) Transcriptional activ...    32   1.9  
Scas_669.8                                                             32   2.1  
Kwal_26.7448                                                           32   2.1  
AFL031W [3162] [Homologous to ScYBR239C - SH] complement(376161....    32   2.3  
Scas_680.25                                                            32   2.3  
YHR178W (STB5) [2464] chr8 (459297..461528) Probable transcripti...    32   2.3  
CAGL0M05907g 622029..624704 similar to sp|P36023 Saccharomyces c...    32   2.9  
Kwal_47.16862                                                          32   3.0  
Scas_720.48                                                            32   3.5  
Kwal_23.6537                                                           32   3.5  
Scas_700.40                                                            31   3.6  
YNR063W (YNR063W) [4646] chr14 (746940..748763) Protein with sim...    31   4.2  
Kwal_14.1636                                                           31   4.2  
Kwal_33.13934                                                          31   4.3  
CAGL0K09394g complement(929234..929899) highly similar to sp|P51...    30   5.5  
Scas_712.41                                                            30   6.4  

>KLLA0D10197g complement(861726..864296) similar to sp|P05085
           Saccharomyces cerevisiae YML099c ARG81 transcription
           factor involved in arginine metabolism singleton, start
           by similarity
          Length = 856

 Score = 1520 bits (3936), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 740/843 (87%), Positives = 740/843 (87%)

Query: 1   MKPAKPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRWTRPIQFDTMG 60
           MKPAKPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRWTRPIQFDTMG
Sbjct: 1   MKPAKPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRWTRPIQFDTMG 60

Query: 61  NVTATPTGIKDPDEPQYQRRNVDFVRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKTWII 120
           NVTATPTGIKDPDEPQYQRRNVDFVR                             KTWII
Sbjct: 61  NVTATPTGIKDPDEPQYQRRNVDFVRYKEEYVYYEDMDDELSALSSPPLELISEDKTWII 120

Query: 121 KKFGVFKGTDXXXXXXXXXXXXXXNQVFINAIEXXXXXXXXXXXXXXTADSDSKEGTNLC 180
           KKFGVFKGTD              NQVFINAIE              TADSDSKEGTNLC
Sbjct: 121 KKFGVFKGTDKVKKRYVPRKKRKKNQVFINAIEKAQKKLANKKNKVKTADSDSKEGTNLC 180

Query: 181 TPEDMESSSANDDHTSAQQLHSLFEFDMNSLLFPGNEWISNELRDDALLSASAVQGETIP 240
           TPEDMESSSANDDHTSAQQLHSLFEFDMNSLLFPGNEWISNELRDDALLSASAVQGETIP
Sbjct: 181 TPEDMESSSANDDHTSAQQLHSLFEFDMNSLLFPGNEWISNELRDDALLSASAVQGETIP 240

Query: 241 FMGIRQNNTPDTPQTPLTVDNMGKKNGSVNGNCNDGRTSGNDNEDELARVYRLLFHRRGS 300
           FMGIRQNNTPDTPQTPLTVDNMGKKNGSVNGNCNDGRTSGNDNEDELARVYRLLFHRRGS
Sbjct: 241 FMGIRQNNTPDTPQTPLTVDNMGKKNGSVNGNCNDGRTSGNDNEDELARVYRLLFHRRGS 300

Query: 301 SDQPPPPTITSETKSGHAKETIGIVPLRNFVELNVPGSTMPRSAIEVIHSQVPDPSIFNR 360
           SDQPPPPTITSETKSGHAKETIGIVPLRNFVELNVPGSTMPRSAIEVIHSQVPDPSIFNR
Sbjct: 301 SDQPPPPTITSETKSGHAKETIGIVPLRNFVELNVPGSTMPRSAIEVIHSQVPDPSIFNR 360

Query: 361 PGNTNPLLDIPTTGVHVHGLARFLLNYYLQNVADLMTVVVLPTNSWKTIYFPRALKALGD 420
           PGNTNPLLDIPTTGVHVHGLARFLLNYYLQNVADLMTVVVLPTNSWKTIYFPRALKALGD
Sbjct: 361 PGNTNPLLDIPTTGVHVHGLARFLLNYYLQNVADLMTVVVLPTNSWKTIYFPRALKALGD 420

Query: 421 LTGIGYTXXXXXXXXXXXXXXXCFNLQSKFPKNSPEMKFFLTLGIEFRTQASSFLKRCLS 480
           LTGIGYT               CFNLQSKFPKNSPEMKFFLTLGIEFRTQASSFLKRCLS
Sbjct: 421 LTGIGYTSNSRNSLLNALLAVSCFNLQSKFPKNSPEMKFFLTLGIEFRTQASSFLKRCLS 480

Query: 481 NTVNQERYKDILTAILSMNSIDVVWGTMADCQVHLAICEDFVENRMKTRPKISAKAKALH 540
           NTVNQERYKDILTAILSMNSIDVVWGTMADCQVHLAICEDFVENRMKTRPKISAKAKALH
Sbjct: 481 NTVNQERYKDILTAILSMNSIDVVWGTMADCQVHLAICEDFVENRMKTRPKISAKAKALH 540

Query: 541 RIFSFLKLIQDSTSLDKVRTKEIVXXXXXXXXXXXXXXXXXXXXXEFKESLNREDGKIVI 600
           RIFSFLKLIQDSTSLDKVRTKEIV                     EFKESLNREDGKIVI
Sbjct: 541 RIFSFLKLIQDSTSLDKVRTKEIVILDNNSSIDSHISSGISLSNGEFKESLNREDGKIVI 600

Query: 601 EFFXXXXXXXXXXVAFPKGSHDSSGVTTPIFSNIASESYYYPKSNDTDNNILSTDALYGL 660
           EFF          VAFPKGSHDSSGVTTPIFSNIASESYYYPKSNDTDNNILSTDALYGL
Sbjct: 601 EFFSSPSSGKPSPVAFPKGSHDSSGVTTPIFSNIASESYYYPKSNDTDNNILSTDALYGL 660

Query: 661 PNSLILLFSDCVRLARHLEYYRQHNIVTPKAFKKLCTEFEQRILSWKSEWDFKVPGSPDH 720
           PNSLILLFSDCVRLARHLEYYRQHNIVTPKAFKKLCTEFEQRILSWKSEWDFKVPGSPDH
Sbjct: 661 PNSLILLFSDCVRLARHLEYYRQHNIVTPKAFKKLCTEFEQRILSWKSEWDFKVPGSPDH 720

Query: 721 FVNDTIEGVYHHTMSFYNGLIIYYFTVVKGLTYKYVKHHVQNVLNSLIQLTELIENKGVK 780
           FVNDTIEGVYHHTMSFYNGLIIYYFTVVKGLTYKYVKHHVQNVLNSLIQLTELIENKGVK
Sbjct: 721 FVNDTIEGVYHHTMSFYNGLIIYYFTVVKGLTYKYVKHHVQNVLNSLIQLTELIENKGVK 780

Query: 781 IVPLIWQGFMAGCACIDSNLQLEFKEWAAKLCKSGMGSYWGARQIMFEVWRRRLNGEQND 840
           IVPLIWQGFMAGCACIDSNLQLEFKEWAAKLCKSGMGSYWGARQIMFEVWRRRLNGEQND
Sbjct: 781 IVPLIWQGFMAGCACIDSNLQLEFKEWAAKLCKSGMGSYWGARQIMFEVWRRRLNGEQND 840

Query: 841 DWF 843
           DWF
Sbjct: 841 DWF 843

>Sklu_2397.8 YML099C, Contig c2397 9784-12330
          Length = 848

 Score =  866 bits (2238), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/865 (53%), Positives = 548/865 (63%), Gaps = 72/865 (8%)

Query: 7   RVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRWTRPIQFDTMGNVTATP 66
           R KTFTGCWTCRSRKVKCDL RP C+RCE+ G  CGGYD+KLRW++PI+FD  G     P
Sbjct: 13  RAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLRWSKPIKFDRYG--VQLP 70

Query: 67  TGIKDPD----EPQYQRRNVDFVRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKTWIIKK 122
                PD    EPQ+QRRN+ FVR                             KTWII K
Sbjct: 71  PSPNSPDSGSDEPQFQRRNIAFVRYQDEYEFYEDMDDELSALHSPPLENIAGDKTWIINK 130

Query: 123 FGVFKGTDXXXXXXXXXXXXXXNQVFINAIEXXXXXXXXXXXXXXTADSDSKEGTNLCTP 182
           FGVF+GT+              N  +                   +  S      +  TP
Sbjct: 131 FGVFRGTEKVKKKYVPRKKRKRNVSYNRG-----GSVSSKLSSTTSVKSKGSSSISNSTP 185

Query: 183 EDMESSSANDDHTSAQQLHSLFEFDMNSLLFPGNEWISNELRDDALLSASAVQGETIPFM 242
            D                  LF+FD +S+ F G+EWISNELRDDALLSASAVQG  IP  
Sbjct: 186 TD------------------LFDFDFSSMNFTGHEWISNELRDDALLSASAVQG--IPTN 225

Query: 243 GIRQNNTPDTPQTPLTVDNMGKKNGS---------------VNGNCNDGRTSGNDNEDEL 287
                   +  ++  T D    KN S               + G  N G  S  D   E+
Sbjct: 226 TFTFPAGGNHTESSATADFNDAKNASGQHHGQHQHRNQQSNIQGTVNGGFASI-DPIAEV 284

Query: 288 ARVYRLLFHRRGSSD---QPPPPTITSETKSGHAKETIGIVPLRNFVELNVPG--STMPR 342
           ++VYRLL HR    D   Q      T +T +    E   +VPL N + ++ PG  S MP 
Sbjct: 285 SQVYRLLSHRNEDKDKDVQEQQKHDTHQTIASQEDEFPSLVPLNNLISIHAPGGESRMPE 344

Query: 343 SAIEVIHSQVPDPSIFNRPGNTNPLLDIPTTGVHVHGLARFLLNYYLQNVADLMTVVVLP 402
           S +E++ S VPDPSIFN   + N LL +PTTG+HVHGLARFLLNYYLQNVADLMTVV LP
Sbjct: 345 SVLEIVPSVVPDPSIFNLQSDKNILLRLPTTGLHVHGLARFLLNYYLQNVADLMTVVALP 404

Query: 403 TNSWKTIYFPRALKALGDLTGIGYTXXXXXXXXXXXXXXXCFNLQSKFPKNSPEMKFFLT 462
           TN WKTIYFPRALKALGDL GIGYT               CFNLQSKFPKN+P+M+F+L 
Sbjct: 405 TNPWKTIYFPRALKALGDLAGIGYTSNSRNSLLNALLAVSCFNLQSKFPKNTPQMRFYLY 464

Query: 463 LGIEFRTQASSFLKRCLSNTVNQERYKDILTAILSMNSIDVVWGTMADCQVHLAICEDFV 522
           LGIEFR+QAS+FLK+CL+++ +QERYKDILTAILSMNSIDVVWGTMADCQ HL ICEDFV
Sbjct: 465 LGIEFRSQASNFLKKCLNSSAHQERYKDILTAILSMNSIDVVWGTMADCQYHLTICEDFV 524

Query: 523 ENRMKTRPKISAKAKALHRIFSFLKLIQDSTSLDKVRTKEIVXXXXXXXXXXXXXXXXX- 581
           E RMKTRPKIS KAKALHRIFSFLKLIQDST+LDKVR  EIV                  
Sbjct: 525 EERMKTRPKISEKAKALHRIFSFLKLIQDSTALDKVREGEIVIKDDEDVTGEQLQESQTG 584

Query: 582 ----XXXXEFKESLNREDGKIVIEFFXXXXXXXXXXVAFPKGSHDSSGVTTPIFSNIASE 637
                   EFKESLN++DGKI IEF               K    SS  +TPIF+NI SE
Sbjct: 585 QDLNIADGEFKESLNQKDGKIRIEFV--------------KQPQSSSSGSTPIFTNITSE 630

Query: 638 SYYYPKSNDTDNNILSTDALYGLPNSLILLFSDCVRLARHLEYYRQHNIVTPKAFKKLCT 697
           +YYYPK + T  +ILSTDALYGLPNSLIL FSDCVRL RH EYY+ + +  P+ + KLCT
Sbjct: 631 TYYYPKMSTTTQDILSTDALYGLPNSLILCFSDCVRLVRHREYYKMNKLPAPRKYAKLCT 690

Query: 698 EFEQRILSWKSEWDFKVPGSPDHFVNDTIEGVYHHTMSFYNGLIIYYFTVVKGLTYKYVK 757
           EFE+R+L+WKSEWDF  P + + FVNDTIEGVYHHTMSFY  LIIYYFT+ + L  + ++
Sbjct: 691 EFEKRLLNWKSEWDFYKPHTRE-FVNDTIEGVYHHTMSFYYSLIIYYFTMARDLNNQLLQ 749

Query: 758 HHVQNVLNSLIQLTELIENKGVKIVPLIWQGFMAGCACIDSNLQLEFKEWAAKLCKSGMG 817
            +V+ VL+ L QL++LI++K VK+VPLIWQGF+AGC+ +DSNLQL FK+WAAKL  SGMG
Sbjct: 750 SYVEKVLSHLNQLSDLIDHKNVKVVPLIWQGFIAGCSSVDSNLQLSFKKWAAKLASSGMG 809

Query: 818 SYWGARQIMFEVWRRRLNGEQNDDW 842
           SYWGARQIMFEVWRRR+NGE+ND+W
Sbjct: 810 SYWGARQIMFEVWRRRMNGEENDNW 834

>Kwal_27.9688
          Length = 841

 Score =  822 bits (2124), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/875 (50%), Positives = 548/875 (62%), Gaps = 79/875 (9%)

Query: 1   MKPAKP---------RVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRWT 51
           MKP K          RVKTFTGCWTCRSRKVKCDL +P C+RCEK GL CGGYD+KLRW+
Sbjct: 1   MKPRKSSDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLRWS 60

Query: 52  RPIQFDTMGNVTATPTGIKDPDEPQYQRRNVDFVRXXXXXXXXXXXXXXXXXXXXXXXXX 111
             I+F+  G V +  +     +EPQ QRRNV FV                          
Sbjct: 61  PSIKFNKFGQVDSNGSPANGTEEPQSQRRNVGFVTYKDEYEFYEDMDEELSALHSPSQDK 120

Query: 112 XXXXKTWIIKKFGVFKGTDXXXXXXXXXXXXXXNQVFINAIEXXXXXXXXXXXXXXTADS 171
               KTWIIKKFGVF+GT+                   N                 + D 
Sbjct: 121 ISDNKTWIIKKFGVFRGTE-------------------NVKTKYTPRRKRRQAGRVSEDQ 161

Query: 172 DSKEGTNLCTPEDMESSSANDDHTSAQQLHSLFEFDMNSLLFPGNEWISNELRDDALLSA 231
             K  T   T       +A+ + TS+Q L +LF+FD +S+ F G+EWI+NELRDDALLSA
Sbjct: 162 IKKPPT---TEIKRPHINADSEITSSQSLANLFDFDFSSMNFNGHEWIANELRDDALLSA 218

Query: 232 SAVQGETIPFM------------GIRQNNTPDTPQTPLTVDNMGKKNGSVNGNCNDGRTS 279
           SA+QG T+  +              R+ ++ +T   P  +    +++   N   N  + +
Sbjct: 219 SAIQGGTMDNLFQRPQGQTSFSANNRRQSSYNTLHLPRRLQPDQEESDQTN---NQLQKA 275

Query: 280 GNDNEDELARVYRLLFHRRGSSDQPPPPTITSETKSGHAKETIGIVPLRNFVELNVPGST 339
           G  + D+++RVY+LLFHR     +             H   TI  VPL N + +N  G+ 
Sbjct: 276 GPADVDDISRVYKLLFHRNEDRSKVTQQAPVVPIDDQHVPRTI--VPLDNVILINSSGTE 333

Query: 340 --MPRSAIEVIHSQVPDPSIFNRPGNTNPLLDIPTTGVHVHGLARFLLNYYLQNVADLMT 397
             MP+  +EV++S VPD +IFN P N N LL +PTTG+ VHGL RFL+NYYLQNV DLMT
Sbjct: 334 GRMPKQVLEVVNSDVPDHTIFNLPTNDNILLRLPTTGLKVHGLTRFLMNYYLQNVVDLMT 393

Query: 398 VVVLPTNSWKTIYFPRALKALGDLTGIGYTXXXXXXXXXXXXXXXCFNLQSKFPKNSPEM 457
           VV LPTN W+TIYFPRA +ALGD+ G+GYT               CFNLQSKFP+NSPEM
Sbjct: 394 VVALPTNPWRTIYFPRAAQALGDIAGVGYTSNSRNSLLNAILAVSCFNLQSKFPRNSPEM 453

Query: 458 KFFLTLGIEFRTQASSFLKRCLSNTVNQERYKDILTAILSMNSIDVVWGTMADCQVHLAI 517
           +F+L LGIEFR QAS FLK CL+++  QERYKDILTAILSMNSIDVVWGTMADCQ HL +
Sbjct: 454 RFYLQLGIEFRGQASDFLKACLASSAKQERYKDILTAILSMNSIDVVWGTMADCQYHLTL 513

Query: 518 CEDFVENRMKTRPKISAKAKALHRIFSFLKLIQDSTSLDKVRTKEIVXXXXXXXXXXXXX 577
           CE  VE RMKTRPK+S KA+ALHRIFSFLKLIQDST+LDKV  +EIV             
Sbjct: 514 CEGLVEERMKTRPKLSGKARALHRIFSFLKLIQDSTALDKVHEREIV--IDHRIPESVVE 571

Query: 578 XXXXXXXXEFKESLNREDGKIVIEFFXXXXXXXXXXVAFPKGSHDSSGVTTPIFSNIASE 637
                   EFKESLN+ DGKI IE+                   +    +TPIF ++AS+
Sbjct: 572 NDVSDNGGEFKESLNKVDGKIRIEYV----------------KQNRKSGSTPIFDSVASQ 615

Query: 638 SYYYP----KSND-----TDNNILSTDALYGLPNSLILLFSDCVRLARHLEYYRQHNIVT 688
           +YYYP     S D       N++LSTDALYGLPNS+ILLFSDCVRLARH EYYR+H+   
Sbjct: 616 TYYYPGNRMGSGDYTKSLEGNDVLSTDALYGLPNSIILLFSDCVRLARHREYYRKHDQDP 675

Query: 689 PKAFKKLCTEFEQRILSWKSEWDFKVPGSPDHFVNDTIEGVYHHTMSFYNGLIIYYFTVV 748
           P++++ LC EFE+++  W SEWDF  P S + FVNDTIEGVY+HTMSFY  LIIYY T+ 
Sbjct: 676 PESYEILCAEFEKKLSGWTSEWDFHKPNSTE-FVNDTIEGVYYHTMSFYQSLIIYYNTMA 734

Query: 749 KGLTYKYVKHHVQNVLNSLIQLTELIENKGVKIVPLIWQGFMAGCACIDSNLQLEFKEWA 808
           +G  ++ ++ +V+N L  L +LTELI NKGVKIVPLIWQGF+AGC+ ID++LQL++KEWA
Sbjct: 735 RGRRHQDIQENVRNALTYLNKLTELI-NKGVKIVPLIWQGFIAGCSAIDTDLQLQYKEWA 793

Query: 809 AKLCKSGMGSYWGARQIMFEVWRRRLNGEQNDDWF 843
           A+L  SGMGSYWGARQIMFEVWRRR+NGE  D+WF
Sbjct: 794 ARLANSGMGSYWGARQIMFEVWRRRVNGENCDNWF 828

>Scas_626.6
          Length = 839

 Score =  739 bits (1908), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/854 (47%), Positives = 516/854 (60%), Gaps = 58/854 (6%)

Query: 7   RVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRWTRPIQFDTMG-NVTAT 65
           R KTFTGCWTCRSRKVKCDLRRPGC RC+K GL CGGYD+KLRW++ ++FD  G  +  +
Sbjct: 14  RAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLRWSKLVKFDPYGVQLPPS 73

Query: 66  PTG-IKDPDEPQYQRRNVDFVRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKTWIIKKFG 124
           P G     +EPQYQRRN+DFV+                             KTWIIKKFG
Sbjct: 74  PNGNSASNEEPQYQRRNIDFVKYKEEYIFHEDMDDELSILHAPPTEKIADGKTWIIKKFG 133

Query: 125 VFKGTDXXXXXXXXXXXXXXNQVFINAIEXXXXXXXXXXXXXXTADSDSKEGTNLCTPED 184
           VF+GTD                    A                +A   + +  N+   ED
Sbjct: 134 VFRGTDKIDKQYAPRKKRRKP-----APSTVSKRKTLKTGNKLSAKESAGKPINI---ED 185

Query: 185 MESSSANDDHTSAQQLHSLFEFDMNSLLFPGNEWISNELRDDALLSASAVQGETIPFMGI 244
             S   ++  +    + S  +FD+     P  EWIS+ELRDD LLSA A+QG +I     
Sbjct: 186 SPSKPMSNHQSPVNNIPSFVDFDLAMNNVPSYEWISSELRDDVLLSAFAIQGASI----- 240

Query: 245 RQNNTPDTPQTPLTVDNMGKKNGSVNGNC---------NDGRTSGNDNEDELARVYRLLF 295
             N+ PD+  +  T  N G  +  +  N          +D +TS N N+  +     LLF
Sbjct: 241 --NDVPDSTTSAKTSINQGTVSTGLFSNIPIDGTNSIGDDTQTSPN-NDYTIQNALNLLF 297

Query: 296 HRRGSSDQPPPPTITSETKSGHAKETIGIVPLRNFVELNVPGSTMPRSAIEVIHSQVPDP 355
           H + +      PT  S +K        G+V  +  ++     S MPR+ +E+I+    + 
Sbjct: 298 HNKQT------PTSPSTSK--------GMV--KTLLDAPQSDSHMPRTIMEIINPSPLEL 341

Query: 356 SIFNRPGNTNPLLDIPTTGVHVHGLARFLLNYYLQNVADLMTVVVLPTNSWKTIYFPRAL 415
            IF      N   +IP +GV+VHG+ +FLLNYYL+NVADLMTVV L  N WK +YFPRAL
Sbjct: 342 EIFEALNKLNLSWNIPASGVNVHGIGKFLLNYYLENVADLMTVVPLSRNPWKKLYFPRAL 401

Query: 416 KALGDLTGIGYTXXXXXXXXXXXXXXXCFNLQSKFPKNSPEMKFFLTLGIEFRTQASSFL 475
           +ALGDL G+GYT               CFNL+SKF KNS E  +FL LGIE R QAS+FL
Sbjct: 402 QALGDLVGLGYTTNSRNSLLNALLAVSCFNLKSKFEKNSKEYNYFLNLGIELRKQASNFL 461

Query: 476 KRCLSNTVNQERYKDILTAILSMNSIDVVWGTMADCQVHLAICEDFVENRMKTRPKISAK 535
             CL++TV  E+YKD+LTAILSMNSIDVVWGTM DCQ HL ICEDFVE RM +RP IS K
Sbjct: 462 NICLNSTVTVEKYKDVLTAILSMNSIDVVWGTMEDCQRHLTICEDFVEKRMNSRPHISGK 521

Query: 536 AKALHRIFSFLKLIQDSTSLDKVRTKEIVXXXXXXXXXXXXXX-----XXXXXXXEFKES 590
           A+ LHRIFSFLKLIQDST+LDKVR KEIV                          +F+ES
Sbjct: 522 ARTLHRIFSFLKLIQDSTALDKVRDKEIVIYGKKDKPDKNKVADPFVKDTSNNGGQFRES 581

Query: 591 LNREDGKIVIEFFXXXXXXXXXXVAFPKGSHDSSGVTTPIFSNIASESYYYP-KSNDTDN 649
           LN+ +GKI IE+                 +  S+  + P+F+NIASESYY P + +++D 
Sbjct: 582 LNKLNGKIQIEYIRNDDSN--------DNNEQSASSSPPMFANIASESYYKPGQKSESDY 633

Query: 650 NILSTDALYGLPNSLILLFSDCVRLARHLEYYRQHNIVTPKAFKKLCTEFEQRILSWKSE 709
           +ILSTDALYGLPNSLILLFSDCVR+ RH EYY    +  P+ F ++C  FE+R+L WK E
Sbjct: 634 DILSTDALYGLPNSLILLFSDCVRIVRHNEYYNIKYLAVPREFTEICLNFEKRLLKWKPE 693

Query: 710 WDFKVPGSPDHFVNDTIEGVYHHTMSFYNGLIIYYFTVVKGLTYKYVKHHVQNVLNSLIQ 769
           W F    + D F++DTIEGVYHHTMSFY GL+IYYF++ K L  ++++ +V+ VL  L +
Sbjct: 694 WAFYKENT-DEFIDDTIEGVYHHTMSFYYGLVIYYFSMAKHLNNQFLQSYVEKVLLHLNK 752

Query: 770 LTELIENKGVKIVPLIWQGFMAGCACIDSNLQLEFKEWAAKLCKSGMGSYWGARQIMFEV 829
           LT+LI++K VKIVPL+WQGF+AGC+    +LQ EF++WAAKL +SGMGSYWGARQ+MFEV
Sbjct: 753 LTDLIDHKSVKIVPLMWQGFIAGCSSNMQDLQQEFRKWAAKLAESGMGSYWGARQVMFEV 812

Query: 830 WRRRLNGEQNDDWF 843
           WRRR+N E ND+W+
Sbjct: 813 WRRRMNDEPNDNWY 826

>AAL175W [12] [Homologous to ScYML099C (ARG81) - NSH]
           complement(32874..35525) [2652 bp, 883 aa]
          Length = 883

 Score =  714 bits (1843), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/877 (44%), Positives = 514/877 (58%), Gaps = 79/877 (9%)

Query: 5   KPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRWTRPIQFDTMGNVTA 64
           +PR KTFTGCWTCR RKVKCDL +P C+RCEK GL CGGYD+KLRW+ PI+FD  GN  A
Sbjct: 35  RPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIKLRWSNPIRFDKFGNQMA 94

Query: 65  TPTGIKDPDEPQ--YQRRNVDFVRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKTWIIKK 122
                 D ++P   +QRRN+ FVR                             KTWIIK+
Sbjct: 95  GEDRDGDGEQPAQPFQRRNIMFVRYDEEYEYYEDMDDELSALHSPPLEMIADHKTWIIKR 154

Query: 123 FGVFKGTDXXXXXXXXXXXXXXNQVFINAI------------EXXXXXXXXXXXXXXTAD 170
           FGVFKGTD              N VF +A+            +               + 
Sbjct: 155 FGVFKGTDRVKRKYVPRKRRKVNPVFADAMAREHRRKLEEREKQARRKRKGELQGSLGSG 214

Query: 171 SDSKEGTNLCTPEDMESSSANDDHTSAQQLHSLFEFDMNSLLFPGNEWISNELRDDALLS 230
           + +  G     P   ES+ A     S      LF+FD ++     +EW++ EL+DD  LS
Sbjct: 215 NATGAGFAKAGPPAAESAGA----MSPVSATPLFDFDFSTPGLVSSEWMAGELKDDTTLS 270

Query: 231 ASAVQGETIPF---MGIRQNN---TPDT----------PQTPLTVDNMGKKNGSVNGNCN 274
            SA+   T+ F   + + Q+    T DT          P+  L + + G           
Sbjct: 271 -SAMLRNTLSFPTGLSVAQHGDGITADTAPPKSQSSIFPEQTLPLQSAG----------- 318

Query: 275 DGRTSGNDNEDELARVYRLLFHRRGSSDQPPPPTITSETKSGHAKETIGIVPLR-NFVEL 333
              T    + DE+++VYRLL + +G+            + +G+   +    P   + V +
Sbjct: 319 ---TMVPPSVDEVSKVYRLLLNNQGTD---------CNSSTGYKGLSGVHTPYTVDNVAI 366

Query: 334 NVPGSTMPRSAIEVIHSQVPDPSIFNRPGNTNPLLDIPTTGVHVHGLARFLLNYYLQNVA 393
           + P S MP SAIE + S VPDP+IF    +TN L+ +P  G+ +HGL RFLL+YY QNVA
Sbjct: 367 HGPESRMPASAIESVPSIVPDPTIFTLAEHTNSLIRLPRMGMQIHGLTRFLLSYYQQNVA 426

Query: 394 DLMTVVVLPTNSWKTIYFPRALKALGDLTGIGYTXXXXXXXXXXXXXXXCFNLQSKFPKN 453
           DLM+VV LP N WKTIYFPRA+KALG+L  +GYT               CF+LQSKFPKN
Sbjct: 427 DLMSVVALPKNPWKTIYFPRAVKALGELGALGYTSHSRNALLNALLAVSCFHLQSKFPKN 486

Query: 454 SPEMKFFLTLGIEFRTQASSFLKRCLSNTVNQERYKDILTAILSMNSIDVVWGTMADCQV 513
           S EMK+F++LG++FR QAS FL  CLS+T  QE YKD+LTAILSMNSIDVVWGTM+DCQ 
Sbjct: 487 SKEMKYFVSLGMDFRNQASGFLNACLSSTSRQEHYKDVLTAILSMNSIDVVWGTMSDCQY 546

Query: 514 HLAICEDFVENRMKTRPKISAKAKALHRIFSFLKLIQDSTSLDKVRTKEIVXXXXXXXXX 573
           HL ICE+F+E+RMK+RP +S KA+ LHRIFSFLKLIQDST+LDKV+ KEI+         
Sbjct: 547 HLTICEEFIESRMKSRPLLSEKARCLHRIFSFLKLIQDSTALDKVQEKEIIMKDAGDKEF 606

Query: 574 XXXXXXXXXXXXE-------FKESLNREDGKIVIEFFXXXXXXXXXXVAFPKGSHDSSGV 626
                       +       + E LN+++G++ IEF                G +  +  
Sbjct: 607 QKNGSSTPPLSTDSSSFTGRYVEQLNKDNGRVCIEFIEK------------DGQYFDTRG 654

Query: 627 TTPIFSNIASESYYYPKSNDTDNNILSTDALYGLPNSLILLFSDCVRLARHLEYYRQHNI 686
           + P+F+ I ++SY + + N+T  + LS D LYGLPNSLILLFSDCV L RH  Y+++HN 
Sbjct: 655 SVPLFNTIVTKSYPH-EINETRIDTLSMDVLYGLPNSLILLFSDCVSLVRHRFYFKRHNT 713

Query: 687 VTPKAFKKLCTEFEQRILSWKSEWDFKVPGSPDHFVNDTIEGVYHHTMSFYNGLIIYYFT 746
             P +F   C + EQR+LSWK EW F    S   F+NDT+EGVYHHTMSFY GL+IYYFT
Sbjct: 714 AQPTSFGLFCVKIEQRLLSWKPEWIFWKDDSKAEFINDTVEGVYHHTMSFYYGLLIYYFT 773

Query: 747 VVKGLTYKYVKHHVQNVLNSLIQLTELIENKGVKIVPLIWQGFMAGCACIDSNLQLEFKE 806
           + + L    ++++VQ VL+ L +L  +IE+K VKIVPL+WQGFMAGC+C DS++QLEFK+
Sbjct: 774 MARSLEDHTLQNYVQKVLSHLRELGNIIEHKDVKIVPLMWQGFMAGCSCTDSSMQLEFKK 833

Query: 807 WAAKLCKSGMGSYWGARQIMFEVWRRRLNGEQNDDWF 843
           W A+L   G+GSYWGARQIM EVWRRR+   + D+W+
Sbjct: 834 WTAQLVNFGIGSYWGARQIMLEVWRRRMTDGKCDNWY 870

>YML099C (ARG81) [3872] chr13 complement(74398..77040) Component of
           the ARGR regulatory complex, contains a Zn[2]-Cys[6]
           fungal-type binuclear cluster domain [2643 bp, 880 aa]
          Length = 880

 Score =  682 bits (1759), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/874 (44%), Positives = 492/874 (56%), Gaps = 57/874 (6%)

Query: 7   RVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRWTRPIQFDTMG-----N 61
           R KTFTGCWTCR RKVKCDLR P C+RCEK  L CGGYD+KLRW++P+QFD  G     N
Sbjct: 14  RAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRWSKPMQFDPYGVPIPQN 73

Query: 62  VTATPTGIKDP-DEPQYQRRNVDFVRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKTWII 120
             AT T +    DEPQYQRRN+DFVR                             KTWII
Sbjct: 74  SPATTTNLSGSVDEPQYQRRNIDFVRYDEEYVYHEDMDDELTMLHTPPIEKISDNKTWII 133

Query: 121 KKFGVFKGTDXXXXXXXXXXXXXXNQVFINAIEXXXXXXXXXXXXXXTADSDSKEGTNLC 180
           KKFGVFKGTD               +V  +                  +         L 
Sbjct: 134 KKFGVFKGTDKIDKQYAPRKKRNRKRVAKSLESSASISLSSLPSSSTISFPIRHIEDKLR 193

Query: 181 TPEDMESS--SANDDHTSAQQLHSLFEFDMNSLLFPGNEWISNELRDDALLSASAVQGET 238
               +++   SAND       L    ++D N+L   G EWIS+ELRDDALLSA  +QG  
Sbjct: 194 NKGHVKTGILSANDGVPPTPNL---LDYDWNNLNITGYEWISSELRDDALLSAVTLQGHH 250

Query: 239 IPFMGIRQNNTPDTPQTPLTVDNM-GKKNGSVNGNCNDGRT-----SGNDNEDELARVYR 292
           +     ++ +  +        +++  K++G      N G +     + + N+    +  +
Sbjct: 251 LGHTQPQEISLEENSNVVSGEEHVNAKEHGCAFEADNQGSSTLPNKAASANDKLYQQNLK 310

Query: 293 LLFHRRGS-SDQPPPPTITSETKSGHAKETIGIVPLRNFVELNVPG--STMPRSAIEVIH 349
           LLF +  S S++P P  +  +        ++    L N + L  P   S MP+S +E+  
Sbjct: 311 LLFQKNSSNSEEPDPQALIDDVFVNIEPRSLPASDL-NKITLAPPNEESRMPKSMLELTS 369

Query: 350 SQVPDPSIFNRPGNTNPLLD-IPTTGVHVHGLARFLLNYYLQNVADLMTVVVLPTNSWKT 408
                P           L+D IP T + VHGLARFLLN+Y  NVAD MTVVVL  N WKT
Sbjct: 370 YSSDLPP---------ELVDIIPKTDLTVHGLARFLLNHYFNNVADKMTVVVLEKNPWKT 420

Query: 409 IYFPRALKALGDLTGIGYTXXXXXXXXXXXXXXXCFNLQSKFPKNSPEMKFFLTLGIEFR 468
           +YFPRAL ALGDL G+G +               CF+LQSK+P+N    K+FL LGIE R
Sbjct: 421 LYFPRALMALGDLAGLGQSSNSRNALLNALLAVSCFHLQSKYPRNYKLQKYFLGLGIELR 480

Query: 469 TQASSFLKRCLSNTVN-QERYKDILTAILSMNSIDVVWGTMADCQVHLAICEDFVENRMK 527
            QAS+FL+ CL+   +  E+YKD+LTAILSMNSIDVVWGTMADCQ HLA+CEDFVE+RMK
Sbjct: 481 NQASNFLRLCLNTKSSIPEKYKDVLTAILSMNSIDVVWGTMADCQDHLALCEDFVESRMK 540

Query: 528 TRPKISAKAKALHRIFSFLKLIQDSTSLDKVRTKEIVXXXXXXXXXXXXXXXXXXXXXE- 586
            RP IS K K LHRIFSFLKLIQDST+LDKVR KEIV                       
Sbjct: 541 LRPNISEKTKTLHRIFSFLKLIQDSTALDKVRAKEIVILPSEEDDNYKPLDTSNATTSSS 600

Query: 587 -----------FKESLNREDGKIVIEFFXXXXXXXXXXVAFPKGSHDSSGVTTPIFSNIA 635
                      F+E+LN  DGKI IEF           +         S  T PIF+NIA
Sbjct: 601 EPRVDVVQEGLFREALNENDGKIHIEFV-------KEPITNVSADSTPSSTTPPIFTNIA 653

Query: 636 SESYYYPKS-----NDTDNNILSTDALYGLPNSLILLFSDCVRLARHLEYYRQHNIVTPK 690
           +ESYY         + TD NI+ TD+LYGLPNSLILLFSDCVR+ RH EYY    +  P+
Sbjct: 654 TESYYNKSDISKLVSKTDENIIGTDSLYGLPNSLILLFSDCVRIVRHNEYYNLTYLPVPR 713

Query: 691 AFKKLCTEFEQRILSWKSEWDFKVPGSP-DHFVNDTIEGVYHHTMSFYNGLIIYYFTVVK 749
            F +L   FE+R+L WKSEW+F    S    F+N T E +YHHTMSFY  LIIYYFT+ +
Sbjct: 714 KFNELSLNFEKRLLKWKSEWNFHQENSEGKSFINSTAEALYHHTMSFYFSLIIYYFTMAR 773

Query: 750 GLTYKYVKHHVQNVLNSLIQLTELIENKGVKIVPLIWQGFMAGCACIDSNLQLEFKEWAA 809
            L  ++++++V  VL+ L  + EL++ K VKIVPLIWQGFMAGCAC D N Q EF+ WAA
Sbjct: 774 SLNCQFLQNYVAKVLDHLNAMEELVDQKKVKIVPLIWQGFMAGCACTDENRQQEFRRWAA 833

Query: 810 KLCKSGMGSYWGARQIMFEVWRRRLNGEQNDDWF 843
           KL +SG+GSYWGARQ+M EVWRRR   E  D+W+
Sbjct: 834 KLAESGVGSYWGARQVMLEVWRRRKEDEPGDNWY 867

>CAGL0H06875g complement(682518..684626) some similarities with
           sp|05085 Saccharomyces cerevisiae YML099c ARG81,
           hypothetical start
          Length = 702

 Score =  191 bits (484), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 97/203 (47%), Positives = 128/203 (63%), Gaps = 7/203 (3%)

Query: 647 TDNNILSTDALYGLPNSLILLFSDCVRLARHLEYYRQHN--IVTPKAFKKLCTEFEQRIL 704
           T  N L  DAL  LPNSL+LLF DCV L R+  Y+++ +  I  P  F     EFE ++ 
Sbjct: 488 TKMNTLGADALNALPNSLVLLFYDCVSLTRYYFYHKKKSEGIELPTEFFMKTREFEDKLS 547

Query: 705 SWKSEWDFKVPGSPDHFVNDTIEGVYHHTMSFYNGLIIYYFTVVKGLTYKYVKHHVQNVL 764
           +WKSEWDF    +  +F++ TIEG+YHHTMSFY GL +YY+  +K   Y+ +   V  V+
Sbjct: 548 NWKSEWDF-FDSTGRNFLSPTIEGIYHHTMSFYYGLCVYYYNFIKNQDYESLNVEVWKVI 606

Query: 765 NSLIQLTELIEN----KGVKIVPLIWQGFMAGCACIDSNLQLEFKEWAAKLCKSGMGSYW 820
             L Q+  L ++    +G+K++PLIWQGF+AGC C D  +Q EFK W   +  +G GSY 
Sbjct: 607 YHLQQIEFLKDSSAGKEGIKLIPLIWQGFIAGCLCSDPEVQSEFKTWFDTVSLTGAGSYR 666

Query: 821 GARQIMFEVWRRRLNGEQNDDWF 843
           GA QIMFEVWRRR N E  DDW 
Sbjct: 667 GAIQIMFEVWRRRDNNELGDDWL 689

 Score =  134 bits (338), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 111/206 (53%), Gaps = 22/206 (10%)

Query: 377 VHGLARFLLNYYLQNVADLMTVVVLPT---NSWKTIYFPRALKALGDLTGIGYTXXXXXX 433
           VH   RFLL +YL+ V DLMT+  +P    N W  IYFPRA+ ALG+L     +      
Sbjct: 249 VHNNVRFLLTHYLEKVPDLMTIAPIPNKNKNPWAKIYFPRAIAALGELIAFPNSQNYARI 308

Query: 434 XXXX-XXXXXCFNLQSKFPKNSPEMKFFLTLGIEFRTQASSFLKRCLSNTVNQERYKDIL 492
                     CFNL+     +     F+L L +E RT+AS FL   L      E Y+DIL
Sbjct: 309 SLLNGCLSVSCFNLKDLLKYDPVSTDFYLNLAVELRTRASHFLNLALEQEEEYEEYRDIL 368

Query: 493 -----------------TAILSMNSIDVVWGTMADCQVHLAICEDFVENRMKTRPKISAK 535
                             AIL+MNSID+VWGTM DC  +L ICE  + ++ K R  +S K
Sbjct: 369 EDDDIAEDYNKHFCDMLIAILTMNSIDIVWGTMVDCDNYLRICEQLI-SKNKKRVVVSKK 427

Query: 536 AKALHRIFSFLKLIQDSTSLDKVRTK 561
            K+L+ I++FLKL+Q+ST+++ + ++
Sbjct: 428 IKSLYTIYAFLKLMQNSTAMETITSE 453

 Score = 97.1 bits (240), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 68/134 (50%), Gaps = 5/134 (3%)

Query: 2   KPAKPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRWTRPIQFDTMG- 60
           K +   VKT++GCWTCR+RKVKCDL RP C RC +  + CGGY +KLRW+  + FD  G 
Sbjct: 3   KKSTRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQCGGYKIKLRWSPLLHFDLYGV 62

Query: 61  ----NVTATPTGIKDPDEPQYQRRNVDFVRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXK 116
               N + T T   D +     RRNV+ VR                             K
Sbjct: 63  PMPSNESITTTEGDDVETSTNLRRNVERVRYEEEYEYHEDMDEELSELHAPPEDKIANNK 122

Query: 117 TWIIKKFGVFKGTD 130
           TWIIKKFGVF+  +
Sbjct: 123 TWIIKKFGVFRAIE 136

>KLLA0F10373g 957948..958994 some similarities with sp|P38141
          Saccharomyces cerevisiae YBR240c THI2 regulator of the
          thiamine biosynthetic genes singleton, hypothetical
          start
          Length = 348

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 23/42 (54%), Positives = 28/42 (66%), Gaps = 1/42 (2%)

Query: 9  KTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRW 50
          + FTGCW CR +K KCD R+P C  C K G+ C  YDV+L W
Sbjct: 5  RNFTGCWACRFKKRKCDERKPICSLCLKHGVEC-CYDVRLSW 45

>AFL033W [3160] [Homologous to ScYBR240C (THI2) - SH]
          complement(373485..374633) [1149 bp, 382 aa]
          Length = 382

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 29/46 (63%), Gaps = 1/46 (2%)

Query: 5  KPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRW 50
          KPR++ FTGCW CR +K +CD   P C  C K G  C  YDV+L W
Sbjct: 15 KPRIRCFTGCWACRFKKRRCDEGVPFCALCVKHGDAC-SYDVRLVW 59

>YBR240C (THI2) [419] chr2 complement(700447..701799) Zinc-finger
          regulatory protein for thiamine pyrophosphokinase
          (THI80) expression [1353 bp, 450 aa]
          Length = 450

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 29/48 (60%), Gaps = 3/48 (6%)

Query: 3  PAKPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRW 50
          P K R  TFTGCW CR +K +CD  RP C  C K G  C  YD++L W
Sbjct: 21 PTKGR--TFTGCWACRFKKRRCDENRPICSLCAKHGDNC-SYDIRLMW 65

>Scas_597.4
          Length = 475

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 28/44 (63%), Gaps = 1/44 (2%)

Query: 7  RVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRW 50
          + +TFTGCW CR +K +CD  +P C  C + G  C  YD++L W
Sbjct: 17 KARTFTGCWACRLKKRRCDELKPTCSLCVRHGDTC-SYDIRLMW 59

>Kwal_14.1631
          Length = 443

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 37/62 (59%), Gaps = 5/62 (8%)

Query: 4  AKPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRWTRPIQFDTMGNVT 63
          +K + ++FTGCW CR +K +CD  +P C  C K G  C  YD++L W    Q + + +V 
Sbjct: 5  SKTKARSFTGCWACRFKKRRCDEAKPVCSLCLKHGDQC-SYDIRLVW----QNENIFSVN 59

Query: 64 AT 65
          AT
Sbjct: 60 AT 61

>Kwal_26.6732
          Length = 676

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 24/38 (63%)

Query: 4  AKPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
          A P+ ++ TGC TCR R+ KCD R+P C  CE   L C
Sbjct: 2  APPKKRSVTGCLTCRKRRKKCDERKPVCTGCESNFLQC 39

>CAGL0C01199g complement(121944..124712) similar to tr|Q12151
          Saccharomyces cerevisiae YDR213w UPC2, hypothetical
          start
          Length = 922

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 23/33 (69%)

Query: 9  KTFTGCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
          K+ TGC  C+ R+VKCD  +PGC++C    L+C
Sbjct: 43 KSKTGCDNCKRRRVKCDEGKPGCKKCSNLNLVC 75

>CAGL0F05357g 541830..543635 some similarities with sp|P39001
           Saccharomyces cerevisiae YDR207c UME6, hypothetical
           start
          Length = 601

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 22/37 (59%)

Query: 5   KPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
           KP  ++ TGCW CR RK KC   +P C  C++  L C
Sbjct: 521 KPATRSRTGCWICRLRKKKCSEEKPACFNCQRLNLDC 557

>CAGL0B03421g complement(336071..340138) similar to sp|P12351
          Saccharomyces cerevisiae YLR256w HAP1 transcription
          factor, hypothetical start
          Length = 1355

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 26/50 (52%)

Query: 3  PAKPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRWTR 52
          P K R +    C  CR RKVKCD  RP C +C K G+    + ++  W +
Sbjct: 12 PKKKRNRIPLSCTICRKRKVKCDKTRPHCNQCTKTGVAHLCHYMEQNWAQ 61

>Scas_674.12*
          Length = 909

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 18/28 (64%)

Query: 14 CWTCRSRKVKCDLRRPGCERCEKGGLIC 41
          C  CRS+KVKCD  RP C RC K   +C
Sbjct: 15 CLVCRSKKVKCDKARPSCGRCRKTNKLC 42

>YDR207C (UME6) [1046] chr4 complement(865005..867515) Global
           transcriptional regulator containing a zinc binuclear
           cluster domain involved in pathway specific repression
           or induction [2511 bp, 836 aa]
          Length = 836

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 22/39 (56%), Gaps = 1/39 (2%)

Query: 8   VKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDV 46
            ++ TGCW CR RK KC   RP C  CE+  L C  YD 
Sbjct: 765 TRSRTGCWICRLRKKKCTEERPHCFNCERLKLDC-HYDA 802

>ADR404C [2144] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C
          (PIP2) - SH] (1432323..1434950) [2628 bp, 875 aa]
          Length = 875

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 1  MKPAKPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRWT 51
          +KP   + K    C  CR  K KCD  +P C RC + GL C GYD++ + T
Sbjct: 11 LKPNTHKRKLSYVCIPCRKCKTKCDKLKPTCSRCAELGLYC-GYDIEKQLT 60

>Sklu_2064.2 , Contig c2064 873-3641
          Length = 922

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 23/34 (67%), Gaps = 1/34 (2%)

Query: 14 CWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVK 47
          C  CR RK+KCD +RP C +C + GL C  YD++
Sbjct: 25 CLECRRRKIKCDKQRPCCIQCAEQGLTC-VYDIE 57

>YMR280C (CAT8) [4234] chr13 complement(827027..831328)
           Transcription factor required for derepression of
           gluconeogenic enzymes, contains an N-terminal
           Zn[2]-Cys[6] fungal-type binuclear cluster domain [4302
           bp, 1433 aa]
          Length = 1433

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 24/50 (48%)

Query: 4   AKPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRWTRP 53
           + P  +    C  CRS+K +CD +RP C +C   G  C   D  LR   P
Sbjct: 60  STPIYRIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRKAYP 109

>Sklu_2376.6 , Contig c2376 12573-15341 reverse complement
          Length = 922

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 20/37 (54%)

Query: 3  PAKPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGL 39
          P K R +T   C  C+ RK+KCD +RP C  C    +
Sbjct: 17 PKKKRQRTTVVCTNCKKRKIKCDRKRPACSNCSVANV 53

>AGL091W [4220] [Homologous to ScYLR228C (ECM22) - SH; ScYDR213W
           (UPC2) - SH] complement(535317..537917) [2601 bp, 866
           aa]
          Length = 866

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 22/33 (66%)

Query: 9   KTFTGCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
           K+  GC  C+ R+VKCD  +PGC++C K  L C
Sbjct: 84  KSKNGCDNCKRRRVKCDEGKPGCQKCLKMRLSC 116

>Kwal_55.20722
          Length = 827

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 24/43 (55%), Gaps = 1/43 (2%)

Query: 1  MKPAKPRV-KTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICG 42
          M    PRV +    C  CR+RK+KCD  RP C RC++  L C 
Sbjct: 1  MDRKSPRVNRPRLVCLECRNRKLKCDKARPKCTRCKQNLLTCS 43

>KLLA0A10329g 903873..905792 some similarities with
          ca|CA6113|IPF100.3 Candida albicans zinc finger
          protein, 3-prime end (by homology), hypothetical start
          Length = 639

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 5  KPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRW-TRPIQ 55
          K   +++ GC  C+S K KCD  +P C  C+K G  C  Y   L+W  RP +
Sbjct: 8  KKVARSYMGCQKCKSLKKKCDEVKPHCGYCKKRGFQC-DYSRTLKWGGRPFK 58

>KLLA0F14322g 1328925..1331078 gi|32440908|emb|CAE00852.1
           Kluyveromyces lactis Sip4 protein, start by similarity
          Length = 717

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 29/60 (48%), Gaps = 1/60 (1%)

Query: 1   MKPAKPRVKTFT-GCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRWTRPIQFDTM 59
           M  A  +VK F+  C  CR +K+KCD  +P C  C+K G  C   D   R   P  +  M
Sbjct: 49  MPTASTKVKRFSQACDRCRLKKIKCDGIKPSCSNCKKIGYHCSTSDKLTRRGFPRGYTEM 108

>KLLA0D00484g 44879..47893 no similarity, hypothetical start
          Length = 1004

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 2/39 (5%)

Query: 5  KPRVKTFT--GCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
          K R  T++  GC  C+    KCD R+P C RCEK  + C
Sbjct: 60 KKRKSTYSRKGCLQCKKAHTKCDERKPKCSRCEKRSIDC 98

>AGL099C [4213] [Homologous to ScYDR207C (UME6) - SH]
           (516587..518830) [2244 bp, 747 aa]
          Length = 747

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 22/39 (56%), Gaps = 1/39 (2%)

Query: 8   VKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDV 46
            ++ TGCW CR RK KC   RP C  C +  L C  YD+
Sbjct: 674 TRSRTGCWICRLRKKKCSEERPQCSNCLRLNLEC-VYDI 711

>Scas_663.12
          Length = 944

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/42 (47%), Positives = 22/42 (52%), Gaps = 1/42 (2%)

Query: 5  KPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDV 46
          K R +    C  CR  KVKCD  +P C RC K  L C  YDV
Sbjct: 31 KKRYRLSFVCQGCRRSKVKCDQEKPVCSRCSKHDLEC-VYDV 71

>Scas_717.33
          Length = 904

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 34/74 (45%), Gaps = 17/74 (22%)

Query: 9  KTFTGCWTCRSRKVKCDL------RRPGCERCEKGGLIC----GGYDVKLRWTRPIQFDT 58
          ++F  C +CR RKVKCDL       +P C RC + G  C    GG  +           T
Sbjct: 29 RSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSGGNGMS-----SANLST 83

Query: 59 MG--NVTATPTGIK 70
          M   N  AT TGIK
Sbjct: 84 MNGKNNQATFTGIK 97

>AGL206C [4106] [Homologous to NOHBY] (311846..314053) [2208 bp,
          735 aa]
          Length = 735

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 6/47 (12%)

Query: 5  KPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLIC------GGYD 45
          K   ++  GC TCR+R+ KCD  RP C  C++  L+C      G YD
Sbjct: 41 KTEKRSRNGCLTCRARRKKCDETRPKCIGCQRNLLLCHWADDDGNYD 87

>KLLA0F20680g 1924148..1926511 weakly similar to sp|P39001
           Saccharomyces cerevisiae YDR207c UME6 negative
           transcriptional regulator singleton, hypothetical start
          Length = 787

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 23/39 (58%), Gaps = 1/39 (2%)

Query: 8   VKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDV 46
            ++ TGCW CR RK KC   +P C+ C +  L C  YD+
Sbjct: 713 ARSRTGCWICRLRKKKCTEEKPQCQNCVRLHLEC-FYDI 750

>YLR256W (HAP1) [3650] chr12 (646417..650925) Transcription factor
           with heme-dependent DNA-binding activity, responsible
           for heme-dependent activation of many genes [4509 bp,
           1502 aa]
          Length = 1502

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%)

Query: 2   KPAKPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRWTR 52
           K  + R +    C  CR RKVKCD  RP C++C K G+    + ++  W  
Sbjct: 52  KIKRKRNRIPLSCTICRKRKVKCDKLRPHCQQCTKTGVAHLCHYMEQTWAE 102

>Kwal_26.7095
          Length = 838

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 21/37 (56%)

Query: 5  KPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
          K R++    C  C+ RK+KCD  RP C RC K  L C
Sbjct: 21 KSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELEC 57

>Scas_596.4
          Length = 701

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%)

Query: 9   KTFTGCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
           ++ +GCW CR RK KC   +P C  C++  L C
Sbjct: 563 RSRSGCWICRLRKKKCTEEKPACFNCQRLNLDC 595

>YDR213W (UPC2) [1051] chr4 (889744..892485) Sterol regulatory
          element binding protein involved in the regulation of
          sterol biosynthetic gene expression and the uptake and
          intracellular esterification of sterols [2742 bp, 913
          aa]
          Length = 913

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 23/44 (52%)

Query: 9  KTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRWTR 52
          K+  GC  C+ R+VKCD  +P C +C    L C    + LR  R
Sbjct: 46 KSKNGCDNCKRRRVKCDEGKPACRKCTNMKLECQYTPIHLRKGR 89

>Sklu_2434.10 YAL051W, Contig c2434 22765-25716
          Length = 983

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 24/40 (60%), Gaps = 2/40 (5%)

Query: 14 CWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRWTRP 53
          C  CR  K KCD  +P C RC K G+ C  YD++ + T+P
Sbjct: 28 CKACRKSKTKCDREKPSCTRCIKNGIEC-VYDIE-QQTQP 65

>Scas_573.4
          Length = 1478

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%)

Query: 2  KPAKPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRWTR 52
          K  + R +    C  CR RKVKCD  RP C++C K G+    + ++  W  
Sbjct: 31 KVKRKRNRVPLSCTICRKRKVKCDKIRPHCQQCTKTGVAHLCHYMEQSWAE 81

>Kwal_56.24566
          Length = 755

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 39/89 (43%), Gaps = 11/89 (12%)

Query: 1   MKPAKPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLIC-------GGYDVKLRWTRP 53
           ++P + R +   GC+TCR R+ KCD  RP C  C K  L C       G    ++R    
Sbjct: 21  LRPKRNRSRA--GCFTCRLRRKKCDEARPKCGTCSKHMLKCIWPRKGQGRLTKEMREKMK 78

Query: 54  IQFDTMGNVT--ATPTGIKDPDEPQYQRR 80
            + D        A   G ++PD PQ   R
Sbjct: 79  REVDLYDESCNFALDGGSQEPDTPQTPYR 107

>KLLA0A04169g complement(376273..378600) similar to sgd|S0004218
           Saccharomyces cerevisiae YLR228c ECM22, start by
           similarity
          Length = 775

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 32/77 (41%), Gaps = 18/77 (23%)

Query: 9   KTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRWTRPIQFDTMGNVTAT--- 65
           K+  GC  C+ R+VKCD  RP C  C+K  L C           P+Q  +  N  AT   
Sbjct: 52  KSKNGCDHCKRRRVKCDETRPHCLNCKKMSLDC--------VYTPVQPRSRKNSAATAPK 103

Query: 66  -------PTGIKDPDEP 75
                  P  +  P EP
Sbjct: 104 HSSKVSKPATVSTPTEP 120

>ADR405C [2145] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C
          (PIP2) - SH] (1435705..1438128) [2424 bp, 807 aa]
          Length = 807

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 25/40 (62%), Gaps = 2/40 (5%)

Query: 14 CWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRWTRP 53
          C +CR  K KCD  +P C RC K G +C  YDV+ + T+P
Sbjct: 39 CQSCRRSKTKCDKVKPSCTRCVKNGSVC-VYDVETQ-TKP 76

>Sklu_1373.2 YDR207C, Contig c1373 1069-2895
          Length = 608

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 22/38 (57%), Gaps = 1/38 (2%)

Query: 9   KTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDV 46
           ++ TGCW CR RK KC   +P C  C +  L C  YD+
Sbjct: 536 RSRTGCWICRLRKKKCTEEKPHCNNCTRLNLEC-FYDI 572

>Scas_556.6
          Length = 1022

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 18/33 (54%), Gaps = 1/33 (3%)

Query: 14 CWTCRSRKVKCDLRRPGCERCEKGGLICGGYDV 46
          C  CR  K KCD  +P C RC K  L C  YDV
Sbjct: 46 CQECRKAKTKCDKEKPACTRCVKQNLAC-VYDV 77

>Kwal_23.3178
          Length = 611

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 22/43 (51%), Gaps = 6/43 (13%)

Query: 5   KPRVK------TFTGCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
           KPR K      + TGCW CR RK KC   +P C  C +  L C
Sbjct: 530 KPRRKNNSGSRSRTGCWICRLRKKKCTEEKPSCHNCLRLNLQC 572

>KLLA0C16489g 1444456..1446642 some similarities with
          ca|CA2184|IPF6874.3 Candida albicans unknown function,
          3-prime end, hypothetical start
          Length = 728

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 22/30 (73%)

Query: 12 TGCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
          +GC+TCR +++KCD + P C RC++  L C
Sbjct: 41 SGCFTCRLKRMKCDEQHPICGRCKRNLLTC 70

>Kwal_26.6805
          Length = 944

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 23/40 (57%), Gaps = 2/40 (5%)

Query: 14 CWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRWTRP 53
          C +CR  K KCD  +P C RC K G+ C  YDV  R T P
Sbjct: 29 CQSCRKGKTKCDRAKPSCSRCLKHGIRC-VYDVD-RQTPP 66

>KLLA0D01452g 124018..128355 gi|3228691|gb|AAC23607.1 Kluyveromyces
           lactis Cat8p, start by similarity
          Length = 1445

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 23/48 (47%)

Query: 6   PRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRWTRP 53
           P  +    C  CR++K++CD +RP C +C   G  C   D   R   P
Sbjct: 175 PSYRVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFP 222

>KLLA0C17050g 1490472..1493339 some similarities with
          ca|CA3454|IPF10533.exon1 Candida albicans unknown
          function, exon 1, hypothetical start
          Length = 955

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 18/35 (51%)

Query: 7  RVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
          R +    C  C  RK+KCD  +P CE C K G  C
Sbjct: 39 RQRQILSCVACHKRKIKCDRAKPVCESCGKNGWEC 73

>Scas_521.2
          Length = 890

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 22/37 (59%)

Query: 9  KTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYD 45
          K+ + C  CRS+K+KCD + P C+RC    + C   D
Sbjct: 36 KSKSACKRCRSKKIKCDQKFPSCDRCAHLKVPCVSVD 72

>KLLA0F09559g complement(876719..878695) some similarities with
           sgd|S0005698 Saccharomyces cerevisiae YOR172w,
           hypothetical start
          Length = 658

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 20/36 (55%)

Query: 4   AKPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGL 39
            + R K    C  CR RK+KCD +RP C  C+  GL
Sbjct: 80  VRKRRKVIKSCTFCRKRKLKCDRKRPMCTGCKMRGL 115

>KLLA0A06039g 557368..559341 weakly similar to sp|P36023
          Saccharomyces cerevisiae YKR064w singleton, start by
          similarity
          Length = 657

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 19/39 (48%)

Query: 3  PAKPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
          P K R +    C  CR RK KCD  +P C  C K G  C
Sbjct: 10 PVKKRHRPTLVCLNCRRRKTKCDRGKPSCSNCLKLGETC 48

>KLLA0F22990g 2134385..2138146 similar to sp|P12351 Saccharomyces
          cerevisiae YLR256w HAP1 transcription factor singleton,
          hypothetical start
          Length = 1253

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 18/27 (66%)

Query: 13 GCWTCRSRKVKCDLRRPGCERCEKGGL 39
           C  CR RKVKCD  RP C++C K G+
Sbjct: 24 SCTICRKRKVKCDKGRPQCQQCVKTGV 50

>CAGL0J07150g complement(686734..689802) similar to sp|P39720
          Saccharomyces cerevisiae YAL051w OAF1 peroxisome
          proliferating transcription factor or sp|P52960
          Saccharomyces cerevisiae YOR363c PIP2, hypothetical
          start
          Length = 1022

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 23/43 (53%), Gaps = 1/43 (2%)

Query: 4  AKPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDV 46
          +K R +    C  CR  K KCD  +P C RC K G+ C  YD+
Sbjct: 13 SKKRNRLSFVCQGCRKAKTKCDKEKPACSRCLKHGIRC-VYDL 54

>CAGL0L04400g complement(511762..514725) similar to tr|Q12340
          Saccharomyces cerevisiae YOR172w, hypothetical start
          Length = 987

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 22/41 (53%), Gaps = 1/41 (2%)

Query: 2  KPAKPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGL-IC 41
          K  K R K    C  CR RK+KCD ++P C  C +  L +C
Sbjct: 25 KRPKKRFKPLKSCAFCRKRKLKCDKQKPRCSSCARRNLPVC 65

>YLR228C (ECM22) [3628] chr12 complement(600021..602465) Sterol
          regulatory element binding protein involved in the
          regulation of sterol biosynthetic gene expression and
          may be involved in regulating sterol uptake [2445 bp,
          814 aa]
          Length = 814

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 21/33 (63%)

Query: 9  KTFTGCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
          K+ TGC  C+ R+VKCD  +P C++C    L C
Sbjct: 39 KSKTGCDNCKRRRVKCDEGKPFCKKCTNMKLDC 71

>KLLA0A03421g 308414..311056 weakly similar to sp|P39720
          Saccharomyces cerevisiae YAL051w OAF1 peroxisome
          proliferating transcription factor, start by similarity
          Length = 880

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 4  AKPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVK 47
          AK R K    C  CR  K KCD ++P C RC++    C  YD++
Sbjct: 11 AKKRYKLSFVCQLCRKSKTKCDRKKPSCARCQRLNKPC-IYDLE 53

>CAGL0K05841g 572315..576433 similar to sp|P12351 Saccharomyces
          cerevisiae YLR256w HAP1 transcription factor,
          hypothetical start
          Length = 1372

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 19/33 (57%)

Query: 7  RVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGL 39
          R +    C  CR RKVKCD  RP C +C K G+
Sbjct: 64 RNRVPLSCTICRRRKVKCDKSRPNCTQCVKTGV 96

>YOR363C (PIP2) [5140] chr15 complement(1020218..1023208)
          Transcription factor required for induction of
          peroxisomal proteins in response to oleic acid [2991
          bp, 996 aa]
          Length = 996

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 18/33 (54%), Gaps = 1/33 (3%)

Query: 14 CWTCRSRKVKCDLRRPGCERCEKGGLICGGYDV 46
          C  CR  K KCD  +P C RC K  L C  YDV
Sbjct: 25 CQACRKAKTKCDQEKPRCGRCTKQNLFC-IYDV 56

>Kwal_23.6529
          Length = 598

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%)

Query: 13 GCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRW 50
          GC  C+  K+KCD ++P C +C K G     Y + L+W
Sbjct: 13 GCINCKKSKIKCDEKKPMCGQCAKKGRDDCAYALVLQW 50

>YCR106W (RDS1) [627] chr3 (310954..313452) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region, involved in resistance to cycloheximide [2499
          bp, 832 aa]
          Length = 832

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 2/37 (5%)

Query: 5  KPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
          KPR++    C  C+  K KCD  RP C RC++  L C
Sbjct: 8  KPRLRLV--CLQCKKIKRKCDKLRPACSRCQQNSLQC 42

>KLLA0F02387g complement(213669..215852) similar to sp|P47988
          Saccharomyces cerevisiae YOR337w TEA1 TY1 enhancer
          activator, start by similarity
          Length = 727

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 22/40 (55%), Gaps = 1/40 (2%)

Query: 13 GCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRWTR 52
           C  CR R+ KCDL  P C RC++ GL C    V LR  R
Sbjct: 40 ACANCRRRRKKCDLEYP-CGRCQELGLGCNINKVDLRKKR 78

>YDR421W (ARO80) [1245] chr4 (1312028..1314880) Positive
          transcription regulator of ARO9 and ARO10, member of
          the Zn2Cys6 transcription factor family [2853 bp, 950
          aa]
          Length = 950

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 23/41 (56%), Gaps = 6/41 (14%)

Query: 7  RVKTFTGCWTCRSRKVKCDL------RRPGCERCEKGGLIC 41
          R +T+  C +CRSRKVKCDL        P C RC++    C
Sbjct: 18 RRRTYQACISCRSRKVKCDLGPVDNPHDPPCARCKRELKKC 58

>CAGL0F07865g complement(768270..770804) similar to tr|Q12151
          Saccharomyces cerevisiae YDR213w UPC2, start by
          similarity
          Length = 844

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 21/33 (63%)

Query: 9  KTFTGCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
          K+  GC  C+ R+VKCD  +P C++C K  L C
Sbjct: 49 KSKNGCDHCKRRRVKCDEGKPMCDKCVKMKLEC 81

>YLR014C (PPR1) [3432] chr12 complement(172267..174981)
          Transcription factor regulating pyrimidine pathway,
          contains a Zn[2]-Cys[6] fungal-type binuclear cluster
          domain in the N-terminal region [2715 bp, 904 aa]
          Length = 904

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 21/37 (56%)

Query: 9  KTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYD 45
          K+ T C  CR +K+KCD   P C+RC K  + C   D
Sbjct: 29 KSRTACKRCRLKKIKCDQEFPSCKRCAKLEVPCVSLD 65

>Scas_550.5*
          Length = 832

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 19/28 (67%)

Query: 14 CWTCRSRKVKCDLRRPGCERCEKGGLIC 41
          C  CR++K++C+  RP C RC++ G  C
Sbjct: 15 CAACRTQKLRCNRERPSCSRCQRIGRTC 42

>AGR061C [4371] [Homologous to ScYLR098C (CHA4) - SH]
          (831058..832896) [1839 bp, 612 aa]
          Length = 612

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 23/40 (57%), Gaps = 1/40 (2%)

Query: 13 GCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRWTR 52
           C TCR R+ KCDL+ P C  C+K G+ C   D  LR  R
Sbjct: 13 ACQTCRKRRRKCDLQVP-CVNCQKFGVECLPVDQDLRKKR 51

>AFR117C [3309] [Homologous to ScYLR256W (HAP1) - SH]
          (646832..650290) [3459 bp, 1152 aa]
          Length = 1152

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 20/35 (57%)

Query: 5  KPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGL 39
          + R +    C  CR RKVKCD  RP C +C K G+
Sbjct: 10 RKRNRVPLSCTICRKRKVKCDKTRPHCNQCTKTGV 44

>ACL058W [991] [Homologous to NOHBY] complement(261723..264176)
          [2454 bp, 817 aa]
          Length = 817

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 23/46 (50%), Gaps = 1/46 (2%)

Query: 7  RVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRWTR 52
          R +    C  C  RKVKC+  RP C+ CEK    C  Y V  R +R
Sbjct: 31 RQRRVLNCMPCHKRKVKCNRARPVCDHCEKNRYAC-AYFVNDRVSR 75

>Scas_696.44
          Length = 1164

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 21/41 (51%)

Query: 13  GCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRWTRP 53
            C  CRS+K +CD +RP C +C   G  C   D   R + P
Sbjct: 80  ACDRCRSKKTRCDGKRPQCSQCAIVGFECKISDKLQRKSFP 120

>Scas_711.31
          Length = 932

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 19/34 (55%)

Query: 8  VKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
          +K    C  CR +K+KCD R P C  C K G+ C
Sbjct: 39 IKRKQACDRCRLKKIKCDDRTPDCTPCMKAGIPC 72

>CAGL0E05434g 532577..535027 similar to sp|P47988 Saccharomyces
           cerevisiae YOR337w TEA1 TY1 enhancer activator,
           hypothetical start
          Length = 816

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 27/51 (52%), Gaps = 5/51 (9%)

Query: 2   KPAKPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRWTR 52
           +P K R+     C  CR R+ KCDL+ P C  C+K GL C   +  LR  R
Sbjct: 68  RPTKKRL----ACSNCRRRRKKCDLQYP-CFTCDKLGLECNINEEDLRKKR 113

>YOR172W (YRM1) [4969] chr15 (654210..656570) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region [2361 bp, 786 aa]
          Length = 786

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%)

Query: 1  MKPAKPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGG 38
          +K A+ R K    C  CR RK++CD ++P C  C+  G
Sbjct: 18 VKKAQKRRKPIKSCAFCRKRKLRCDQQKPMCSTCKTRG 55

>ADR403C [2143] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C
          (PIP2) - SH] (1429118..1432030) [2913 bp, 970 aa]
          Length = 970

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 14 CWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVK 47
          C  CR  K KCD  +P C RC K  + C  YD++
Sbjct: 32 CQACRKSKTKCDREKPRCSRCAKNNVKC-VYDIE 64

>YLL054C (YLL054C) [3369] chr12 complement(32894..35203) Protein
          with similarity to transcription factors, has
          Zn[2]-Cys[6] fungal-type binuclear cluster domain in
          the N-terminal region [2310 bp, 769 aa]
          Length = 769

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 4  AKPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVK 47
          ++ +VK    C  C+ RK+KCD   P C +C+    IC  Y+V+
Sbjct: 5  SQKKVKPSFVCLRCKQRKIKCDKLWPTCSKCKASSSIC-SYEVE 47

>Kwal_23.6425
          Length = 735

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 20/36 (55%)

Query: 4  AKPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGL 39
          ++ R K+   C  CR RK+KCD  RP C  C   GL
Sbjct: 26 SRKRRKSIKQCLFCRKRKLKCDKNRPVCGTCASRGL 61

>Scas_721.94
          Length = 869

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 19/33 (57%)

Query: 9  KTFTGCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
          K+  GC  C+ R+VKCD  +P C RC    + C
Sbjct: 50 KSKQGCTHCKRRRVKCDELKPACRRCLNWNVPC 82

>Scas_679.26
          Length = 775

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%)

Query: 9  KTFTGCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
          K+  GC  C+ R+VKCD  +P C++C    L C
Sbjct: 53 KSKNGCDNCKRRRVKCDELKPTCQKCINMNLEC 85

>Kwal_23.3122
          Length = 788

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%)

Query: 9  KTFTGCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
          K+  GC  C+ R+VKCD  +P C++C    L C
Sbjct: 45 KSKNGCDNCKRRRVKCDEDKPSCQKCLNMKLEC 77

>AFR096W [3288] [Homologous to ScYJL089W (SIP4) - SH]
          complement(606993..609551) [2559 bp, 852 aa]
          Length = 852

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 24/51 (47%)

Query: 9  KTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRWTRPIQFDTM 59
          ++   C  CR +K+KCD  RP C  C+K G  C   D   R   P  +  M
Sbjct: 24 RSSQACDRCRLKKIKCDGLRPSCTSCKKIGYQCKTSDKLTRRGFPRGYTEM 74

>KLLA0D10153g 858016..859983 weakly similar to sp|P35995
          Saccharomyces cerevisiae YKL222c, hypothetical start
          Length = 655

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 23/45 (51%), Gaps = 1/45 (2%)

Query: 5  KPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLR 49
          K R K    C  C+ RK KCD + P C  C K G  C  Y+V L+
Sbjct: 3  KSRNKPTRSCLMCQRRKKKCDRKAPSCSACLKKGYEC-IYNVNLQ 46

>AGL233C [4079] [Homologous to ScYKL222C - NSH; ScYOR172W - NSH]
          (260414..263032) [2619 bp, 872 aa]
          Length = 872

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 19/38 (50%)

Query: 2  KPAKPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGL 39
          K  K R K    C  CR R+VKC+  RP C  C   GL
Sbjct: 7  KIVKTRRKVSKSCVFCRKRRVKCNKARPKCSTCIGKGL 44

>YLR278C (YLR278C) [3671] chr12 complement(700001..704026) Protein
          with similarity to transcription factors, contains an
          N-terminal Zn[2]-Cys[6] fungal-type binuclear cluster
          domain [4026 bp, 1341 aa]
          Length = 1341

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 16/29 (55%)

Query: 13 GCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
           C  CR RK +CD + P C  C K G+ C
Sbjct: 40 SCLLCRRRKQRCDHKLPSCTACLKAGIKC 68

>Kwal_55.20674
          Length = 252

 Score = 38.1 bits (87), Expect = 0.018,   Method: Composition-based stats.
 Identities = 15/40 (37%), Positives = 20/40 (50%)

Query: 2  KPAKPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
          K  K R      C +CR RK KC   +P C+RC +  + C
Sbjct: 9  KMGKDRSGAMFTCKSCRQRKRKCSREKPQCQRCARLSIPC 48

>Scas_590.2
          Length = 1172

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 16/30 (53%)

Query: 12 TGCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
          T C  CR RK KCD + P C  C K  + C
Sbjct: 39 TACLLCRRRKQKCDHQLPSCTACLKAAVKC 68

>Kwal_23.2905
          Length = 881

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 18/37 (48%)

Query: 9  KTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYD 45
          ++   C  CR RKVKCD + P C RC      C   D
Sbjct: 44 RSIAACKRCRIRKVKCDQKFPSCSRCVSANEPCVSID 80

>YAL051W (OAF1) [17] chr1 (48565..51753) Transcription factor
          required for induction of SPS19 and POX1 on
          oleate-containing medium, plays a role in peroxisome
          proliferation [3189 bp, 1062 aa]
          Length = 1062

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 21/42 (50%), Gaps = 1/42 (2%)

Query: 5  KPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDV 46
          + R +    C  C   K KCD  +P C RC K GL C  YDV
Sbjct: 57 RKRNRILFVCQACWKSKTKCDREKPECGRCVKHGLKC-VYDV 97

>Kwal_27.10232
          Length = 1209

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 20/41 (48%)

Query: 13  GCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRWTRP 53
            C  CRS+K +CD +RP C +C   G  C   D   R   P
Sbjct: 73  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFP 113

>KLLA0D05038g 433653..435674 weakly similar to sp|P40971
          Saccharomyces cerevisiae YDR034c LYS14 transcriptional
          activator of lysine pathway genes singleton, start by
          similarity
          Length = 673

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 36/81 (44%), Gaps = 7/81 (8%)

Query: 2  KPAKPRVK-TFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRWTRPIQFDTMG 60
          +PAK + K +  GC  C+ +KVKCD  +P C +C    L C      +  T+  QF   G
Sbjct: 15 EPAKKKRKYSKNGCLECKRKKVKCDETKPMCWQCTHLSLEC------VYKTKEFQFVVSG 68

Query: 61 NVTATPTGIKDPDEPQYQRRN 81
              +    K       +R+N
Sbjct: 69 GPNKSRVNSKVTSVSDKKRKN 89

>ABL121C [471] [Homologous to ScYMR280C (CAT8) - SH]
           (170784..174641) [3858 bp, 1285 aa]
          Length = 1285

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 17/29 (58%)

Query: 13  GCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
            C  CRS+K +CD +RP C +C   G  C
Sbjct: 77  ACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105

>KLLA0F00572g complement(42710..44503) some similarities with
          ca|CA2184|IPF6874.3 Candida albicans unknown function,
          3-prime end, hypothetical start
          Length = 597

 Score = 38.5 bits (88), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 20/33 (60%)

Query: 9  KTFTGCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
          ++ TGC  CR RK KCD  +P C  C++  L C
Sbjct: 6  RSSTGCLICRRRKKKCDEVKPTCTACKRNFLEC 38

>Sklu_2191.2 YKL222C, Contig c2191 6517-8673 reverse complement
          Length = 718

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 18/35 (51%)

Query: 5  KPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGL 39
          + R K    C  CR RK+KCD ++P C  C    L
Sbjct: 10 RKRRKVIKSCLFCRKRKLKCDHKKPKCSTCAARNL 44

>Kwal_14.2619
          Length = 1167

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 21/37 (56%), Gaps = 1/37 (2%)

Query: 12 TGCWTCRSRKVKCDLRRPGCERCEKGGLICG-GYDVK 47
          T C TCR RKVKCD  +P C  C K   I    Y+VK
Sbjct: 10 TSCLTCRRRKVKCDRSKPVCLACIKYKSISECSYEVK 46

>AGL361C [3951] [Homologous to NOHBY] (24101..26191) [2091 bp, 696
          aa]
          Length = 696

 Score = 38.5 bits (88), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query: 1  MKPAKPRVK-TFTGCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
          +K  KP+V+ +  GC  C+   +KCD  +P C  C K  ++C
Sbjct: 47 LKSKKPKVQYSRKGCSQCKKSHIKCDKVQPLCTTCAKKNILC 88

>KLLA0D12650g complement(1073580..1075535) weakly similar to
          ca|CA2184|IPF6874.3 Candida albicans unknown function,
          3-prime end, hypothetical start
          Length = 651

 Score = 38.1 bits (87), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 19/33 (57%)

Query: 13 GCWTCRSRKVKCDLRRPGCERCEKGGLICGGYD 45
          GC TCR R  KCD ++P C  C++  L C   D
Sbjct: 31 GCLTCRDRHKKCDEKKPLCSGCKENFLRCVWRD 63

>KLLA0D11286g complement(964642..966678) no similarity,
          hypothetical start
          Length = 678

 Score = 38.1 bits (87), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 24/49 (48%)

Query: 7  RVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRWTRPIQ 55
          R +T   C  C S K KCD ++P C RC K  L C  +  +    R +Q
Sbjct: 19 RKRTPKSCIRCYSIKRKCDHKKPSCTRCFKKSLPCEYFTEEHVLERCLQ 67

>KLLA0A03443g 311628..314555 weakly similar to sp|P39720
          Saccharomyces cerevisiae YAL051w OAF1 peroxisome
          proliferating transcription factor, start by similarity
          Length = 975

 Score = 38.1 bits (87), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 14 CWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVK 47
          C  CR  K KCD  +P C RC K  L C  YDV+
Sbjct: 35 CQACRKNKTKCDREKPRCGRCVKYHLKC-VYDVE 67

>Kwal_34.15751
          Length = 628

 Score = 38.1 bits (87), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 18/28 (64%)

Query: 14 CWTCRSRKVKCDLRRPGCERCEKGGLIC 41
          C  CR RK+KC+ ++P C RC K  L C
Sbjct: 15 CDACRIRKLKCNKQKPSCSRCVKHDLQC 42

>Sklu_2296.6 YJL089W, Contig c2296 12179-14938 reverse complement
          Length = 919

 Score = 38.1 bits (87), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 24/51 (47%)

Query: 9  KTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRWTRPIQFDTM 59
          ++   C  CR +K+KCD  +P C  C+K G  C   D   R   P  +  M
Sbjct: 24 RSSQACDRCRLKKIKCDGLKPNCTSCKKVGFHCQTSDKLTRRGFPRGYTEM 74

>Kwal_47.17681
          Length = 854

 Score = 38.1 bits (87), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 21/45 (46%), Positives = 25/45 (55%), Gaps = 5/45 (11%)

Query: 5  KPRVKTFTGCWTCRSRKVKCD--LRRPGCERCEKGGLICGGYDVK 47
          KPR  T   C  C  RKV+CD  +R P C  C+  GL+C   DVK
Sbjct: 12 KPR--TNRACEVCHDRKVRCDANIRVP-CTSCQTFGLVCRLRDVK 53

>CAGL0M12298g complement(1225753..1228737) similar to sp|P39720
          Saccharomyces cerevisiae YAL051w OAF1 peroxisome
          proliferating transcription factor or sp|P52960
          Saccharomyces cerevisiae YOR363c PIP2, hypothetical
          start
          Length = 994

 Score = 37.7 bits (86), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 16/28 (57%)

Query: 14 CWTCRSRKVKCDLRRPGCERCEKGGLIC 41
          C  CR  K +CD  +P C RC+K  L C
Sbjct: 27 CQACRRSKTRCDKEKPICTRCKKLKLEC 54

>CAGL0A00451g 47557..50880 similar to sp|P12383 Saccharomyces
          cerevisiae YGL013c PDR1 transcription factor,
          hypothetical start
          Length = 1107

 Score = 37.7 bits (86), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 5/67 (7%)

Query: 2  KPAKPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRWTRPIQFDTMGN 61
          KP+  R K    C +CR RK+KC+  +P C  C   G  C   D K   T+ ++ +  G 
Sbjct: 19 KPSTRRTKVGKACDSCRRRKIKCNGLKP-CPSCTIYGCECTYTDAK--STKNLKSNDAGK 75

Query: 62 VTATPTG 68
            + PTG
Sbjct: 76 --SKPTG 80

>KLLA0F22880g 2123577..2127071 some similarities with
          ca|CA3639|IPF9251 Candida albicans unknown function,
          hypothetical start
          Length = 1164

 Score = 37.7 bits (86), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 3/52 (5%)

Query: 9  KTFTGCWTCRSRKVKCDLRRPGCERCEKGG--LICGGYDVKLRWTRPIQFDT 58
          K    C  CR RKV+CD  +P C  C K G  + C  Y+V+ R  + +   T
Sbjct: 4  KNGKSCLVCRRRKVRCDRAKPVCLVCVKHGSNMEC-NYEVQKREVKFVSMKT 54

>Sklu_2321.3 YLR014C, Contig c2321 8747-11467
          Length = 906

 Score = 37.4 bits (85), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 18/37 (48%)

Query: 9  KTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYD 45
          ++   C  CR +KVKCD + P C +C      C   D
Sbjct: 38 RSIAACKRCRLKKVKCDQKFPSCSKCASANEPCVSLD 74

>Kwal_56.24670
          Length = 643

 Score = 37.4 bits (85), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 19/41 (46%)

Query: 1  MKPAKPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
          M     R    TGC  C+ RK +C   +P C  CE+ G  C
Sbjct: 14 MNTVGKRTHRKTGCIPCKIRKKRCSEHKPTCTDCERLGFTC 54

>KLLA0C04620g complement(422705..426514) weakly similar to
          sp|Q05854 Saccharomyces cerevisiae YLR278c, start by
          similarity
          Length = 1269

 Score = 37.4 bits (85), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 19/38 (50%), Gaps = 5/38 (13%)

Query: 13 GCWTCRSRKVKCDLRRPGCERCEKGGLIC-----GGYD 45
           C  C+ RK KCD + P C  C K G+ C      GYD
Sbjct: 40 ACLLCQRRKQKCDHKIPSCTACLKAGVKCIQPAKYGYD 77

>Scas_709.42
          Length = 374

 Score = 37.0 bits (84), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 49/112 (43%), Gaps = 2/112 (1%)

Query: 452 KNSPEMKFFLTLGIEFRTQASSFLKRCLSNTVNQERYKDILTAILSMNSIDVVWGTMADC 511
           ++S E +  LT  I+      + +   L+   N E   DI T  L   SID   GTM  C
Sbjct: 25  QDSEEYQTLLTSTIQDLLSLKTIVYGKLALFSNNETLDDISTNSLKFLSIDYYLGTM--C 82

Query: 512 QVHLAICEDFVENRMKTRPKISAKAKALHRIFSFLKLIQDSTSLDKVRTKEI 563
               A  +   +   K R K+    K++  I  FL ++QD   LD +  ++I
Sbjct: 83  SKKQATAKQVGDPSSKNRMKVKFLEKSVQIIMQFLTMLQDYEILDTMLARKI 134

>YBL066C (SEF1) [131] chr2 complement(96906..100079) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region [3174 bp, 1057 aa]
          Length = 1057

 Score = 37.4 bits (85), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 3/36 (8%)

Query: 9  KTFTGCWTCRSRKVKCDLRR---PGCERCEKGGLIC 41
          +  T C  CR  K+KCD  +     C RCEK GL C
Sbjct: 52 RPVTSCTHCRQHKIKCDASQNFPHPCSRCEKIGLHC 87

>Scas_657.3
          Length = 856

 Score = 37.4 bits (85), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 13/23 (56%), Positives = 15/23 (65%)

Query: 12 TGCWTCRSRKVKCDLRRPGCERC 34
          T C  CR RK+KCD +RP C  C
Sbjct: 43 TSCAFCRQRKLKCDQKRPICSTC 65

>KLLA0D00396g complement(36277..37362) some similarities with
          ca|CA2346|CaSEF1 Candida albicans Putative
          transcription factor1, hypothetical start
          Length = 361

 Score = 36.6 bits (83), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 20/37 (54%), Gaps = 3/37 (8%)

Query: 8  VKTFTGCWTCRSRKVKCDLR--RPG-CERCEKGGLIC 41
          +K    C  CR  KVKCD    RPG C  C K GL+C
Sbjct: 2  LKPLRSCTRCRKNKVKCDSANTRPGPCTACSKRGLVC 38

>KLLA0F19602g complement(1814949..1816760) similar to sp|P43634
          Saccharomyces cerevisiae YLR098c CHA4 transcription
          factor, start by similarity
          Length = 603

 Score = 36.6 bits (83), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 20/38 (52%), Gaps = 1/38 (2%)

Query: 4  AKPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
           K + K    C  CR ++ KCD+ RP C  C K G+ C
Sbjct: 7  GKRKRKAHLACQNCRIKRRKCDMERP-CSNCLKYGIEC 43

>KLLA0C10923g complement(939148..941475) similar to sp|P07272
          Saccharomyces cerevisiae YLR014c PPR1 transcription
          factor regulating pyrimidine pathway, hypothetical
          start
          Length = 775

 Score = 36.6 bits (83), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 21/45 (46%)

Query: 9  KTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRWTRP 53
          ++   C  CR RK+KCD + P C +C +    C   D   R   P
Sbjct: 15 RSVAACKRCRIRKIKCDNKFPSCTKCIQAQEPCITIDPSTRREIP 59

>YOR337W (TEA1) [5116] chr15 (954339..956618) Ty1 enhancer activator
           of the Gal4p-type family of DNA-binding proteins [2280
           bp, 759 aa]
          Length = 759

 Score = 36.6 bits (83), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 1/40 (2%)

Query: 13  GCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRWTR 52
            C  CR+R+ KCDL  P C  C +  L+C   D  LR  R
Sbjct: 69  ACTNCRNRRKKCDLGFP-CGNCSRLELVCNVNDEDLRKKR 107

>Scas_720.58
          Length = 890

 Score = 36.6 bits (83), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 16/29 (55%)

Query: 13 GCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
           C  CR +K+KC    P C +C K G+ C
Sbjct: 19 ACDNCRLKKLKCSKETPKCSKCLKNGMKC 47

>Scas_625.5
          Length = 1141

 Score = 36.6 bits (83), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 36/84 (42%), Gaps = 3/84 (3%)

Query: 5   KPRVKTFTGCWTCRSRKVKCDL--RRPGCERCEKGGLICGGYDVKLRWTRPIQFDTMGNV 62
           K R K    C  CR +K+KCD    +  C  C++ G  C    V L+   P +  T  + 
Sbjct: 66  KKRTKASRACDQCRKKKIKCDFSEEKTLCSNCQRNGEKCTFERVPLKRG-PSKGYTRNHS 124

Query: 63  TATPTGIKDPDEPQYQRRNVDFVR 86
            +TP    + D    + +N +  R
Sbjct: 125 KSTPQTTHETDINHNKSQNYETER 148

>KLLA0E19701g complement(1739869..1741914) some similarities with
          sp|P26370 Saccharomyces cerevisiae YDL170w UGA3
          transcriptional activator for GABA catabolic genes
          singleton, hypothetical start
          Length = 681

 Score = 36.6 bits (83), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 20/37 (54%)

Query: 5  KPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
          K R  +  GC TC+ RK +C   RP C+ C +  L C
Sbjct: 11 KRRRHSKKGCLTCKVRKKRCSEDRPICKDCARLSLDC 47

>AFR171W [3363] [Homologous to NOHBY] complement(752592..754430)
          [1839 bp, 612 aa]
          Length = 612

 Score = 36.6 bits (83), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 17/29 (58%)

Query: 13 GCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
          GC  C+ RKVKCD  +P C +C   G  C
Sbjct: 21 GCSECKRRKVKCDETKPACWQCSHLGKRC 49

>YJL089W (SIP4) [2826] chr10 (265842..268331) Transcriptional
          activator of gluconeogenic genes through CSRE elements,
          activated by Snf1p kinase, contains a Zn[2]-Cys[6]
          fungal-type binuclear cluster domain [2490 bp, 829 aa]
          Length = 829

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 18/38 (47%)

Query: 8  VKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYD 45
          V+    C  CR +K+KCD  +P C  C K    C   D
Sbjct: 40 VRKAHACDRCRLKKIKCDGLKPNCSNCAKIDFPCKTSD 77

>ADR199C [1940] [Homologous to ScYDR421W (ARO80) - SH]
          (1048530..1051364) [2835 bp, 944 aa]
          Length = 944

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 20/39 (51%), Gaps = 6/39 (15%)

Query: 9  KTFTGCWTCRSRKVKCDL------RRPGCERCEKGGLIC 41
          + +  C  CR+RKV+CDL      R P C RC +    C
Sbjct: 27 RIYKACLNCRTRKVRCDLGPVDKPREPPCVRCSRERKEC 65

>YLR266C (PDR8) [3660] chr12 complement(675621..677726)
          Zn[2]-Cys[6] zinc finger transcription factor, likely
          involved in pleiotropic drug response [2106 bp, 701 aa]
          Length = 701

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 16/28 (57%)

Query: 7  RVKTFTGCWTCRSRKVKCDLRRPGCERC 34
          R K    C  CR RK+KC   RP C++C
Sbjct: 24 RRKVIKSCAFCRKRKLKCSQARPMCQQC 51

>KLLA0A09119g complement(797533..800781) weakly similar to
          sp|P12383 Saccharomyces cerevisiae YGL013c PDR1
          transcription factor, start by similarity
          Length = 1082

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 20/38 (52%), Gaps = 1/38 (2%)

Query: 4  AKPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
           KPR K    C +CR +K+KC    P C+ CE  G  C
Sbjct: 45 GKPRRKVSRACDSCRKKKIKCSGTLP-CKSCETYGCEC 81

>CAGL0H01507g complement(147689..150073) similar to sp|Q06639
          Saccharomyces cerevisiae YDR303c RSC3, start by
          similarity
          Length = 794

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 17/32 (53%)

Query: 7  RVKTFTGCWTCRSRKVKCDLRRPGCERCEKGG 38
          ++K    C  CR RKV CD  RP C  C + G
Sbjct: 7  KMKKPPACAQCRRRKVGCDRVRPVCGNCARAG 38

>Scas_702.7
          Length = 1113

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 29/70 (41%), Gaps = 4/70 (5%)

Query: 1  MKPAKPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRWTRPIQFDTMG 60
          +K  +PR K    C  CR RK+KC    P C  C      C   D+K   + P    T+G
Sbjct: 24 VKIKRPRKKVSKACANCRRRKIKCTGTYP-CSNCAAYQCECIFDDLKEDSSNP---STVG 79

Query: 61 NVTATPTGIK 70
            T   T  K
Sbjct: 80 GTTQKVTKTK 89

>CAGL0G09757g 930351..934622 some similarities with sp|Q05854
          Saccharomyces cerevisiae YLR278c, hypothetical start
          Length = 1423

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 15/29 (51%)

Query: 13 GCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
           C  CR RK +CD + P C  C K  + C
Sbjct: 40 SCLLCRRRKQRCDHKLPSCTACLKAAVKC 68

>YGL013C (PDR1) [1960] chr7 complement(469095..472301) Zinc-finger
          transcription factor, in conjunction with Pdr3p
          regulates the expression of a network of genes involved
          in multiple drug resistance [3207 bp, 1068 aa]
          Length = 1068

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 24/52 (46%), Gaps = 7/52 (13%)

Query: 2  KPAKPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLIC------GGYDVK 47
          K  KPR K    C  CR RK+KC+ + P C  CE     C      GG  +K
Sbjct: 34 KIRKPRSKVSKACDNCRKRKIKCNGKFP-CASCEIYSCECTFSTRQGGARIK 84

>Sklu_2301.1 , Contig c2301 1246-2795 reverse complement
          Length = 517

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 18/37 (48%)

Query: 9  KTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYD 45
          ++   C  CR++K KCD   P C RC   G  C   D
Sbjct: 35 RSIVACERCRTKKTKCDQNFPSCARCASLGEPCISVD 71

>Scas_526.3
          Length = 1109

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 25/61 (40%), Gaps = 8/61 (13%)

Query: 13 GCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRWTRP-----IQFDTMGNVTATPT 67
           C  CR RK +CD + P C  C K  + C       R++ P        D+M N   T  
Sbjct: 40 SCLLCRRRKQRCDHKMPSCTACLKAAVKCVQ---PARYSSPASISITNLDSMTNSINTNM 96

Query: 68 G 68
          G
Sbjct: 97 G 97

>YPR196W (YPR196W) [5609] chr16 (931370..932782) Positive
          regulator of the maltose pathway MAL genes, contains a
          Zn[2]-Cys[6] fungal-type binuclear cluster domain in
          the N-terminal region [1413 bp, 470 aa]
          Length = 470

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 18/29 (62%), Gaps = 1/29 (3%)

Query: 13 GCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
           C  CR R+VKCD  RP C+RC +  L C
Sbjct: 7  SCDCCRVRRVKCDRNRP-CDRCRQRNLRC 34

>YOR162C (YRR1) [4961] chr15 complement(639560..641992)
          Transcription factor involved in drug-induced
          transcriptional regulation, including activation of
          multidrug transporter gene SNQ2, has a Zn[2]-Cys[6]
          fungal-type binuclear cluster domain [2433 bp, 810 aa]
          Length = 810

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 19/41 (46%)

Query: 4  AKPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGY 44
           K R K    C  CR RK++CD ++P C  C    L    Y
Sbjct: 44 GKKRNKLIKSCGFCRRRKLRCDQQKPMCSTCISRNLTTCQY 84

>Scas_659.10
          Length = 757

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 17/30 (56%)

Query: 5  KPRVKTFTGCWTCRSRKVKCDLRRPGCERC 34
          K R K    C  CR RK+KCD  +P C +C
Sbjct: 12 KRRRKPIKSCAFCRGRKLKCDKNKPICNQC 41

>KLLA0E20405g <1805948..1809364 gi|3024604|sp|P87164|SEF1_KLULA
           Kluyveromyces lactis SUPPRESSOR PROTEIN SEF1, start by
           similarity
          Length = 1138

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 4/56 (7%)

Query: 9   KTFTGCWTCRSRKVKCDLRR--PG-CERCEKGGLICGGYDVKLRWTRPIQFDTMGN 61
           +  T C  CR  K+KC+     P  C RCE+ GL C   D + R  +  Q  ++ N
Sbjct: 132 RPVTSCTHCRQHKIKCNASEKFPAPCSRCERMGLHC-EIDPQFRPKKGSQLQSLRN 186

>Sklu_2411.11 YMR019W, Contig c2411 20506-22569 reverse complement
          Length = 687

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 1/38 (2%)

Query: 4  AKPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
          +K R++    C  C+ RK+KCD  +P C  C K  + C
Sbjct: 18 SKQRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQC 54

>YKL038W (RGT1) [3220] chr11 (365248..368760) Protein involved in
          regulation of glucose transporters, acts as a
          transcriptional repressor that is converted to an
          activator upon glucose-induced phosphorylation [3513
          bp, 1170 aa]
          Length = 1170

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 2/47 (4%)

Query: 5  KPRVKTFTGCWTCRSRKVKCDLR--RPGCERCEKGGLICGGYDVKLR 49
          K R K    C  CR +K+KCD +  +  C  C++ G  C    V L+
Sbjct: 38 KKRTKASRACDQCRKKKIKCDYKDEKGVCSNCQRNGDRCSFDRVPLK 84

>AGR369W [4680] [Homologous to ScYBL066C (SEF1) - SH]
           complement(1412347..1415502) [3156 bp, 1051 aa]
          Length = 1051

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 25/56 (44%), Gaps = 4/56 (7%)

Query: 9   KTFTGCWTCRSRKVKCDLRR---PGCERCEKGGLICGGYDVKLRWTRPIQFDTMGN 61
           +  T C  CR  K+KC+        C RCE+ GL C   D + R  +  Q   + N
Sbjct: 87  RPVTSCTHCRQHKIKCNASENFPSSCSRCERMGLQC-EIDPQFRPKKGSQLQNLKN 141

>ACR241C [1288] [Homologous to ScYKR064W - SH] (784358..786745)
          [2388 bp, 795 aa]
          Length = 795

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 19/38 (50%)

Query: 1  MKPAKPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGG 38
          M P K R +    C  C+ RK +CD  +P C  C + G
Sbjct: 1  MMPLKKRQRQTLVCSNCKRRKSRCDRGKPACGNCIRLG 38

>CAGL0D03850g 384689..387193 weakly similar to sp|Q06639
          Saccharomyces cerevisiae YDR303c RSC3 or sp|P38781
          Saccharomyces cerevisiae YHR056c, hypothetical start
          Length = 834

 Score = 35.4 bits (80), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 17/32 (53%)

Query: 7  RVKTFTGCWTCRSRKVKCDLRRPGCERCEKGG 38
          +VK    C  CR RK+ CD  +P C  C K G
Sbjct: 9  KVKKPPACQQCRRRKIGCDRGKPICGNCLKQG 40

>Scas_715.3
          Length = 1115

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 3/36 (8%)

Query: 9   KTFTGCWTCRSRKVKCDLRR--PG-CERCEKGGLIC 41
           +  T C  CR +K+KCD  +  P  C RC+K  L C
Sbjct: 101 RPVTSCSHCRQQKIKCDASQNFPAPCSRCQKMALQC 136

>CAGL0I07755g complement(745315..748476) similar to tr|Q12180
           Saccharomyces cerevisiae YOL089c HAL9, hypothetical
           start
          Length = 1053

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 18/40 (45%), Gaps = 3/40 (7%)

Query: 5   KPRVKTFTGCWTCRSRKVKCDLRRP---GCERCEKGGLIC 41
           K + +    C  CR RK KCD   P    C  C K G+ C
Sbjct: 169 KEKRRAAKACEYCRKRKTKCDEVSPYTNKCSNCSKAGVDC 208

>YKL015W (PUT3) [3241] chr11 (408187..411126) Transcription factor
          that activates the proline utilization pathway genes,
          contains a Zn[2]-Cys[6] fungal-type binuclear cluster
          domain in the N-terminal region [2940 bp, 979 aa]
          Length = 979

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 1/40 (2%)

Query: 2  KPAKPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
          +P K + ++   C +CR R +KC    P C++C     IC
Sbjct: 22 QPQKRQQRSSVACLSCRKRHIKCPGGNP-CQKCVTSNAIC 60

>CAGL0M03025g complement(341849..345613) similar to sp|P39113
          Saccharomyces cerevisiae YMR280c CAT8 transcription
          factor involved in gluconeogenesis, hypothetical start
          Length = 1254

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 23/52 (44%)

Query: 2  KPAKPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRWTRP 53
          + + P  +    C  CR +K KCD + P C +C   G  C   D   R + P
Sbjct: 48 RGSTPTYRVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFP 99

>KLLA0D09977g complement(841852..843756) weakly similar to
          sp|P40969 Saccharomyces cerevisiae YMR168c CEP3
          kinetochore protein complex, 71 KD subunit singleton,
          start by similarity
          Length = 634

 Score = 35.0 bits (79), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 3/34 (8%)

Query: 4  AKPRVKTFTG---CWTCRSRKVKCDLRRPGCERC 34
          +KP++    G   C  C++RKVKCD   P C+ C
Sbjct: 2  SKPKISLTKGKHPCTFCQARKVKCDRSLPACQNC 35

>CAGL0D02904g complement(302952..305615) similar to sp|P07272
          Saccharomyces cerevisiae YLR014c PPR1 transcription
          factor regulating pyrimidine pathway, hypothetical
          start
          Length = 887

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 17/33 (51%)

Query: 13 GCWTCRSRKVKCDLRRPGCERCEKGGLICGGYD 45
           C  CR +KVKCD   P C+ C +  + C   D
Sbjct: 24 ACKLCRRKKVKCDQGYPSCKGCLRNNVPCVSVD 56

>AFL160C [3035] [Homologous to ScYPL248C (GAL4) - SH]
          (130842..132788) [1947 bp, 648 aa]
          Length = 648

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 1/43 (2%)

Query: 7  RVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLR 49
          R      C +CR RK+KC    P C +C +   +C  Y  K+R
Sbjct: 2  RPPVIQACDSCRRRKMKCSKTFPKCAKCREDNRVC-LYSPKIR 43

>CAGL0A04455g 432854..436150 similar to sp|P34228 Saccharomyces
           cerevisiae YBL066c SEF1, hypothetical start
          Length = 1098

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 18/36 (50%), Gaps = 3/36 (8%)

Query: 9   KTFTGCWTCRSRKVKCDLRR--PG-CERCEKGGLIC 41
           +  T C  CR  K+KCD  +  P  C RC K G  C
Sbjct: 82  RPVTSCTHCRQHKIKCDASQNFPAPCTRCAKNGFHC 117

>KLLA0F02750g complement(250368..253814) some similarities with
          sgd|S0005449 Saccharomyces cerevisiae YOL089c HAL9
          transcriptional activator of ENA1, hypothetical start
          Length = 1148

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 21/43 (48%), Gaps = 5/43 (11%)

Query: 2  KPAKPRVKTFTGCWTCRSRKVKCDLRRP---GCERCEKGGLIC 41
          KPAK RV     C  CR RK+KCD   P    C  C K  + C
Sbjct: 24 KPAKKRVSK--ACDRCRRRKIKCDDLDPVSGKCSNCIKYKVPC 64

>CAGL0L03377g complement(382932..386561) some similarities with
          sp|P46954 Saccharomyces cerevisiae YJL089w SIP4
          interacts with SNF1 protein kinase, hypothetical start
          Length = 1209

 Score = 34.7 bits (78), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 18/33 (54%), Gaps = 1/33 (3%)

Query: 13 GCWTCRSRKVKCDLRRPGCERCEKGGLICGGYD 45
           C  CRS+K+KCD  +P C  C K G  C   D
Sbjct: 28 ACDRCRSKKIKCDGLQP-CSNCAKIGYNCVTSD 59

>Kwal_47.17233
          Length = 948

 Score = 34.7 bits (78), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 26/73 (35%), Gaps = 13/73 (17%)

Query: 7   RVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLIC-------------GGYDVKLRWTRP 53
           R +    C  C  RK+KC    P C +C K    C              G +VK+  + P
Sbjct: 28  RQRKILSCVPCHKRKIKCTRETPSCSKCLKKNWECSYFLNDRISRGGHSGMEVKVENSDP 87

Query: 54  IQFDTMGNVTATP 66
                  N T+ P
Sbjct: 88  EVLANKANGTSDP 100

>Scas_449.1
          Length = 636

 Score = 34.3 bits (77), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 5/50 (10%)

Query: 3  PAKPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRWTR 52
          P + R+     C  CR R+ KCDL  P C  C + GL C   +  +R  R
Sbjct: 30 PKRKRL----ACSNCRRRRKKCDLNFP-CANCIRLGLNCNVNEEDMRKKR 74

>ACL195C [854] [Homologous to NOHBY] (19204..19533) [330 bp, 109
          aa]
          Length = 109

 Score = 32.3 bits (72), Expect = 0.42,   Method: Composition-based stats.
 Identities = 16/36 (44%), Positives = 18/36 (50%), Gaps = 3/36 (8%)

Query: 9  KTFTGCWTCRSRKVKCD--LRRPG-CERCEKGGLIC 41
          K    C  CR  K+KCD   RRP  C  C K G+ C
Sbjct: 26 KPLRSCVRCRKNKIKCDSATRRPKPCSSCLKKGVGC 61

>Sklu_1622.2 YDR034C, Contig c1622 1522-3858
          Length = 778

 Score = 34.3 bits (77), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 17/29 (58%)

Query: 13  GCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
           GC  C+ R++KCD  +P C +C +    C
Sbjct: 163 GCTECKKRRMKCDEGKPSCWQCTRLNREC 191

>CAGL0K11902g complement(1148381..1150876) similar to sp|P40971
           Saccharomyces cerevisiae YDR034c LYS14 transcriptional
           activator of lysine pathway genes, hypothetical start
          Length = 831

 Score = 34.3 bits (77), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 19/35 (54%)

Query: 7   RVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
           R  +  GC  C+ R++KCD  +P C +C +    C
Sbjct: 197 RKYSRNGCAECKRRRMKCDESKPKCWQCTRLNRDC 231

>Sklu_1973.1 YDR303C, Contig c1973 815-3148 reverse complement
          Length = 777

 Score = 34.3 bits (77), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 17/32 (53%)

Query: 7  RVKTFTGCWTCRSRKVKCDLRRPGCERCEKGG 38
          ++K    C  CR RK+ CD  +P C  C + G
Sbjct: 9  KMKKPPACVQCRKRKIGCDRAKPICGNCLRNG 40

>Kwal_47.18089
          Length = 745

 Score = 34.3 bits (77), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 15/27 (55%)

Query: 13 GCWTCRSRKVKCDLRRPGCERCEKGGL 39
           C  CR RK+KCD +RP C  C    L
Sbjct: 28 SCTFCRHRKLKCDHKRPMCGSCAARKL 54

>CAGL0L04576g 526960..529557 similar to tr|Q12340 Saccharomyces
           cerevisiae YOR172w, hypothetical start
          Length = 865

 Score = 34.3 bits (77), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 32/70 (45%), Gaps = 1/70 (1%)

Query: 14  CWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRWTRPIQFDTMGNVTATPTGIKDPD 73
           C  CR RK+KCD  RP C  C         Y+  +  TR ++ + + +     T +K  +
Sbjct: 40  CAFCRRRKLKCDNARPMCSTCVSRKFSTCIYEDTVD-TRKVKLEEVFDSVPNLTLLKKVE 98

Query: 74  EPQYQRRNVD 83
           E +   + VD
Sbjct: 99  ELEKALQAVD 108

>KLLA0F04213g 400673..402979 similar to sp|P40971 Saccharomyces
           cerevisiae YDR034c LYS14 transcriptional activator of
           lysine pathway genes singleton, start by similarity
          Length = 768

 Score = 34.3 bits (77), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 17/29 (58%)

Query: 13  GCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
           GC  C+ R++KCD  +P C +C +    C
Sbjct: 154 GCLECKKRRMKCDEGKPTCWQCARLNRKC 182

>YDR034C (LYS14) [885] chr4 complement(509732..512104)
           Transcriptional activator of lysine pathway genes with
           2-aminoadipate semialdehyde as coinducer [2373 bp, 790
           aa]
          Length = 790

 Score = 34.3 bits (77), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 19/35 (54%)

Query: 7   RVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
           R  +  GC  C+ R++KCD  +P C +C +    C
Sbjct: 152 RKYSRNGCSECKRRRMKCDETKPTCWQCARLNRQC 186

>Scas_709.51
          Length = 759

 Score = 33.9 bits (76), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 32/74 (43%), Gaps = 8/74 (10%)

Query: 5  KPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRWTR------PIQFDT 58
          K R++    C  C+ RKVKCD  +P C  C K  + C  Y+     T+      P   D 
Sbjct: 25 KQRIRVQRACNICKRRKVKCDGNKP-CLNCIKKEIDC-EYNNSSNTTKKEPNDPPADIDA 82

Query: 59 MGNVTATPTGIKDP 72
            + T +P  +  P
Sbjct: 83 AESSTMSPPNLLHP 96

>YER031C (YPT31) [1456] chr5 complement(214075..214746) GTP-binding
           protein required in the secretory pathway at the stage
           of formation of trans-Golgi vesicles, member of the rab
           family in the ras superfamily of small GTP-binding
           proteins [672 bp, 223 aa]
          Length = 223

 Score = 33.1 bits (74), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 29/54 (53%), Gaps = 4/54 (7%)

Query: 445 NLQSKFPKNSPEMKFFLTLGIEFRTQASSF----LKRCLSNTVNQERYKDILTA 494
           NL S+F KN   M    T+G+EF T+        +K  + +T  QERY+ I +A
Sbjct: 28  NLLSRFTKNEFNMDSKSTIGVEFATRTLEIDGKRIKAQIWDTAGQERYRAITSA 81

>AGR280C [4591] [Homologous to ScYLR278C - SH] (1266918..1270238)
          [3321 bp, 1106 aa]
          Length = 1106

 Score = 33.9 bits (76), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 16/28 (57%)

Query: 14 CWTCRSRKVKCDLRRPGCERCEKGGLIC 41
          C  C+ RK +CD + P C  C K G+ C
Sbjct: 41 CLLCQRRKQRCDHKIPSCTACLKAGVRC 68

>AAL057C [130] [Homologous to ScYDR303C (RSC3) - SH; ScYHR056C
          (RSC30) - SH] (246899..249328) [2430 bp, 809 aa]
          Length = 809

 Score = 33.9 bits (76), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 17/32 (53%)

Query: 7  RVKTFTGCWTCRSRKVKCDLRRPGCERCEKGG 38
          ++K    C  CR RK+ CD  +P C  C + G
Sbjct: 9  KMKKPPACVQCRKRKIGCDRAKPLCGNCVRNG 40

>YOR380W (RDR1) [5153] chr15 (1051286..1052926) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region [1641 bp, 546 aa]
          Length = 546

 Score = 33.9 bits (76), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 2/57 (3%)

Query: 7  RVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRWTRPIQFDTMGNVT 63
          R +    C  CR RK KC+ + P CE C   G +C   D ++    P Q   +G  +
Sbjct: 13 RQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYIDGRVPSASP-QVQQVGETS 67

>KLLA0A01804g complement(159689..162526) similar to sgd|S0002829
          Saccharomyces cerevisiae YDR421w positive transcription
          regulator of ARO9 and ARO10, start by similarity
          Length = 945

 Score = 33.9 bits (76), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 33/76 (43%), Gaps = 17/76 (22%)

Query: 6  PRVKTFT----GCWTCRSRKVKCDL------RRPGCERCEKGGLIC-------GGYDVKL 48
          P+ +TF      C  C+ RKVKCDL        P C RC++    C       GG+ V  
Sbjct: 12 PKKQTFKRGYKACLNCKMRKVKCDLGPFDNPHGPPCVRCKRESRECMFTETKRGGFRVAK 71

Query: 49 RWTRPIQFDTMGNVTA 64
          +    ++ ++ G   A
Sbjct: 72 QSLVSLKEESAGKSMA 87

>KLLA0A02585g complement(226562..227674) some similarities with
          ca|CA5890|CaFCR1 Candida albicans Zinc cluster
          transcription factor, hypothetical start
          Length = 370

 Score = 33.5 bits (75), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 15/29 (51%), Gaps = 1/29 (3%)

Query: 13 GCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
           C  CR  K KCD  RP C RC K   +C
Sbjct: 21 ACDACRKSKTKCDGERP-CSRCLKENKLC 48

>YHR056C (RSC30) [2344] chr8 complement(215184..217835) Component
          of the abundant RSC chromatin remodeling complex [2652
          bp, 883 aa]
          Length = 883

 Score = 33.9 bits (76), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 16/30 (53%)

Query: 7  RVKTFTGCWTCRSRKVKCDLRRPGCERCEK 36
          +V+    C  CR RK+ CD  +P C  C K
Sbjct: 8  KVRKPPACTQCRKRKIGCDRAKPICGNCVK 37

>YKL222C (YKL222C) [3053] chr11 complement(3504..5621) Protein
          with similarity to transcription factors, has
          Zn[2]-Cys[6] fungal-type binuclear cluster domain in
          the N-terminal region [2118 bp, 705 aa]
          Length = 705

 Score = 33.9 bits (76), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 16/30 (53%)

Query: 5  KPRVKTFTGCWTCRSRKVKCDLRRPGCERC 34
          + R K    C  CR RK+KCD  RP C  C
Sbjct: 15 QSRRKPAKSCHFCRVRKLKCDRVRPFCGSC 44

>Scas_699.7
          Length = 935

 Score = 33.9 bits (76), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 18/37 (48%), Gaps = 1/37 (2%)

Query: 13 GCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLR 49
           C  CR +K+KC   +P C +C K    C  Y  K R
Sbjct: 12 ACDLCRVKKLKCSKEKPKCAKCLKNNWEC-CYSPKTR 47

>KLLA0F18084g complement(1652031..1654613) no similarity,
          hypothetical start
          Length = 860

 Score = 33.9 bits (76), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 15/29 (51%)

Query: 13 GCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
           C  CR  + KCD  +P C RC K  + C
Sbjct: 4  SCQNCRKTRRKCDRGKPTCARCIKYKIDC 32

>ADR365W [2106] [Homologous to ScYOR337W (TEA1) - SH]
          complement(1355410..1357515) [2106 bp, 701 aa]
          Length = 701

 Score = 33.5 bits (75), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 20/44 (45%), Gaps = 1/44 (2%)

Query: 9  KTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRWTR 52
          K    C  CR R+ KCDL  P C  C +  L C   D  LR  R
Sbjct: 42 KKRLACTNCRRRRKKCDLNYP-CSSCLRLKLECNVNDEDLRKKR 84

>KLLA0F13904g complement(1287758..1289497) some similarities with
          sp|P42950 Saccharomyces cerevisiae YJL103c,
          hypothetical start
          Length = 579

 Score = 33.5 bits (75), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 3/56 (5%)

Query: 12 TGCWTCRSRKVKCDLRRPGCERCEKGGL--ICGGYDVKLRWTRPIQFDTMGNVTAT 65
          T C  C  + ++CDL RP C+ C K G+   C   + K R   P +      V+A+
Sbjct: 18 TACVFCHEKHLQCDLGRP-CQNCSKRGIGDTCRDKERKPRKRGPRKVKKEREVSAS 72

>Scas_630.14
          Length = 701

 Score = 33.5 bits (75), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 19/41 (46%)

Query: 5  KPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYD 45
          + R +    C  CR RK KCD  +P C  C   G+    YD
Sbjct: 17 RKRNRVPKSCTVCRLRKSKCDRIKPYCSSCVLHGIKECRYD 57

>Scas_588.11
          Length = 835

 Score = 33.5 bits (75), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 28/70 (40%), Gaps = 8/70 (11%)

Query: 13 GCWTCRSRKVKCDLRRPGCERCEKGGL-ICGGYDVKLRWTRPIQFDTMGNVTATPTGIKD 71
           C  CR RK+ CD  +P C  C K     C   D+  R+  P        + +TPT    
Sbjct: 13 ACVQCRKRKIGCDRVKPICGNCRKTNKGDCFFPDIPGRYV-PAHSKGPSKLLSTPTP--- 68

Query: 72 PDEPQYQRRN 81
              QY R N
Sbjct: 69 ---SQYSRDN 75

>CAGL0H00396g complement(37005..39827) similar to sp|P08638
          Saccharomyces cerevisiae YLR451w LEU3 transcription
          factor, hypothetical start
          Length = 940

 Score = 33.5 bits (75), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 16/32 (50%), Gaps = 3/32 (9%)

Query: 13 GCWTCRSRKVKCDLRRPG---CERCEKGGLIC 41
           C  CR +K KCD        C RC+K G+ C
Sbjct: 57 ACVECRQQKSKCDAHDKAPEPCTRCQKKGVPC 88

>KLLA0C19228g 1713787..1715562 similar to sp|P53749 Saccharomyces
          cerevisiae YNR063w singleton, hypothetical start
          Length = 591

 Score = 33.1 bits (74), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 1/29 (3%)

Query: 13 GCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
           C  C+ RK KCD ++P C RC K  + C
Sbjct: 2  ACLECKKRKQKCDGQKP-CRRCTKLNVKC 29

>Scas_661.23
          Length = 741

 Score = 33.5 bits (75), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 17/29 (58%)

Query: 13  GCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
           GC  C+ R++KCD  +P C +C +    C
Sbjct: 131 GCAECKRRRMKCDETKPICWQCARLSREC 159

>KLLA0F10835g 997512..999782 no similarity, hypothetical start
          Length = 756

 Score = 33.5 bits (75), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 16/29 (55%)

Query: 13 GCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
          GC  C+   +KCD  +P C +C K  + C
Sbjct: 23 GCLQCKRSHLKCDEGQPKCGKCVKRNISC 51

>Kwal_27.10852
          Length = 1046

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 26/56 (46%), Gaps = 4/56 (7%)

Query: 9   KTFTGCWTCRSRKVKCDLRR--PG-CERCEKGGLICGGYDVKLRWTRPIQFDTMGN 61
           +  T C  CR  K+KC+     P  C RCE+ GL C   D   R  +  Q  ++ N
Sbjct: 95  RPVTSCTHCRQHKIKCNANDNFPAPCSRCERMGLHC-EIDPGFRPKKGSQLQSLRN 149

>ACR028C [1076] [Homologous to NOHBY] (408701..410506) [1806 bp,
          601 aa]
          Length = 601

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 15/29 (51%)

Query: 13 GCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
          GC  C+    KCD  +P C +C K  + C
Sbjct: 20 GCLQCKKSHTKCDETKPACLKCVKRNVEC 48

>YMR019W (STB4) [3983] chr13 (312155..315004) Sin3p-binding protein,
           contains a Zn[2]-Cys[6] fungal-type binuclear cluster
           domain in the N-terminal region [2850 bp, 949 aa]
          Length = 949

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 21/44 (47%), Gaps = 2/44 (4%)

Query: 4   AKPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVK 47
            K R++    C  C+ RKVKCD   P C  C K    C  YD K
Sbjct: 77  GKGRLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKEC-RYDFK 118

>CAGL0M02651g complement(304583..305971) similar to sp|P19541
          Saccharomyces cerevisiae YPL133c, hypothetical start
          Length = 462

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 3/40 (7%)

Query: 4  AKPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKG--GLIC 41
          AK + K +  C  CR   V CD +RP C RC K   G +C
Sbjct: 6  AKKQKKLYKSCIFCRRSHVNCDHQRP-CSRCIKREIGHLC 44

>Scas_702.7d
          Length = 978

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 1/35 (2%)

Query: 7  RVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
          ++++   C  CR RK+KC   +P C  CE  G +C
Sbjct: 11 KLRSSRACSNCRRRKIKCSGIQP-CPNCEIYGCLC 44

>Kwal_56.23058
          Length = 775

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 17/29 (58%)

Query: 13  GCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
           GC  C+ R++KCD  +P C +C +    C
Sbjct: 148 GCTECKRRRMKCDEGKPTCWQCARLNREC 176

>YPL248C (GAL4) [5202] chr16 complement(79711..82356)
          Transcription factor involved in expression of
          galactose-induced genes, phosphorylation correlates
          with activity [2646 bp, 881 aa]
          Length = 881

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 15/29 (51%)

Query: 13 GCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
           C  CR +K+KC   +P C +C K    C
Sbjct: 10 ACDICRLKKLKCSKEKPKCAKCLKNNWEC 38

>YPL133C (RDS2) [5312] chr16 complement(299887..301227) Protein
          with similarity to transcription factors, has
          Zn[2]-Cys[6] fungal-type binuclear cluster domain in
          the N-terminal region, involved in resistance to the
          antifungal drug ketoconazole [1341 bp, 446 aa]
          Length = 446

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 3/55 (5%)

Query: 9  KTFTGCWTCRSRKVKCDLRRPGCERCEKGGL--ICGGYDVKLRWTRPIQFDTMGN 61
          K F  C  C+   V CD +RP C RC K  +  +C   D+ +    P Q ++  N
Sbjct: 12 KAFKTCLFCKRSHVVCDKQRP-CSRCVKRDIAHLCREDDIAVPNEMPSQHESSPN 65

>YGR288W (MAL13) [2233] chr7 (1070298..1071719) Maltose pathway
          regulatory protein, contains a Zn[2]-Cys[6] fungal-type
          binuclear cluster domain [1422 bp, 473 aa]
          Length = 473

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 17/29 (58%), Gaps = 1/29 (3%)

Query: 13 GCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
           C  CR R+VKCD +RP C  C +  L C
Sbjct: 12 ACDCCRIRRVKCDGKRP-CSSCLQNSLDC 39

>YBR297W (MAL33) [474] chr2 (800479..801885) Maltose fermentation
          regulatory protein, has a Zn[2]-Cys[6] fungal-type
          binuclear cluster domain [1407 bp, 468 aa]
          Length = 468

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 2/43 (4%)

Query: 13 GCWTCRSRKVKCDLRRPGCERCEKGGLICGGYD-VKLRWTRPI 54
           C  CR R+VKCD ++P C RC +    C     +K R ++PI
Sbjct: 7  ACDYCRVRRVKCDGKKP-CSRCIEHNFDCTYQQPLKKRGSKPI 48

>ABL099W [493] [Homologous to ScYDR034C (LYS14) - SH]
           complement(212832..215234) [2403 bp, 800 aa]
          Length = 800

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 17/29 (58%)

Query: 13  GCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
           GC  C+ R++KCD  +P C +C +    C
Sbjct: 196 GCTECKRRRMKCDEGKPICWQCSRLNREC 224

>Sklu_2268.2 YKR064W, Contig c2268 4260-6887 reverse complement
          Length = 875

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 15/25 (60%)

Query: 14 CWTCRSRKVKCDLRRPGCERCEKGG 38
          C  C+ RK KCD ++P C  C + G
Sbjct: 13 CSNCKRRKSKCDKQKPACSNCVRLG 37

>CAGL0F09229g complement(908186..910693) weakly similar to
          sp|P39961 Saccharomyces cerevisiae YER184c,
          hypothetical start
          Length = 835

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 16/33 (48%), Gaps = 1/33 (3%)

Query: 9  KTFTGCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
          +    C  CR RKVKCD  +P C  C     +C
Sbjct: 16 RVIRACDVCRKRKVKCDGDQP-CSSCMTASTVC 47

>Kwal_23.3514
          Length = 579

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 1/30 (3%)

Query: 9  KTFTGCWTCRSRKVKCDLRRPGCERCEKGG 38
          KT T C  C  RKVKCD   P C  C K G
Sbjct: 7  KTRTPCVVCTKRKVKCDRNIP-CSNCVKRG 35

>Scas_638.14
          Length = 1043

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 18/37 (48%), Gaps = 1/37 (2%)

Query: 5  KPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
          KP  K    C  CR RK+KC  ++P C  CE     C
Sbjct: 39 KPTNKVSKACDNCRKRKIKCTGKQP-CATCEAYQCPC 74

>Kwal_14.819
          Length = 568

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 16/32 (50%)

Query: 10 TFTGCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
          +   C  CR RKV+C  + P C+ C K    C
Sbjct: 12 SIISCRQCRDRKVRCSRQIPKCKSCTKRNCEC 43

>YDL170W (UGA3) [701] chr4 (156319..157905) Transcriptional
          activator for 4-aminobutyric acid (GABA) catabolic
          genes, including UGA4, UGA1, and UGS2, contains a
          Zn[2]-Cys[6] fungal-type binuclear cluster domain [1587
          bp, 528 aa]
          Length = 528

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 15/29 (51%)

Query: 13 GCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
          GC TC+ RK +C   +P C  C +    C
Sbjct: 16 GCITCKIRKKRCSEDKPVCRDCRRLSFPC 44

>Scas_669.8
          Length = 637

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 18/33 (54%), Gaps = 1/33 (3%)

Query: 7  RVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGL 39
          R KT   C  C+ RKVKCD   P C  C + GL
Sbjct: 9  RRKTPYACNVCKKRKVKCDKLIP-CTSCIQKGL 40

>Kwal_26.7448
          Length = 714

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 4/36 (11%)

Query: 13  GCWTCRSRKVKCDLRRPGCERCE----KGGLICGGY 44
           GC  C+ R++KCD   P C  C+    KG   C  Y
Sbjct: 94  GCDECKRRRIKCDETLPECNNCKNRHNKGPSQCCSY 129

>AFL031W [3162] [Homologous to ScYBR239C - SH]
          complement(376161..377714) [1554 bp, 517 aa]
          Length = 517

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 18/36 (50%), Gaps = 1/36 (2%)

Query: 4  AKPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGL 39
          A  R KT   C  C    V C+ +RP C RC K GL
Sbjct: 9  AAKRKKTNVACVNCSRSHVTCESQRP-CTRCVKKGL 43

>Scas_680.25
          Length = 738

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 13/29 (44%)

Query: 13 GCWTCRSRKVKCDLRRPGCERCEKGGLIC 41
           C  CR  K KC  + P C  CEK    C
Sbjct: 15 SCSRCRRLKKKCPRQTPSCANCEKAHATC 43

>YHR178W (STB5) [2464] chr8 (459297..461528) Probable
          transcriptional activator of multidrug resistance genes
          such as PDR5 and SNQ2 [2232 bp, 743 aa]
          Length = 743

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 20/53 (37%)

Query: 7  RVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRWTRPIQFDTM 59
          R      C  CR  K KC  + P C  C+K G  C       R T+    D M
Sbjct: 15 RTTELYSCARCRKLKKKCGKQIPTCANCDKNGAHCSYPGRAPRRTKKELADAM 67

>CAGL0M05907g 622029..624704 similar to sp|P36023 Saccharomyces
          cerevisiae YKR064w, hypothetical start
          Length = 891

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 1/37 (2%)

Query: 2  KPAKPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGG 38
          K  K R +    C  CR RK KCD + P C +C + G
Sbjct: 6  KVTKSRRRPMLVCVNCRKRKSKCDRQLP-CSKCIQHG 41

>Kwal_47.16862
          Length = 743

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 7/43 (16%)

Query: 5  KPRVKTFTGCWTCRSRKVKC------DLRRPGCERCEKGGLIC 41
          +P+  TF  C  C ++K KC      D+ R  C RC K   +C
Sbjct: 52 RPKRNTF-ACTNCHAQKSKCVPSDVLDIYRKPCVRCRKRNKLC 93

>Scas_720.48
          Length = 1179

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 27/62 (43%), Gaps = 2/62 (3%)

Query: 326 PLRNFVELNVPGS--TMPRSAIEVIHSQVPDPSIFNRPGNTNPLLDIPTTGVHVHGLARF 383
           P+   +E   PGS  T P +A    H     P I       NP +D  T  V V G A++
Sbjct: 155 PIEYLIEPGPPGSNTTTPNNATSQSHHLAQKPYIIKEKVQFNPTIDPVTQEVLVPGHAKY 214

Query: 384 LL 385
           +L
Sbjct: 215 ML 216

>Kwal_23.6537
          Length = 552

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 19/44 (43%), Gaps = 1/44 (2%)

Query: 3  PAKPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDV 46
          P   R++    C  CR RK KCD   P C  C   G  C   DV
Sbjct: 9  PRNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYDDV 51

>Scas_700.40
          Length = 407

 Score = 31.2 bits (69), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 19/35 (54%), Gaps = 2/35 (5%)

Query: 5  KPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGL 39
          K R KT   C  CR   V CD +RP C RC K G+
Sbjct: 14 KKRKKT-KSCLFCRRSHVNCDGKRP-CSRCLKRGI 46

>YNR063W (YNR063W) [4646] chr14 (746940..748763) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region [1824 bp, 607 aa]
          Length = 607

 Score = 31.2 bits (69), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 2/33 (6%)

Query: 2  KPAKPRVKTFTGCWTCRSRKVKCDLRRPGCERC 34
          K A+ R  +   C  CR RK+KCD  +P C RC
Sbjct: 5  KDARKRSISL-ACTVCRKRKLKCDGNKP-CGRC 35

>Kwal_14.1636
          Length = 456

 Score = 31.2 bits (69), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%)

Query: 7  RVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGL 39
          R KT   C  C    V C   RP C RC K GL
Sbjct: 5  RQKTSVACINCSKSHVTCQAERP-CTRCVKKGL 36

>Kwal_33.13934
          Length = 797

 Score = 31.2 bits (69), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 17/34 (50%)

Query: 5  KPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGG 38
          K R +    C  C+ RK KCD  +P C  C + G
Sbjct: 14 KKRRRPTVVCTNCKRRKSKCDRLKPICGNCSRLG 47

>CAGL0K09394g complement(929234..929899) highly similar to sp|P51996
           Saccharomyces cerevisiae YGL210w YPT32 or sp|P38555
           Saccharomyces cerevisiae YER031c YPT31, start by
           similarity
          Length = 221

 Score = 30.4 bits (67), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 4/54 (7%)

Query: 445 NLQSKFPKNSPEMKFFLTLGIEFRTQASSF----LKRCLSNTVNQERYKDILTA 494
           NL S+F  N   ++   T+G+EF T+        +K  + +T  QERY+ I +A
Sbjct: 29  NLLSRFTTNEFNLESKSTIGVEFATRTIKVEDKKIKAQIWDTAGQERYRAITSA 82

>Scas_712.41
          Length = 219

 Score = 30.0 bits (66), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 4/54 (7%)

Query: 445 NLQSKFPKNSPEMKFFLTLGIEFRTQASSF----LKRCLSNTVNQERYKDILTA 494
           NL S+F  N   ++   T+G+EF T+        +K  + +T  QERY+ I +A
Sbjct: 28  NLLSRFTTNEFNIESKSTIGVEFATRTIEVEGKKIKAQIWDTAGQERYRAITSA 81

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.136    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 26,292,280
Number of extensions: 1120496
Number of successful extensions: 3574
Number of sequences better than 10.0: 213
Number of HSP's gapped: 3611
Number of HSP's successfully gapped: 221
Length of query: 843
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 733
Effective length of database: 12,788,129
Effective search space: 9373698557
Effective search space used: 9373698557
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)