Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0D10065g46645924650.0
Sklu_2101.356843514680.0
Kwal_23.348850244713690.0
ADL279W49342613480.0
CAGL0F07799g58045312901e-174
YMR171C55046511941e-160
Scas_669.1058546911421e-152
Sklu_2430.75393523341e-33
KLLA0B12760g5422423041e-29
CAGL0M06545g5873463032e-29
ABL026W4801952994e-29
YKL124W (SSH4)5792312882e-27
Kwal_26.76655512922829e-27
Scas_721.1265732282783e-26
AFR242C82363770.24
CAGL0I04114g910120740.60
Kwal_47.1917383628701.9
Scas_712.2397324692.5
Sklu_1925.2458103673.3
CAGL0J11726g33642673.4
YGL227W (VID30)95824673.7
CAGL0M11858g23728663.8
KLLA0A01221g872126639.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D10065g
         (459 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D10065g complement(851283..852683) similar to sp|Q03212 Sac...   954   0.0  
Sklu_2101.3 YMR171C, Contig c2101 5004-6710                           570   0.0  
Kwal_23.3488                                                          531   0.0  
ADL279W [1462] [Homologous to ScYMR171C - SH] complement(212401....   523   0.0  
CAGL0F07799g complement(760681..762423) similar to sp|Q03212 Sac...   501   e-174
YMR171C (YMR171C) [4126] chr13 complement(603867..605519) Protei...   464   e-160
Scas_669.10                                                           444   e-152
Sklu_2430.7 YKL124W, Contig c2430 12905-14524                         133   1e-33
KLLA0B12760g 1114942..1116570 some similarities with sp|P32343 S...   121   1e-29
CAGL0M06545g 677238..679001 similar to sp|P32343 Saccharomyces c...   121   2e-29
ABL026W [566] [Homologous to ScYKL124W (SSH4) - SH] complement(3...   119   4e-29
YKL124W (SSH4) [3142] chr11 (210239..211978) Protein that confer...   115   2e-27
Kwal_26.7665                                                          113   9e-27
Scas_721.126                                                          111   3e-26
AFR242C [3434] [Homologous to ScYGL227W (VID30) - SH] (873480..8...    34   0.24 
CAGL0I04114g 360592..363324 similar to sp|P53076 Saccharomyces c...    33   0.60 
Kwal_47.19173                                                          32   1.9  
Scas_712.23                                                            31   2.5  
Sklu_1925.2 YOL072W, Contig c1925 3789-5165                            30   3.3  
CAGL0J11726g 1140123..1141133 similar to sp|P50105 Saccharomyces...    30   3.4  
YGL227W (VID30) [1771] chr7 (69670..72546) Protein that regulate...    30   3.7  
CAGL0M11858g 1177287..1178000 weakly similar to sp|P38989 Saccha...    30   3.8  
KLLA0A01221g 113308..115926 similar to sp|P53076 Saccharomyces c...    29   9.7  

>KLLA0D10065g complement(851283..852683) similar to sp|Q03212
           Saccharomyces cerevisiae YMR171c, start by similarity
          Length = 466

 Score =  954 bits (2465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/459 (100%), Positives = 459/459 (100%)

Query: 1   MNLSLVARHGHKSKMAHKHHGDSAHVSEGPSDPDVDMDLIVFTMMFMFLSYLLSILVYFV 60
           MNLSLVARHGHKSKMAHKHHGDSAHVSEGPSDPDVDMDLIVFTMMFMFLSYLLSILVYFV
Sbjct: 1   MNLSLVARHGHKSKMAHKHHGDSAHVSEGPSDPDVDMDLIVFTMMFMFLSYLLSILVYFV 60

Query: 61  TRWLVKRLFTARISLHEEGTMNGGQSDLSEDRYLDDESEVKEFLQNLSPKEQFYYKQGEE 120
           TRWLVKRLFTARISLHEEGTMNGGQSDLSEDRYLDDESEVKEFLQNLSPKEQFYYKQGEE
Sbjct: 61  TRWLVKRLFTARISLHEEGTMNGGQSDLSEDRYLDDESEVKEFLQNLSPKEQFYYKQGEE 120

Query: 121 YVKQNPPLLVPYLPNDPENREEVIPDPIVNEQTLQFIEEEGAAAWEFQADPNLPNDTVMI 180
           YVKQNPPLLVPYLPNDPENREEVIPDPIVNEQTLQFIEEEGAAAWEFQADPNLPNDTVMI
Sbjct: 121 YVKQNPPLLVPYLPNDPENREEVIPDPIVNEQTLQFIEEEGAAAWEFQADPNLPNDTVMI 180

Query: 181 QERTELTFLNFSYDASVMTTLPIPRLNKVYYYECKIFELNQGKNHLSDNEMISIGLSTSP 240
           QERTELTFLNFSYDASVMTTLPIPRLNKVYYYECKIFELNQGKNHLSDNEMISIGLSTSP
Sbjct: 181 QERTELTFLNFSYDASVMTTLPIPRLNKVYYYECKIFELNQGKNHLSDNEMISIGLSTSP 240

Query: 241 YPYFRLPGRHHHSISYDSDGCRRMNSSFPMSAELQTLFPRFEKGDVIGIGYRTRSGTIFF 300
           YPYFRLPGRHHHSISYDSDGCRRMNSSFPMSAELQTLFPRFEKGDVIGIGYRTRSGTIFF
Sbjct: 241 YPYFRLPGRHHHSISYDSDGCRRMNSSFPMSAELQTLFPRFEKGDVIGIGYRTRSGTIFF 300

Query: 301 THNGKKLNEKKVGGHIKGWKLKYLYPIVGSNIPCKIHVNFGTYGFVYIEANVKKWGYSKN 360
           THNGKKLNEKKVGGHIKGWKLKYLYPIVGSNIPCKIHVNFGTYGFVYIEANVKKWGYSKN
Sbjct: 301 THNGKKLNEKKVGGHIKGWKLKYLYPIVGSNIPCKIHVNFGTYGFVYIEANVKKWGYSKN 360

Query: 361 AGIKLPPPSYEDYDQDVLLESAFEDDVSDSESITSDSINEQITDQSGNILPPPPGFEFST 420
           AGIKLPPPSYEDYDQDVLLESAFEDDVSDSESITSDSINEQITDQSGNILPPPPGFEFST
Sbjct: 361 AGIKLPPPSYEDYDQDVLLESAFEDDVSDSESITSDSINEQITDQSGNILPPPPGFEFST 420

Query: 421 SVASDIPVESITMHSLPAEPPNYSADEDEEHNVEDNTIA 459
           SVASDIPVESITMHSLPAEPPNYSADEDEEHNVEDNTIA
Sbjct: 421 SVASDIPVESITMHSLPAEPPNYSADEDEEHNVEDNTIA 459

>Sklu_2101.3 YMR171C, Contig c2101 5004-6710
          Length = 568

 Score =  570 bits (1468), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/435 (62%), Positives = 347/435 (79%), Gaps = 19/435 (4%)

Query: 27  SEGPSDP--------DVDMDLIVFTMMFMFLSYLLSILVYFVTRWLVKRLFTARISLHEE 78
           SE PS P        D+DM ++ F+M FM LSY+L  L+YF  R+++K+ F+ RISL+  
Sbjct: 84  SEHPSAPGFQDDYEDDMDMAMLFFSMAFMLLSYILLTLIYFSVRFVIKKYFSTRISLNNN 143

Query: 79  GTMN-GGQSDLSEDRYLDDESEVKEFLQNLSPKEQFYYKQGEEYVKQNPPLLVPYLPNDP 137
            + N    +  S    LDDE  VK+ L  LSP+EQFYYKQGEEY+KQNPPLL+P+   D 
Sbjct: 144 NSPNIRTTTSNSWPSSLDDEEAVKDKLVKLSPEEQFYYKQGEEYIKQNPPLLIPHRSEDS 203

Query: 138 ENREEVIPDPIVNEQTLQFIEEEGAAAWEFQADPNLPNDTVMIQERTELTFLNFSYDASV 197
           +     + DPI+N+QT++FIEEEG  AWEFQ DPNLPNDT++I+ +TE+TFLN++YDASV
Sbjct: 204 QG----MLDPIINDQTIRFIEEEGVHAWEFQPDPNLPNDTILIENKTEITFLNYNYDASV 259

Query: 198 MTTLPIPRLNKVYYYECKIFELNQGK---NHLSDNEMISIGLSTSPYPYFRLPGRHHHSI 254
           MT LP+PR+N+VYY+ECKIFELN  +   N+LSDNEMIS GLS+SPYPYFRLPGRHHHSI
Sbjct: 260 MTNLPVPRVNRVYYFECKIFELNTSRSDNNYLSDNEMISFGLSSSPYPYFRLPGRHHHSI 319

Query: 255 SYDSDGCRRMNSSFPMSAELQTLFPRFEKGDVIGIGYRTRSGTIFFTHNGKKLNEKKVGG 314
           +YDS G RR N SF +SAEL ++FPR++KGD+IGIGYRT SGT+FFT NGKKLNEK +GG
Sbjct: 320 AYDSTGGRRFNDSFELSAELASIFPRYQKGDIIGIGYRTNSGTVFFTRNGKKLNEKPIGG 379

Query: 315 HIKGWKLKYLYPIVGSNIPCKIHVNFGTYGFVYIEANVKKWGYSKNAGIKLPPPSYEDYD 374
           HIKGWKLKYLYPIVG+N+PCK+HVNFG+YGFV+IEANVKKWGY+K+ G+KLPPPSY++Y 
Sbjct: 380 HIKGWKLKYLYPIVGANVPCKVHVNFGSYGFVFIEANVKKWGYAKSHGVKLPPPSYDEYG 439

Query: 375 QDVLLESAFEDDVSDSESITSDSINEQITDQSGNILPPPPGFEFSTSVASDIPV-ESITM 433
           QDVLLES++EDD++D+ES++  ++   I D  G +LPPPPGFEFST+  S   + + IT+
Sbjct: 440 QDVLLESSYEDDITDNESVS--TVEGDIVDSDGELLPPPPGFEFSTTPQSRGNIGDQITL 497

Query: 434 HSLPAEPPNYSADED 448
            SLPA+PP+YS+D+D
Sbjct: 498 DSLPAQPPSYSSDDD 512

>Kwal_23.3488
          Length = 502

 Score =  531 bits (1369), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/447 (59%), Positives = 329/447 (73%), Gaps = 10/447 (2%)

Query: 7   ARHGHKSKMAHKHHGDSAHVSEGPSDPDVDMDLIVFTMMFMFLSYLLSILVYFVTRWLVK 66
           A  G+    +   H   +   +G  + D+D+ L++F++ FM  SY    LVY V ++L++
Sbjct: 24  ASCGYVPSQSDGQHFVGSGPYDGDYEDDLDIGLMMFSLAFMVFSYFALTLVYLVVKFLLR 83

Query: 67  RLFTARISLHE-EGTMNGGQSDLSEDRYLDDESEVKEFLQNLSPKEQFYYKQGEEYVKQN 125
           R F   ISL E E  + G   +      LDD   V++ L  +S +EQFYYKQGEE++KQN
Sbjct: 84  RYFRTGISLSEGESRVIGPAVNARWPSALDDADAVRDKLARMSAEEQFYYKQGEEFIKQN 143

Query: 126 PPLLVPYLPNDPENREEVIPDPIVNEQTLQFIEEEGAAAWEFQADPNLPNDTVMIQERTE 185
           PPLL+P     P   E V  DPI+NEQTLQFI+EEGA AWEFQ DP LPND+V+++ ++E
Sbjct: 144 PPLLLP--DRSPVGAETV--DPIINEQTLQFIDEEGAHAWEFQPDPKLPNDSVLVENKSE 199

Query: 186 LTFLNFSYDASVMTTLPIPRLNKVYYYECKIFELNQG--KNHLSDNEMISIGLSTSPYPY 243
           +TFLN++YD SVMT LPIPRLN+VYY E KIFELN     N+ S NEM+S GLSTSPYPY
Sbjct: 200 ITFLNYNYDVSVMTNLPIPRLNRVYYCEFKIFELNTAGSNNNSSQNEMLSFGLSTSPYPY 259

Query: 244 FRLPGRHHHSISYDSDGCRRMNSSFPMSAELQTLFPRFEKGDVIGIGYRTRSGTIFFTHN 303
           FRLPGRHHHSI+YDS G RR N SF +S EL ++FPR EKGDVIGIGYRT SGT+FFT N
Sbjct: 260 FRLPGRHHHSIAYDSTGGRRFNDSFELSPELASIFPRCEKGDVIGIGYRTNSGTVFFTRN 319

Query: 304 GKKLNEKKVGGHIKGWKLKYLYPIVGSNIPCKIHVNFGTYGFVYIEANVKKWGYSKNAGI 363
           GKKLNEK +GGHIKGWK KY+YPIVGSNIPCK+HVNFGTYGFV+IEANVKKWGY+K+ G+
Sbjct: 320 GKKLNEKSIGGHIKGWKFKYVYPIVGSNIPCKVHVNFGTYGFVFIEANVKKWGYAKSNGM 379

Query: 364 KLPPPSYEDYDQDVLLESAFEDDVSDSESITSDSINEQITDQSGNILPPPPGFEFSTSVA 423
           KLPPPSYEDY QDVLLES++EDD +D+ES +  +I+  I D  G++LPPPPGFE+S S  
Sbjct: 380 KLPPPSYEDYSQDVLLESSYEDDATDNESTS--TIDGDIIDSEGHLLPPPPGFEYSVSPQ 437

Query: 424 SDIPVESITMHSLPAEPPNYSADEDEE 450
                   T++SLP EPP Y++D  E+
Sbjct: 438 PSA-AGQFTLNSLPPEPPRYASDTPED 463

>ADL279W [1462] [Homologous to ScYMR171C - SH]
           complement(212401..213882) [1482 bp, 493 aa]
          Length = 493

 Score =  523 bits (1348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/426 (59%), Positives = 325/426 (76%), Gaps = 18/426 (4%)

Query: 30  PSDPDVDMDLIVFT--MMFMFLSYLLSILVYFVTRWLVKRLFTARISLHEEGTMNGGQSD 87
           P D ++DMD ++FT  ++FM L Y + +L+Y   R++V+R FT RI+L    +      D
Sbjct: 32  PDDNELDMDFVLFTFSLVFMLLCYGMMVLIYLGLRYVVRRCFTRRIALSSSDSSRANSGD 91

Query: 88  LSEDRYLDDESEVKEFLQNLSPKEQFYYKQGEEYVKQNPPLLVPY---LPNDPENREEVI 144
           +     LDDE EV+  L  LSP+EQFYYKQGEE++KQNPP L+PY              +
Sbjct: 92  VPT--VLDDELEVRHKLAQLSPEEQFYYKQGEEFIKQNPPALMPYQTVAGGGSHGEPADV 149

Query: 145 PDPIVNEQTLQFIEEEGAAAWEFQADPNLPNDTVMIQERTELTFLNFSYDASVMTTLPIP 204
            DP++N+QTL++IEEEGA AWEFQ  P+LP D V ++ RTELTF+N + D SV T LPIP
Sbjct: 150 FDPVINDQTLRYIEEEGAQAWEFQPSPSLPPDFVKVENRTELTFMNSNSDVSVATNLPIP 209

Query: 205 RLNKVYYYECKIFEL----NQGKNHLSDNEMISIGLSTSPYPYFRLPGRHHHSISYDSDG 260
             NKVYY+ECKIFEL     +  +HLS+N+++S GL+TSPYPYFRLPGRHHHS++YDS+G
Sbjct: 210 LANKVYYFECKIFELCDRLGRPVSHLSENQIVSFGLATSPYPYFRLPGRHHHSVAYDSNG 269

Query: 261 CRRMNSSFPMSAELQTLFPRFEKGDVIGIGYRTRSGTIFFTHNGKKLNEKKVGGHIKGWK 320
            RR+N+SF +  EL +LFPR EKGDVIGIGYRTRSGT+FFT NGKKLNEK++GGHIKGWK
Sbjct: 270 ARRLNNSFKLPQELSSLFPRCEKGDVIGIGYRTRSGTVFFTRNGKKLNEKRIGGHIKGWK 329

Query: 321 LKYLYPIVGSNIPCKIHVNFGTYGFVYIEANVKKWGYSKNAGIKLPPPSYEDYDQDVLLE 380
           +KYLYPIVG+N+PCKIHVNFGTYGFVYIEANVKKWGY+K  G+KLPPP+YEDYD+DVLLE
Sbjct: 330 IKYLYPIVGANVPCKIHVNFGTYGFVYIEANVKKWGYAKLNGMKLPPPAYEDYDRDVLLE 389

Query: 381 SAFEDDVSDSESITSDSINEQITDQSGNILPPPPGFEFSTSVASDIPVESITMHSLPAEP 440
           S++ED+VS+ E   ++S  E + D  G++LPPPPGFEFST+  S+   +  T+++LP EP
Sbjct: 390 SSYEDEVSEGE---TNSFVEHLHD--GHLLPPPPGFEFSTTPTSN--CDQFTLNTLPTEP 442

Query: 441 PNYSAD 446
           P Y +D
Sbjct: 443 PGYMSD 448

>CAGL0F07799g complement(760681..762423) similar to sp|Q03212
           Saccharomyces cerevisiae YMR171c, hypothetical start
          Length = 580

 Score =  501 bits (1290), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 261/453 (57%), Positives = 324/453 (71%), Gaps = 29/453 (6%)

Query: 28  EGPSDPDVDMDLIVFTMMF--MFLSYLLSILVYFVTRWLVKRLFT--ARISLHEEGTMNG 83
           +G ++ D  +D+ V  + F  M + YL   ++YF T+ +V RL T  ARISL  E  M  
Sbjct: 57  DGYTNQDDQLDINVMFIYFGSMLVMYLCICIIYFTTKIVVTRLLTRHARISLLNEEGMAT 116

Query: 84  GQSDLS-------EDRY---LDDESEVKEFLQNLSPKEQFYYKQGEEYVKQNPPLLVPYL 133
           G S  S       E R+   LDDE+EVK  LQ LSP+EQFYYKQGEEY+KQNPPL++   
Sbjct: 117 GLSARSRRLAESAESRWPSALDDENEVKSKLQKLSPEEQFYYKQGEEYIKQNPPLIIS-- 174

Query: 134 PNDPENREEVIPDPIVNEQTLQFIEEEGAAAWEFQADPNLPNDTVMIQERTELTFLNFSY 193
                  +  + DPI+N+QT QFIEEEGA AWEFQ +PNLPNDT++++ +TE++FLN++Y
Sbjct: 175 TGSRSGDQNTVNDPIINDQTRQFIEEEGALAWEFQPNPNLPNDTIIVENKTEISFLNYNY 234

Query: 194 DASVMTTLPIPRLNKVYYYECKIFELN--QGKNHLSDNEMISIGLSTSPYPYFRLPGRHH 251
           DASV T LPIP +N+VYY E KIFEL+    +  L DNE+IS GLSTSPYPYFRLPGRHH
Sbjct: 235 DASVTTNLPIPCINRVYYCEFKIFELSITDDQTTLKDNEIISFGLSTSPYPYFRLPGRHH 294

Query: 252 HSISYDSDGCRRMNSSFPMSAELQTLFPRFEKGDVIGIGYRTRSGTIFFTHNGKKLNEKK 311
           HSI+YDS+G RR N SF +  EL  LFP+ +KGD+IGIGYRTRSGT+FFT NGKK++EK 
Sbjct: 295 HSIAYDSNGARRFNDSFKLEPELADLFPKCQKGDIIGIGYRTRSGTVFFTRNGKKISEKS 354

Query: 312 VGGHIKGWKLKYLYPIVGSNIPCKIHVNFGTYGFVYIEANVKKWGYSKNAGIKLPPPSYE 371
           VGGHIKGWK KYLYP+VG+N+PCKIHVNFG+YGFV+IEANVKKWGY+K  GIKLPPPSY+
Sbjct: 355 VGGHIKGWKFKYLYPVVGANVPCKIHVNFGSYGFVFIEANVKKWGYAKPNGIKLPPPSYD 414

Query: 372 DYDQDVLLESAFEDDVSDSESITSD----------SINEQITDQSGNILPPPPGFEFSTS 421
           DY QD LLES +ED+ +       +          SI   I D  GN+LPPPPGFEFSTS
Sbjct: 415 DYVQDTLLESGYEDNDNSDNDSDDESDTDNRRQHRSIKNTIIDIDGNLLPPPPGFEFSTS 474

Query: 422 VASDIPVESITMHSLPAEPPNYSADEDEEHNVE 454
             S    E I + SLP  PP+YS DE+ ++ V+
Sbjct: 475 PHSHGTNEEINLDSLPMNPPSYS-DEESKNQVK 506

>YMR171C (YMR171C) [4126] chr13 complement(603867..605519) Protein
           containing a SPRY (SPla and RYanodine Receptor) domain,
           has moderate similarity to uncharacterized C. albicans
           Orf6.5491p [1653 bp, 550 aa]
          Length = 550

 Score =  464 bits (1194), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 247/465 (53%), Positives = 319/465 (68%), Gaps = 40/465 (8%)

Query: 26  VSEGPSDPD-VDMDLIVFTMMFMFLSYLLSILVYFVTRWLVKRLFTARISLHEEGTMNGG 84
           VS G  D D ++MD+++F    + + Y++  +VYF T+ +  RL TA  + H  G     
Sbjct: 32  VSYGGDDTDELNMDIMLFAFGTLIVVYIVICIVYFFTKQIATRLITAYYNEHGPGQRISL 91

Query: 85  QSDLSEDRY------------------LDDESEVKEFLQNLSPKEQFYYKQGEEYVKQNP 126
            SD  E+                    LDD  EV++ L  LSP+EQFYYKQGEEY+KQNP
Sbjct: 92  FSDYDENNAHVHSRRLMENMSLRWPNNLDDADEVRDKLAQLSPEEQFYYKQGEEYIKQNP 151

Query: 127 PLLVP---YLPNDPENREEVIPDPIVNEQTLQFIEEEGAAAWEFQADPNLPNDTVMIQER 183
           P L+       ++  N +    DPI+NEQT Q+I+EEGA AWEF  +P++PN TV+++ +
Sbjct: 152 PFLLNQGLLQQSEDSNPDTTREDPIMNEQTRQYIQEEGAYAWEFSPNPDMPNHTVIVENK 211

Query: 184 TELTFLNFSYDASVMTTLPIPRLNKVYYYECKIFE----LNQGKNHLSDNEMISIGLSTS 239
           TE++FLN++YDAS+ T LPIP +NKVYY E KIFE    LN  +N      +IS GLST 
Sbjct: 212 TEVSFLNYNYDASISTNLPIPCINKVYYCEFKIFETDGPLNSDEN--VSKGVISFGLSTQ 269

Query: 240 PYPYFRLPGRHHHSISYDSDGCRRMNSSFPMSAELQTLFPRFEKGDVIGIGYRTRSGTIF 299
           PYPYFRLPGRHHHSI+YDS+G RR N SF ++ +L+TLFP+ EKGD++GIGYR+RSGT+F
Sbjct: 270 PYPYFRLPGRHHHSIAYDSNGARRFNDSFKLNEQLRTLFPQCEKGDIVGIGYRSRSGTVF 329

Query: 300 FTHNGKKLNEKKVGGHIKGWKLKYLYPIVGSNIPCKIHVNFGTYGFVYIEANVKKWGYSK 359
           FT NGKKLNEK VGGHI+GWK +YLYPI+GSN+PC+IHVNFGTYGFVYIEANVKKWGY+K
Sbjct: 330 FTRNGKKLNEKSVGGHIRGWKFQYLYPIIGSNVPCQIHVNFGTYGFVYIEANVKKWGYAK 389

Query: 360 NAGIKLPPPSYEDYDQDVLLESA-----FEDDVSDSESI-----TSDSINEQITDQSGNI 409
           + GIKLPPPSYEDY +D LLES      F++D SD +S      ++ ++N+ I  ++G I
Sbjct: 390 SNGIKLPPPSYEDYGKDTLLESGGEDNDFDEDFSDGDSDNIAAGSTTNLNDDIIIRNGEI 449

Query: 410 LPPPPGFEFSTS--VASDIPVESITMHSLPAEPPNYSADEDEEHN 452
           LPPPPGFEF+ S      I  E I + SLP  PP+YS DE    N
Sbjct: 450 LPPPPGFEFTMSPPTGKKIINEEINLDSLPMLPPSYSDDEHHSKN 494

>Scas_669.10
          Length = 585

 Score =  444 bits (1142), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 251/469 (53%), Positives = 323/469 (68%), Gaps = 50/469 (10%)

Query: 28  EGPSDPDVDMDLIVFTMMFMFLSYLLSILVYFVTRWLVKRLFTA---RISLH-----EEG 79
           E   D DVD  +++F+++ M + Y+L ILVY V +++V R+ T+   RISL      EE 
Sbjct: 43  EDDKDEDVDFHVMLFSLITMIIIYVLVILVYIVVKFVVTRMLTSNISRISLLNRTEVEES 102

Query: 80  TMNGGQSDLSE------------DRYLDDESEVKEFLQNLSPKEQFYYKQGEEYVKQNPP 127
           T    +                 + +LDD   VK  L  L+P+EQFYYKQGEE++KQNPP
Sbjct: 103 TRTNNEGTGRSRRSTRRDQRFDLESFLDDPETVKSKLSLLNPEEQFYYKQGEEFIKQNPP 162

Query: 128 LLVPYLPNDPENREEVIP-----DPIVNEQTLQFIEEEGAAAWEFQADPNLPNDTVMIQE 182
           +++P   N+  N           DPI+N QT QFIEEEGA+AWEFQADPNLPNDT++I+ 
Sbjct: 163 IIIPPNNNNNSNDISTTDSNAEDDPIMNHQTKQFIEEEGASAWEFQADPNLPNDTILIEN 222

Query: 183 RTELTFLNFSYDASVMTTLPIPRLNKVYYYECKIFELNQG--KNHLSDNEMISIGLSTSP 240
           +TE+TFLN++YDASVMT LPIP +N+VYY E KIFELN    + +LS NE+IS+GL+TSP
Sbjct: 223 KTEITFLNYNYDASVMTNLPIPCINRVYYCEFKIFELNNSPEQTNLSPNEVISMGLATSP 282

Query: 241 YPYFRLPGRHHHSISYDSDGCRRMNSSFPMSAELQTLFPRFEKGDVIGIGYRTRSGTIFF 300
           YPYFRLPGRHHHSI+YDS+G RR N SFP+  EL  LFP  E+GD+IG+GYRTRSGT FF
Sbjct: 283 YPYFRLPGRHHHSIAYDSNGARRFNDSFPLDPELANLFPVCERGDIIGVGYRTRSGTFFF 342

Query: 301 THNGKKLNEKKVGGHIKGWKLKYLYPIVGSNIPCKIHVNFGTYGFVYIEANVKKWGYSKN 360
           T NGKK++EK +GGHIKG K+KYLYPIVG+N+PCK+HVNFGTYGFVYIEANVKKWGY+K+
Sbjct: 343 TRNGKKVSEKSIGGHIKGCKIKYLYPIVGTNVPCKVHVNFGTYGFVYIEANVKKWGYAKS 402

Query: 361 AGIKLPPPSYEDYDQDVLLES--AFEDDVS------------------DSESITSDSINE 400
            G+K+PPPSYE+Y +D L+ S    ED ++                  D E   + +  +
Sbjct: 403 HGLKVPPPSYEEYGKDALVGSYQDLEDGINDEEEDYEDEEEEDEEEDYDEEDDNTTTETD 462

Query: 401 QITDQSGNILPPPPGFEFSTSVASDI---PVESITMHSLPAEPPNYSAD 446
            + D+ G +LPPPPGFEFSTS  S+      E I ++SLP +PP YS D
Sbjct: 463 PLRDEYGQLLPPPPGFEFSTSPLSNFGQNEEEDINLNSLPYDPPRYSQD 511

>Sklu_2430.7 YKL124W, Contig c2430 12905-14524
          Length = 539

 Score =  133 bits (334), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 108/352 (30%), Positives = 164/352 (46%), Gaps = 77/352 (21%)

Query: 94  LDDESEVKE-----FLQNLSPKEQFYYKQGEEYVKQNPPLLVPYLPNDPENREEVIPD-P 147
            DDE  V+E     F    S  E   Y++ +E+ K NPP++  +    P   +++I D  
Sbjct: 110 FDDEQAVQEQEDECFKDKFSKFEIELYQRAKEFQKVNPPIVKSFGTYTPLKDKQLIKDRG 169

Query: 148 IVNEQTLQFIEEEGAAAWEFQADPNLPNDTVMIQERTELTFLNFSYDASVMTTLPIPRLN 207
           I +   L  I +    A  F     LP  + +IQ++ ++ F  ++  +S +   P+P   
Sbjct: 170 IQSYYFLPSINDNLDKAGNF-----LP--SFLIQDKLDIEFTKYNKSSSAIMNFPLPYNR 222

Query: 208 K-VYYYECKIFELNQGKNHLSDNEMISIGLSTSPYPYFRLPGRHHHSISYDSDGCRRMNS 266
           K   Y+E K+F     K     N + +IGL T PYPYFR+PG + HSI+Y+S G  R+++
Sbjct: 223 KDAVYFEVKVF-----KYPSKSNSIFTIGLITPPYPYFRMPGYNKHSIAYESTGKLRISN 277

Query: 267 SFPMSAELQTLFPRFEKGDVIGIGYRTRSGTIFFTHNGKK-------------------- 306
            F  +    TL P+ E+GDV+G GYR RSGTIF THNGKK                    
Sbjct: 278 PFYAN----TLLPKLEEGDVVGFGYRFRSGTIFITHNGKKLLDLTENIGVDLFIGLGAMN 333

Query: 307 --------------------LNEKKVGGHIK---------GWKLKYLYPIVGSNIP---C 334
                               L+E+ V   +            +L+ ++     +IP    
Sbjct: 334 ACYTKSYTLEGLLADPDNPGLHEQLVAAQLTPESDTTAAINPQLERVHDYTTEDIPSDEI 393

Query: 335 KIHVNFGTYGFVYIEANVKKWGYSKNAGIKLPPPSY--EDYDQDVLLESAFE 384
           ++ VN G  GFV+IEANVKK+ +    G    PPSY  ++  QD +L+   E
Sbjct: 394 ELQVNLGQLGFVFIEANVKKYVFGSVYGEIGIPPSYNGDEIKQDTVLQKGEE 445

>KLLA0B12760g 1114942..1116570 some similarities with sp|P32343
           Saccharomyces cerevisiae YKL124w SSH4 suppressor of
           SHR3, hypothetical start
          Length = 542

 Score =  121 bits (304), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 81/242 (33%), Positives = 126/242 (52%), Gaps = 41/242 (16%)

Query: 88  LSEDRYLDDES----EVKEFLQNLSPKEQFYYKQGEEYVKQNPPLLVPYLPNDPENREEV 143
           ++  ++ DDES    E KE L  +S  E   Y++ +E+ K +PP++ P            
Sbjct: 103 MTPGKFDDDESLKVREAKE-LPKMSSFEVELYERTKEFQKMSPPMVKPL----------- 150

Query: 144 IPDPIVNEQTLQFIEEEGAAAWEFQADPN---------LPNDTVMIQERTELTFLNFSYD 194
                +N Q  Q I++ G  ++ F    N         LP  +  ++++  ++F  F+  
Sbjct: 151 --GSFLNSQDKQVIKDRGIQSYFFLPSINDNVDINGAFLP--SFFVEDKLNVSFTKFNIS 206

Query: 195 ASVMTTLPIPRLNK-VYYYECKIFELNQGKNHLSDNEMISIGLSTSPYPYFRLPGRHHHS 253
           +S +   P+P   K   Y+E K+++          N + SIGL T PYPYFR+PG   +S
Sbjct: 207 SSAIMNYPLPMNKKDAVYFEVKVYKFKT-----CSNSIFSIGLMTCPYPYFRIPGTAAYS 261

Query: 254 ISYDSDGCRRMNSSFPMSAELQTLFPRFEKGDVIGIGYRTRSGTIFFTHNGKKLNE--KK 311
           I+Y+S G  R+N++F       TL P+ E+GDV+G GYR  SGTIF THNGKK+ +   K
Sbjct: 262 IAYESTGKLRINNAF----GADTLLPKLEEGDVVGFGYRYSSGTIFITHNGKKMMDVTHK 317

Query: 312 VG 313
           VG
Sbjct: 318 VG 319

>CAGL0M06545g 677238..679001 similar to sp|P32343 Saccharomyces
           cerevisiae YKL124w SSH4, hypothetical start
          Length = 587

 Score =  121 bits (303), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 102/346 (29%), Positives = 155/346 (44%), Gaps = 87/346 (25%)

Query: 101 KEFLQNLSPKEQFYYKQGEEYVKQNPPLLVPYLPNDPENREEVIPDPIVNEQTLQFIEEE 160
           +E L  +SP E   Y + +E+   +PP +  +                ++ + LQ I++ 
Sbjct: 123 REALIKMSPFEVDSYMRAKEFQIVSPPAVQEF-------------GTYLDSKDLQMIKDR 169

Query: 161 GAAAWEFQADPN---------LPNDTVMIQERTELTFLNFSYDASVMTTLPIPRLNK-VY 210
           G  ++ F    N         LP  + ++Q++ E+ F  ++  +S +   P+P   K   
Sbjct: 170 GIQSYYFIPSINDNVDKSGHFLP--SFLVQDKLEVEFTRWNKSSSAVLNYPLPYNKKDAV 227

Query: 211 YYECKIFELNQGKNHL-SDNEMISIGLSTSPYPYFRLPGRHHHSISYDSDGCRRMNSSFP 269
           Y+E K++      NH  + N + SIGL T PYPYFR+PG    SI+Y+S G  R+N  F 
Sbjct: 228 YFEVKVY------NHKPNSNSIFSIGLVTVPYPYFRIPGMCKFSIAYESTGKLRINDPFF 281

Query: 270 MSAELQTLFPRFEKGDVIGIGYRTRSGTIFFTHNGKK------------------LNEKK 311
            S    TL P+  +GDV+G GYR ++GTIF THNGKK                  +N   
Sbjct: 282 PS----TLLPKLVEGDVVGFGYRFKTGTIFITHNGKKLMDVTQNVSVELFIALGAMNASY 337

Query: 312 VGGHIK------------------GWKLKYLYPIVGSNIP-------------CKIHVNF 340
              + K                  G +LK    I   + P              ++HVN 
Sbjct: 338 TRTYTKDGLLEDPDNIELRNALAEGRELKLSKDIQNPHNPMDETKWDIIDSDEIELHVNL 397

Query: 341 GTYGFVYIEANVKKWGYSKNAGIKLPPPSY--EDYDQDVLLESAFE 384
           G  GFV+IEANVKK+G+    G    PP+Y   D  +D L++   E
Sbjct: 398 GQTGFVFIEANVKKYGFGSVFGEIGIPPAYNPNDIQKDKLIQKGEE 443

>ABL026W [566] [Homologous to ScYKL124W (SSH4) - SH]
           complement(350985..352427) [1443 bp, 480 aa]
          Length = 480

 Score =  119 bits (299), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 70/195 (35%), Positives = 112/195 (57%), Gaps = 16/195 (8%)

Query: 115 YKQGEEYVKQNPPLLVPYLP-NDPENREEVIPDPIVNEQTLQFIEEEGAAAWEFQADPNL 173
           Y + +E+   NPPL+  +     PE+R+ V    I     L  I +       F     L
Sbjct: 70  YLRAKEFQAMNPPLVKAFGTYMCPEDRQCVRDRGIQAYYLLPSINDNVDRRGNF-----L 124

Query: 174 PNDTVMIQERTELTFLNFSYDASVMTTLPIPRLNK-VYYYECKIFELNQGKNHLSDNEMI 232
           P  + ++Q++  +TF  ++  +S +   P+P   +   Y+E K+++    +N+L+ N + 
Sbjct: 125 P--SFLVQDKLNVTFTKYNKSSSTIMNYPLPHNKRDAVYFEVKVYKF---RNYLASNSIF 179

Query: 233 SIGLSTSPYPYFRLPGRHHHSISYDSDGCRRMNSSFPMSAELQTLFPRFEKGDVIGIGYR 292
           SIGL T PYPYF +PG   +SI+Y+S G  R+N+SF  S    TL P+ ++GDV+G+GYR
Sbjct: 180 SIGLVTCPYPYFVMPGMCQYSIAYESTGKLRINNSFYAS----TLLPKLQEGDVVGLGYR 235

Query: 293 TRSGTIFFTHNGKKL 307
            R+GT+F THNGKK+
Sbjct: 236 YRTGTVFITHNGKKM 250

>YKL124W (SSH4) [3142] chr11 (210239..211978) Protein that confers
           resistance to immunosuppressive drug leflunomide upon
           overproduction [1740 bp, 579 aa]
          Length = 579

 Score =  115 bits (288), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 78/231 (33%), Positives = 120/231 (51%), Gaps = 41/231 (17%)

Query: 90  EDRYLDDESEVKEFLQNLSPKEQFYYKQGEEYVKQNPPLLV---PYLPNDPENREEVIPD 146
           +D  +  E E++E L  +S  E   Y + +E+   +PP++     YL +D +        
Sbjct: 117 DDEIVLQERELEE-LPKMSAYEVELYIRAKEFQMMSPPMVKDFGTYLDSDDQ-------- 167

Query: 147 PIVNEQTLQFIEEEGAAAWEFQADPN---------LPNDTVMIQERTELTFLNFSYDASV 197
                   QFI++ G  ++      N         LP  + ++Q++ ++ F  F+  +S 
Sbjct: 168 --------QFIKDRGIQSYFLLPSINDNIDEYGNFLP--SFIVQDKLDIQFSKFNKSSST 217

Query: 198 MTTLPIPRLNK-VYYYECKIFELNQGKNHLSDNEMISIGLSTSPYPYFRLPGRHHHSISY 256
           +   P+P   K   Y+E KIF   Q       N + SIGL+T PYPYFR+PG   +SI+Y
Sbjct: 218 VMNYPLPHNRKDAVYFEVKIFRHIQ-----KSNSIFSIGLTTVPYPYFRVPGMAKYSIAY 272

Query: 257 DSDGCRRMNSSFPMSAELQTLFPRFEKGDVIGIGYRTRSGTIFFTHNGKKL 307
           +S G  R+N+ F  S    TL P+ E+GD +G GYR ++GTIF THNGKKL
Sbjct: 273 ESTGKLRINNPFTAS----TLLPKLEEGDTVGFGYRYKTGTIFITHNGKKL 319

>Kwal_26.7665
          Length = 551

 Score =  113 bits (282), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 88/292 (30%), Positives = 134/292 (45%), Gaps = 49/292 (16%)

Query: 39  LIVFTMMFMFLSYLLSILVYFVTRW-------------LVKRLFTARIS--LHEEGTMNG 83
           LI  ++ F  L  +L ++  +VT                +  +F  + S  L +   +  
Sbjct: 79  LISLSVTFAILMVMLIVIAVYVTFCGADESEYDEEVASAIPNMFRKKRSGVLLDGSFLTP 138

Query: 84  GQSDLSEDRYLDDESEVKEFLQNLSPKEQFYYKQGEEYVKQNPPLLVPYLPNDPENREEV 143
           GQ D   D +   E E  E L  +S  E   Y++  E+ K  PP +  +           
Sbjct: 139 GQFD---DEHALLEQEAVE-LPRMSRFEVELYQRCREFQKMCPPNVTEF----------- 183

Query: 144 IPDPIVNEQTLQFIEEEGAAAWEFQADPNLPND-------TVMIQERTELTFLNFSYDAS 196
                 +    QFI++ G  ++ F    N   D       + ++Q++ ++ F  F+  AS
Sbjct: 184 --GTYTSASDKQFIKDRGVQSYYFLPSINDNVDHYGNFLPSFIVQDKLDVLFTKFNRSAS 241

Query: 197 VMTTLPIPRLNK-VYYYECKIFELNQGKNHLSDNEMISIGLSTSPYPYFRLPGRHHHSIS 255
            +   P+P+  K   Y+E K+F     K     N + S GL T PYPYFR+PG    SI+
Sbjct: 242 TIMNYPLPQNKKEAVYFEVKVF-----KFPAKSNSIFSCGLVTCPYPYFRIPGMAQFSIA 296

Query: 256 YDSDGCRRMNSSFPMSAELQTLFPRFEKGDVIGIGYRTRSGTIFFTHNGKKL 307
           Y+S G  RMN+ F       TL P+ ++GDVIG GYR ++GTI  THNGKKL
Sbjct: 297 YESTGKLRMNNPF----YANTLLPKLQEGDVIGFGYRYKTGTILITHNGKKL 344

>Scas_721.126
          Length = 573

 Score =  111 bits (278), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 77/228 (33%), Positives = 113/228 (49%), Gaps = 38/228 (16%)

Query: 94  LDDESEVKEF----LQNLSPKEQFYYKQGEEYVKQNPPLLVPYLPNDPENREEVIPDPIV 149
            DDE E +E     L  +SP E   YK+  E+ +  PP +  +                +
Sbjct: 115 FDDECEHQEREHTELNRMSPFELELYKRSNEFQEVAPPHIDEF-------------GTYL 161

Query: 150 NEQTLQFIEEEGAAAWEFQADPN---------LPNDTVMIQERTELTFLNFSYDASVMTT 200
               LQ I++ G  ++      N         LP  + +IQ++ ++ F  ++  +S +  
Sbjct: 162 KATDLQVIKDRGIQSYFLLPSINDNVNKQGNFLP--SFLIQDKLDMVFTKYNKSSSTVMN 219

Query: 201 LPIPRLNK-VYYYECKIFELNQGKNHLSDNEMISIGLSTSPYPYFRLPGRHHHSISYDSD 259
            P+P   +   Y+E K+F     K+    N + SIGL T PYPYFR+PG    SI+Y+S 
Sbjct: 220 YPLPYTKRDAVYFEVKVF-----KHQPVSNTIFSIGLVTVPYPYFRIPGMAKFSIAYEST 274

Query: 260 GCRRMNSSFPMSAELQTLFPRFEKGDVIGIGYRTRSGTIFFTHNGKKL 307
           G  R+N+ F  S    TL P+  +GDV+G GYR  SGTIF THNGKKL
Sbjct: 275 GKLRINNPFMAS----TLLPKLVEGDVVGFGYRYSSGTIFITHNGKKL 318

>AFR242C [3434] [Homologous to ScYGL227W (VID30) - SH]
           (873480..875951) [2472 bp, 823 aa]
          Length = 823

 Score = 34.3 bits (77), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 26/63 (41%), Gaps = 5/63 (7%)

Query: 281 FEKGDVIGIGYRTRSGTIFFTHNGKKLNEKKVGGHIKGWKLKYLYPIVGSNIPCKIHVNF 340
           + + DVIG G     GTIFFT NG  L     G   K      L P V       I  NF
Sbjct: 402 YGRDDVIGCGINYVDGTIFFTKNGIHL-----GTAFKDVAHLDLVPYVSLKPANSIRTNF 456

Query: 341 GTY 343
           G Y
Sbjct: 457 GLY 459

>CAGL0I04114g 360592..363324 similar to sp|P53076 Saccharomyces
           cerevisiae YGL227w VID30, start by similarity
          Length = 910

 Score = 33.1 bits (74), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 53/120 (44%), Gaps = 11/120 (9%)

Query: 281 FEKGDVIGIGYRTRSGTIFFTHNGKKLNEKKVGGHIKGWKLKYLYPIVGSNIPCKIHVNF 340
           + + DVIG G    +G++FFT NG  L E  V   +    + Y+    G++    +  NF
Sbjct: 502 YGRDDVIGCGINYVNGSVFFTKNGVFLGE-AVSSLMNVNAIPYIALKSGNS----VRTNF 556

Query: 341 GTY-GFVY----IEANVKKWGYSKNAGIKLPPPSYEDYDQDVLLESAFE-DDVSDSESIT 394
           G Y  FV+     + N K+  Y       +    + D    ++ ES  E DD +D   ++
Sbjct: 557 GLYEEFVFDINQYQKNWKRVAYKNIFKASITSHQFPDTKNTLIDESQMEIDDDADESQLS 616

>Kwal_47.19173
          Length = 836

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 17/28 (60%)

Query: 280 RFEKGDVIGIGYRTRSGTIFFTHNGKKL 307
           ++ + DVIG G     GTIFFT NG  L
Sbjct: 438 QYGRNDVIGCGVNYVDGTIFFTKNGLHL 465

>Scas_712.23
          Length = 973

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 15/24 (62%)

Query: 281 FEKGDVIGIGYRTRSGTIFFTHNG 304
           F + D+IG G     GTIFFT NG
Sbjct: 580 FGRDDIIGCGINYIDGTIFFTKNG 603

>Sklu_1925.2 YOL072W, Contig c1925 3789-5165
          Length = 458

 Score = 30.4 bits (67), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 46/103 (44%), Gaps = 9/103 (8%)

Query: 203 IPRLNKVYYYECKIFELNQGKNHLSDNEMISIGLSTSPYP------YFRLPGRHHHSISY 256
           + RLN +Y+   KI   +   N   + +  S+    S YP      Y  L GR++     
Sbjct: 184 VNRLNNIYF---KIDSASSCSNIFKNTKHKSMVERFSEYPAREQVEYRYLLGRYYLLNHR 240

Query: 257 DSDGCRRMNSSFPMSAELQTLFPRFEKGDVIGIGYRTRSGTIF 299
            SD   ++NS+F M A   T+ P+ ++     + Y   +G +F
Sbjct: 241 ISDSFHQLNSAFQMLAGQTTVSPQLQRNMYRVLKYLLPTGILF 283

>CAGL0J11726g 1140123..1141133 similar to sp|P50105 Saccharomyces
           cerevisiae YMR005w MPT1 required for protein synthesis,
           hypothetical start
          Length = 336

 Score = 30.4 bits (67), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 25/42 (59%), Gaps = 2/42 (4%)

Query: 375 QDVLLESAFEDDVSDSESITSDSINEQITDQSGNILPPPPGF 416
           QDVL+ +    D+ + E++ S ++N   T Q+  ++PP P F
Sbjct: 95  QDVLISAGV--DLKEEEALLSSTVNVSKTQQNAVVIPPHPPF 134

>YGL227W (VID30) [1771] chr7 (69670..72546) Protein that regulates
           expression of genes that are involved in nitrogen
           metabolism [2877 bp, 958 aa]
          Length = 958

 Score = 30.4 bits (67), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 15/24 (62%)

Query: 281 FEKGDVIGIGYRTRSGTIFFTHNG 304
           F + DVIG G     G+IFFT NG
Sbjct: 533 FGRDDVIGCGINFIDGSIFFTKNG 556

>CAGL0M11858g 1177287..1178000 weakly similar to sp|P38989
           Saccharomyces cerevisiae YFR031c SMC2 chromosome
           segregation protein, hypothetical start
          Length = 237

 Score = 30.0 bits (66), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 22/28 (78%), Gaps = 2/28 (7%)

Query: 88  LSE-DRYLDDESEVKEFLQNL-SPKEQF 113
           LSE DRY ++ES +KE LQNL S KE+F
Sbjct: 63  LSELDRYKEEESRMKEALQNLNSTKEEF 90

>KLLA0A01221g 113308..115926 similar to sp|P53076 Saccharomyces
           cerevisiae YGL227w VID30 singleton, start by similarity
          Length = 872

 Score = 28.9 bits (63), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 52/126 (41%), Gaps = 17/126 (13%)

Query: 281 FEKGDVIGIGYRTRSGTIFFTHNGKKLNEKKVGGHIKGWKLKYLYPIVGSNIPCKIHVNF 340
           F   D++G G     G+IFFT NG  L     G   +      L P V       +  NF
Sbjct: 457 FGNDDIVGCGVNFIEGSIFFTKNGIFL-----GNAFEDCFDIDLVPFVSIKSGNSLRTNF 511

Query: 341 G-TYGFVY-IEANVKKWGYSKNAGIKLPPPSYEDYDQDVLLESAFEDDVSDSESI--TSD 396
           G T  F++ I+    +W Y   + I        DYD  + L S    D SD+E +    D
Sbjct: 512 GLTEEFLFDIDQYQLQWKYKTYSHIFKAV----DYDSGLNLVS----DESDNEDLGKLGD 563

Query: 397 SINEQI 402
            IN+ +
Sbjct: 564 EINDTL 569

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.135    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 17,184,068
Number of extensions: 819250
Number of successful extensions: 3146
Number of sequences better than 10.0: 49
Number of HSP's gapped: 3159
Number of HSP's successfully gapped: 56
Length of query: 459
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 354
Effective length of database: 12,961,219
Effective search space: 4588271526
Effective search space used: 4588271526
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 63 (28.9 bits)