Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0D10043g48848023840.0
Sklu_2101.449151910861e-144
AFL202C48149110581e-140
Kwal_23.349446641910281e-136
CAGL0L07436g5153558591e-110
Scas_613.114934118281e-105
YDL106C (PHO2)5593458121e-102
KLLA0B01584g464691477e-10
CAGL0G07249g345801262e-07
Kwal_47.18450370751262e-07
YML027W (YOX1)385891244e-07
ADL394C102611065e-06
Sklu_797.1386601147e-06
AFR643C102611057e-06
AER456W5752991e-05
Kwal_33.129919150976e-05
YDR451C (YHP1)353461049e-05
Scas_641.124131191031e-04
AER314W431601022e-04
KLLA0C03135g22858957e-04
KLLA0B14553g22858957e-04
Scas_720.112349760.084
CAGL0A03014g501111740.45
Kwal_33.1299511046680.76
YCR097W (HMRA1)12655671.3
ABR013W142473658.0
Kwal_56.2358370085649.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D10043g
         (480 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D10043g 849549..851015 some similarities with sp|P07269 Sac...   922   0.0  
Sklu_2101.4 YDL106C, Contig c2101 7279-8754 reverse complement        422   e-144
AFL202C [2993] [Homologous to ScYDL106C (PHO2) - SH] (56150..575...   412   e-140
Kwal_23.3494                                                          400   e-136
CAGL0L07436g 818510..820057 similar to sp|P07269 Saccharomyces c...   335   e-110
Scas_613.11                                                           323   e-105
YDL106C (PHO2) [763] chr4 complement(270222..271901) Homeodomain...   317   e-102
KLLA0B01584g complement(125027..126421) weakly similar to sp|P34...    61   7e-10
CAGL0G07249g complement(688189..689226) similar to sp|P34161 Sac...    53   2e-07
Kwal_47.18450                                                          53   2e-07
YML027W (YOX1) [3938] chr13 (221406..222563) Protein involved in...    52   4e-07
ADL394C [1347] [Homologous to ScYCR097W (HMRA1) - NSH] (18058..1...    45   5e-06
Sklu_797.1 YML027W, Contig c797 554-1714 reverse complement            49   7e-06
AFR643C [3835] [Homologous to ScYCR097W (HMRA1) - SH] (1607899.....    45   7e-06
AER456W [2956] [Homologous to ScYCR097W (HMRA1) - NSH] complemen...    43   1e-05
Kwal_33.12991                                                          42   6e-05
YDR451C (YHP1) [1270] chr4 complement(1361108..1362169) Protein ...    45   9e-05
Scas_641.12                                                            44   1e-04
AER314W [2815] [Homologous to ScYML027W (YOX1) - SH; ScYDR451C (...    44   2e-04
KLLA0C03135g complement(279869..280555) gi|10643642|gb|AAG21094....    41   7e-04
KLLA0B14553g complement(1278622..1279308) sp|Q9HG12 Kluyveromyce...    41   7e-04
Scas_720.1                                                             34   0.084
CAGL0A03014g 305631..307136 similar to sp|P48360 Saccharomyces c...    33   0.45 
Kwal_33.12995                                                          31   0.76 
YCR097W (HMRA1) [619] chr3 (293831..293935,293990..294235,294288...    30   1.3  
ABR013W [604] [Homologous to ScYKL010C (UFD4) - SH] complement(4...    30   8.0  
Kwal_56.23583                                                          29   9.6  

>KLLA0D10043g 849549..851015 some similarities with sp|P07269
           Saccharomyces cerevisiae YDL106c GRF10 homeodomain
           protein singleton, hypothetical start
          Length = 488

 Score =  922 bits (2384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/480 (96%), Positives = 461/480 (96%)

Query: 1   MDNFDYNQPDFPHFQPEFDPSNTFLGDQEQLQDKRISSGESGYGNQSGTLMNASDGVEMF 60
           MDNFDYNQPDFPHFQPEFDPSNTFLGDQEQLQDKRISSGESGYGNQSGTLMNASDGVEMF
Sbjct: 1   MDNFDYNQPDFPHFQPEFDPSNTFLGDQEQLQDKRISSGESGYGNQSGTLMNASDGVEMF 60

Query: 61  QGIPSTLANEHNTQVEXXXXXXXXXXXXXXXXXXXKPKSKRTRATGEALEILKREFQLNP 120
           QGIPSTLANEHNTQVE                   KPKSKRTRATGEALEILKREFQLNP
Sbjct: 61  QGIPSTLANEHNTQVEHDDDHDSNHETHHSSSSSSKPKSKRTRATGEALEILKREFQLNP 120

Query: 121 SPNAQNRKRISEMTGLPEKNVRIWFQNRRSKYRKSDKRMNGPGATDNTTLVSSFEFDKIP 180
           SPNAQNRKRISEMTGLPEKNVRIWFQNRRSKYRKSDKRMNGPGATDNTTLVSSFEFDKIP
Sbjct: 121 SPNAQNRKRISEMTGLPEKNVRIWFQNRRSKYRKSDKRMNGPGATDNTTLVSSFEFDKIP 180

Query: 181 LAINSSYYFIDISSLTVGSWKRLKSGNLRSDSLPQIQKLSNLSPISINTIMANATDLMVL 240
           LAINSSYYFIDISSLTVGSWKRLKSGNLRSDSLPQIQKLSNLSPISINTIMANATDLMVL
Sbjct: 181 LAINSSYYFIDISSLTVGSWKRLKSGNLRSDSLPQIQKLSNLSPISINTIMANATDLMVL 240

Query: 241 ISKKNFEINYFFSAIANNTKILFRIFFPINTVVNCSLSLDNTESLKGDAKNSNSPSSLDG 300
           ISKKNFEINYFFSAIANNTKILFRIFFPINTVVNCSLSLDNTESLKGDAKNSNSPSSLDG
Sbjct: 241 ISKKNFEINYFFSAIANNTKILFRIFFPINTVVNCSLSLDNTESLKGDAKNSNSPSSLDG 300

Query: 301 NNDTNSSKLAELRLSLSKSPKFAVYFSETIDDASSNQWSICEDFSEGRQVNDAFIGGSNI 360
           NNDTNSSKLAELRLSLSKSPKFAVYFSETIDDASSNQWSICEDFSEGRQVNDAFIGGSNI
Sbjct: 301 NNDTNSSKLAELRLSLSKSPKFAVYFSETIDDASSNQWSICEDFSEGRQVNDAFIGGSNI 360

Query: 361 PHVLTGLDESLKFMNSLILDMNSTEHFPPTTQLQHGIMHSMPPTDTQSTALRFNDDPNLI 420
           PHVLTGLDESLKFMNSLILDMNSTEHFPPTTQLQHGIMHSMPPTDTQSTALRFNDDPNLI
Sbjct: 361 PHVLTGLDESLKFMNSLILDMNSTEHFPPTTQLQHGIMHSMPPTDTQSTALRFNDDPNLI 420

Query: 421 AHDTSANPSHNSQSSFLTTNDNFTSMTFDNFSSNIPKTPDFLNSTNLQEGQSMSTLLFQD 480
           AHDTSANPSHNSQSSFLTTNDNFTSMTFDNFSSNIPKTPDFLNSTNLQEGQSMSTLLFQD
Sbjct: 421 AHDTSANPSHNSQSSFLTTNDNFTSMTFDNFSSNIPKTPDFLNSTNLQEGQSMSTLLFQD 480

>Sklu_2101.4 YDL106C, Contig c2101 7279-8754 reverse complement
          Length = 491

 Score =  422 bits (1086), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 259/519 (49%), Positives = 322/519 (62%), Gaps = 88/519 (16%)

Query: 1   MDNFDYNQPDF-PHFQPEFDPSNTFLG-----------DQEQLQDKRISSGESGYGNQ-S 47
           M+NF+Y+  DF  HF  +F P   F+G           D +       +S  S Y +Q S
Sbjct: 1   MENFEYDSNDFTSHFNNDFTPPQEFIGSAPDTNSTANSDDQTTGTTSATSFSSNYNDQKS 60

Query: 48  GTLMNASDGVEMFQGIPSTLANEHNTQVEXXXXXXXXXXXXXXXXXXXKPKSKRTRATGE 107
             L   +DG                                       KPK+KRTRATGE
Sbjct: 61  AHLQQGNDG---------------------------------------KPKTKRTRATGE 81

Query: 108 ALEILKREFQLNPSPNAQNRKRISEMTGLPEKNVRIWFQNRRSKYRKSDKRMNGPGATDN 167
           AL ILKREF +NP+PNAQNRKRIS+MT LPEKNVRIWFQNRR+K+RKS ++   P A D 
Sbjct: 82  ALAILKREFDVNPNPNAQNRKRISDMTNLPEKNVRIWFQNRRAKFRKSGRQNPRPSALDM 141

Query: 168 TTLVS---SFEFDKIPLAINSSYYFIDISSLTVGSWKRLKSGNLRSDSLPQIQKLSNLSP 224
             + S   + +FD+IPL IN++YYF+D+SSLTVGSWKRLKSGNL  +SLP I+ LSNLSP
Sbjct: 142 NGIGSLSLTVDFDRIPLNINNNYYFLDVSSLTVGSWKRLKSGNLDKESLPNIKDLSNLSP 201

Query: 225 ISINTIMANATDLMVLISKKNFEINYFFSAIANNTKILFRIFFPINTVVNCSLSLDNTES 284
           ISIN IM+N+TDLMVLISKKNFEINYFFSAIANNTKILFRIFFPIN+VVNCSLS +  +S
Sbjct: 202 ISINDIMSNSTDLMVLISKKNFEINYFFSAIANNTKILFRIFFPINSVVNCSLSFE-ADS 260

Query: 285 LKGDAKNSNSPSSLDGNNDTNSSKLAELRLSLSKSPKFAVYFSETIDDASSNQWSICEDF 344
           ++ + ++       D  +   S K  EL+L++SKSPKFAVYFS+ ++  +SNQWSICEDF
Sbjct: 261 IRKENEDQ------DEQDQDPSEKTCELKLTVSKSPKFAVYFSDAVEHFTSNQWSICEDF 314

Query: 345 SEGRQVNDAFIGGSNIPHVLTGLDESLKFMNSLILDMNSTEHF--PPTTQLQHGI-MHSM 401
           SEGRQV+DAF+GGSN+PHVL GL++SLKFMNSLILD NST     PPT    H +   SM
Sbjct: 315 SEGRQVSDAFVGGSNLPHVLNGLEDSLKFMNSLILDYNSTNQIIPPPTVTQPHAVSQQSM 374

Query: 402 ----PPTDTQSTALRFNDD---PNLI------AHD---TSANPSHNSQSSFLTTNDNFTS 445
                P   +    +F DD    N I       HD   T    S NS  S   T+DN T 
Sbjct: 375 ILQPEPRPAEQGQQQFFDDFDAQNAILGLPHQEHDQLTTQQFVSPNSAQSHHFTDDNNTV 434

Query: 446 MTFD-----NFSSNIPKTPDFLNSTNL--QEGQSMSTLL 477
              +     N  + IP TP+FL++T+L  ++   +S LL
Sbjct: 435 SQANLLPNLNQEAQIPNTPEFLSTTDLTSEDHNGISDLL 473

>AFL202C [2993] [Homologous to ScYDL106C (PHO2) - SH] (56150..57595)
           [1446 bp, 481 aa]
          Length = 481

 Score =  412 bits (1058), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 247/491 (50%), Positives = 297/491 (60%), Gaps = 70/491 (14%)

Query: 1   MDNFDYNQPDFPHFQPEFDPSNTFL--GDQEQLQDKRISSGESGYGNQSGTLMNASDGVE 58
           MDNF+Y   +F  F  EF      L  G  E   D   ++G S      G L  A+DG  
Sbjct: 1   MDNFEYPGGEFGRFNQEFGSPEEMLNNGHGELRSDNGEATGNSKSPGH-GELAEAADG-- 57

Query: 59  MFQGIPSTLANEHNTQVEXXXXXXXXXXXXXXXXXXXKPKSKRTRATGEALEILKREFQL 118
                                                KPKSKRTRATGEALE+LK+EF +
Sbjct: 58  ------------------------------------GKPKSKRTRATGEALELLKKEFDI 81

Query: 119 NPSPNAQNRKRISEMTGLPEKNVRIWFQNRRSKYRKSDKRMNG-PGATDNTTLVS---SF 174
           NP+PNAQNRKRISE TGLPEKNVRIWFQNRR+KYRKSD+  N    ATD  T  S   + 
Sbjct: 82  NPNPNAQNRKRISEQTGLPEKNVRIWFQNRRAKYRKSDRTFNQRTAATDMNTFGSISVTV 141

Query: 175 EFDKIPLAINSSYYFIDISSLTVGSWKRLKSGNLRSDSLPQIQKLSNLSPISINTIMANA 234
           E+DKIPL IN +YYFID +SLTVGSWKRLKSGNL  +SL  I+ LSNLSP SIN IM+NA
Sbjct: 142 EYDKIPLNINDNYYFIDANSLTVGSWKRLKSGNLHRESLSNIKYLSNLSPTSINMIMSNA 201

Query: 235 TDLMVLISKKNFEINYFFSAIANNTKILFRIFFPINTVVNCSLSLDNTESLKGDAKNSNS 294
           TDLMVLISKKNFE+NYFFSAIANNTKILFRIFFPIN+V+NCSL L + E  K D  ++N 
Sbjct: 202 TDLMVLISKKNFEVNYFFSAIANNTKILFRIFFPINSVLNCSLLL-HAEGGKKDEDDAN- 259

Query: 295 PSSLDGNNDTNSSKLAELRLSLSKSPKFAVYFSETIDDASSNQWSICEDFSEGRQVNDAF 354
            + +       + ++ EL+L++SK P FAVYFS+  D+ +SNQWSICEDFSEGRQV+DA+
Sbjct: 260 -NVVQETTAPAAEQVCELKLNVSKPPNFAVYFSDMNDELTSNQWSICEDFSEGRQVSDAY 318

Query: 355 IGGSNIPHVLTGLDESLKFMNSLILDMNSTEHFPPTTQLQHGIMHSMPPTDTQSTALRFN 414
           +GGSN PHVLTGL+ SLKFM+SLILD NST H  P  Q Q         +   + A+   
Sbjct: 319 VGGSNFPHVLTGLEASLKFMSSLILDYNSTTHVVPHAQPQPHPHSHPHHSSDPAQAIVLQ 378

Query: 415 DDPNLIAHDT-SANPSHNSQSSFL------------TTNDNFTS---------MTFDNFS 452
            +P+ +A      N   +S    L            T N  F S         +T     
Sbjct: 379 PEPHSLAQSAFFRNYGPHSTDDILDIQDPDQYETAQTANTEFPSTSTAAGSHFLTAHLAD 438

Query: 453 SNIPKTPDFLN 463
           + IPKTP+FLN
Sbjct: 439 TQIPKTPEFLN 449

>Kwal_23.3494
          Length = 466

 Score =  400 bits (1028), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 228/419 (54%), Positives = 272/419 (64%), Gaps = 52/419 (12%)

Query: 96  KPKSKRTRATGEALEILKREFQLNPSPNAQNRKRISEMTGLPEKNVRIWFQNRRSKYRKS 155
           +P++KRTRATGEAL +LKREF  NP+PNAQNRKRISE+TGLPEKNVRIWFQNRR+K+RKS
Sbjct: 52  RPRTKRTRATGEALNVLKREFDQNPNPNAQNRKRISELTGLPEKNVRIWFQNRRAKHRKS 111

Query: 156 DKRMNGPGATDN-----TTLVSSFEFDKIPLAINSSYYFIDISSLTVGSWKRLKSGNLRS 210
           D+      AT +     T  + + +FD+IPL  NS+Y FID+ SLTVGSWKRLKSGNL+ 
Sbjct: 112 DRGGTRGSATTDVAGEPTGAIPALDFDRIPLDSNSNYCFIDVKSLTVGSWKRLKSGNLKQ 171

Query: 211 DSLPQIQKLSNLSPISINTIMANATDLMVLISKKNFEINYFFSAIANNTKILFRIFFPIN 270
           D LP +Q+LSNLSP+SIN IMANATDLMVLISKKN EINYFFSAIANNTKILFRIFFPI 
Sbjct: 172 DDLPTVQRLSNLSPVSINEIMANATDLMVLISKKNHEINYFFSAIANNTKILFRIFFPIT 231

Query: 271 TVVNCSLSL--DNTESLKGDAKNSNSPSSLDGNNDTNSSKLAELRLSLSKSPKFAVYFSE 328
           T V+C+LS   D  ES++ DA N                KL ELRL+LSK+P FAVYFS+
Sbjct: 232 TTVDCALSATTDGAESVRSDAHN----------------KLCELRLNLSKAPTFAVYFSD 275

Query: 329 TIDDASSNQWSICEDFSEGRQVNDAFIGGSNIPHVLTGLDESLKFMNSLILDMNSTEH-F 387
             D  SSNQWSICEDFSE RQV++AFIGG NIPH+LTGL+ SL FM S I D NS  H  
Sbjct: 276 GADQFSSNQWSICEDFSEERQVSEAFIGGLNIPHILTGLESSLSFMCSSIQDHNSGAHVL 335

Query: 388 PPTTQLQ--------HGIMHSMPPTDTQSTALRFNDDPNLIAHDTSANPSHNSQSSFLTT 439
              + L+        H I+ +  P    +    F DD N    D  A   HN+   F  +
Sbjct: 336 SHKSHLRDSVGAPEAHNIVINPEPHALGTRQQPFFDDFN-DHQDIYAIGEHNT-PQFAAS 393

Query: 440 NDNFTSMTFDNFS---------------SNIPKTPDFLNS---TNLQEGQSMSTLLFQD 480
           N    S +F   S               S +PKTPDFL S     ++E   ++ LL  D
Sbjct: 394 NTTTQSHSFSQHSPEPSGNEHTSPQYSESGVPKTPDFLRSHAEMGVEEQSGLNNLLIFD 452

>CAGL0L07436g 818510..820057 similar to sp|P07269 Saccharomyces
           cerevisiae YDL106c GRF10 homeodomain protein,
           hypothetical start
          Length = 515

 Score =  335 bits (859), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 183/355 (51%), Positives = 232/355 (65%), Gaps = 68/355 (19%)

Query: 98  KSKRTRATGEALEILKREFQLNPSPNAQNRKRISEMTGLPEKNVRIWFQNRRSKYRKSDK 157
           KSKRTRA GE+L+ILK  FQLNP+P+ Q R RISE+TG+PEKNVRIWFQNRR+K RK  K
Sbjct: 6   KSKRTRAKGESLDILKSSFQLNPNPSLQERNRISELTGMPEKNVRIWFQNRRAKVRKKGK 65

Query: 158 RMNG--PGATDNTTLVSSFE---------------------------------------- 175
            ++G  P   D  + V S                                          
Sbjct: 66  -LDGDKPKLHDGESRVVSGTGAGAGTATAGPGAGAGVTRTQGTATRTTATTDVTTVDTSG 124

Query: 176 ---FDKIPLAINSSYYFIDISSLTVGSWKRLKSGNLRSDSLPQIQKLSNLSPISINTIMA 232
              FDK+PL IN++YYFID+ S+TVGSW R+KSG+L ++SLP ++ L NLSP+S+N +M+
Sbjct: 125 PPYFDKLPLNINNNYYFIDVFSITVGSWNRMKSGSLTANSLPVVKDLPNLSPVSMNQLMS 184

Query: 233 NATDLMVLISKKNFEINYFFSAIANNTKILFRIFFPINTVVNCSLSLDNTESLKGDAKNS 292
           +ATDLMV+ISKKNFEINYFFSA+ANNTKILFRIFF INTV +CSLS D T+         
Sbjct: 185 DATDLMVVISKKNFEINYFFSAMANNTKILFRIFFRINTVASCSLSFDKTDE-------- 236

Query: 293 NSPSSLDGNNDTN-SSKLAELRLSLSKSPKFAVYFSETIDDASSNQWSICEDFSEGRQVN 351
                 + NN T+ ++K AEL+L ++K PKFAVYF    ++ ++NQW +CEDFSEG+QVN
Sbjct: 237 ------EINNRTDPANKQAELKLKVNKPPKFAVYFLNQPENNNTNQWCLCEDFSEGKQVN 290

Query: 352 DAFIGGSNIPHVLTGLDESLKFMNSLILDMNSTEHF-------PPTTQLQHGIMH 399
           DAF+GGSN+PHVL GL+ SLK +NSLILD  ST          PP T +   I+H
Sbjct: 291 DAFVGGSNVPHVLKGLESSLKILNSLILDYISTNDTITSAPLPPPPTNVGSDILH 345

>Scas_613.11
          Length = 493

 Score =  323 bits (828), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 198/411 (48%), Positives = 264/411 (64%), Gaps = 61/411 (14%)

Query: 97  PKSKRTRATGEALEILKREFQLNPSPNAQNRKRISEMTGLPEKNVRIWFQNRRSKYRK-- 154
           PKS+R RA GE L ILK  F+LNP+P+ + RK+IS + G+PEK+VRIWFQNRR+K +K  
Sbjct: 93  PKSRRKRAKGEELNILKSHFELNPNPSNEERKKISNLVGMPEKSVRIWFQNRRAKVKKHN 152

Query: 155 ------------SDKRMNGPGATDNTTLVSSFEFDKIPLAINSSYYFIDISSLTVGSWKR 202
                       +D+  N   + +  +  + F FD+IP+ IN +Y FID+ S+TVGSW R
Sbjct: 153 NLKNRNNANMDSNDEDFNDETSPNTDSNNAKF-FDRIPVRINKNYNFIDVCSITVGSWNR 211

Query: 203 LKSGNLRSDSLPQIQKLSNLSPISINTIMANATDLMVLISKKNFEINYFFSAIANNTKIL 262
            K G+L  + LP ++KLSNLSP+S+N IM+N+TDL+VL SKKN EINYFFSA+AN+TKIL
Sbjct: 212 KKYGSLLPEDLPIVEKLSNLSPVSMNNIMSNSTDLIVLTSKKNDEINYFFSAMANDTKIL 271

Query: 263 FRIFFPINTVVNCSLSLDNTESLKGDAKNSNSPSSLDGNNDTNSS----KLAELRLSLSK 318
           FRIFFPI++V NCSLSL+  + +            +  NN TNSS    +L EL+L L+K
Sbjct: 272 FRIFFPISSVKNCSLSLETDDDI------------ITNNNVTNSSDTSERLGELKLILTK 319

Query: 319 SPKFAVYF-----SETIDDASSNQWSICEDFSEGRQVNDAFIGGSNIPHVLTGLDESLKF 373
            P FAVYF     +ET+   S NQWSICEDFSEG+QV DAFIGGSN+PHVL+GL +SLKF
Sbjct: 320 PPTFAVYFIKSDENETV--PSINQWSICEDFSEGKQVTDAFIGGSNLPHVLSGLQDSLKF 377

Query: 374 MNSLILDMNST-EHFPPTT------QLQ-HGIMHSMPPTDTQSTALRFNDD--PNLIAHD 423
           +NS IL+  ST E  PP+T      QLQ H +   M P    S++   ND   PN+I+  
Sbjct: 378 LNSHILEYKSTNEILPPSTITVPSHQLQSHDL---MTPMQYSSSSTGTNDSLLPNIISP- 433

Query: 424 TSANPSHNSQSSFLTTNDNFTSMTFDNFSSNIPKTPDFLNSTNLQEGQSMS 474
               P+ N+  S L  + N  S   +N      +T + L ++N Q+ Q+ S
Sbjct: 434 ----PNTNTLFSLLMPDQNSDSNLLNNH-----ETDNLLPNSNSQQHQNES 475

>YDL106C (PHO2) [763] chr4 complement(270222..271901) Homeodomain
           protein required for expression of phosphate pathway and
           other genes [1680 bp, 559 aa]
          Length = 559

 Score =  317 bits (812), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 177/345 (51%), Positives = 223/345 (64%), Gaps = 56/345 (16%)

Query: 98  KSKRTRATGEALEILKREFQLNPSPNAQNRKRISEMTGLPEKNVRIWFQNRRSKYRKSDK 157
           + KRTRA GEAL++LKR+F++NP+P+   RK+IS++ G+PEKNVRIWFQNRR+K RK   
Sbjct: 78  RPKRTRAKGEALDVLKRKFEINPTPSLVERKKISDLIGMPEKNVRIWFQNRRAKLRKKQH 137

Query: 158 RMNGP----------------GATDN-----TTLVSSFE------FDKIPLAINSSYYFI 190
             N                  G+TDN     T+  S F       FD+IPL  N++YYF 
Sbjct: 138 GSNKDTIPSSQSRDIANDYDRGSTDNNLVTTTSTSSIFHDEDLTFFDRIPLNSNNNYYFF 197

Query: 191 DISSLTVGSWKRLKSGNLRSDSLPQIQKLSNLSPISINTIMANATDLMVLISKKNFEINY 250
           DI S+TVGSW R+KSG L+  +   I++L NLSPI IN IM+NATDLMVLISKKN EINY
Sbjct: 198 DICSITVGSWNRMKSGALQRRNFQSIKELRNLSPIKINNIMSNATDLMVLISKKNSEINY 257

Query: 251 FFSAIANNTKILFRIFFPINTVVNCSLSLDNTESLKGDAKNSNSPSSLDGNNDTNSS--- 307
           FFSA+ANNTKILFRIFFP+++V NCSL+L+  +    D  NSN+ S  + +N  N     
Sbjct: 258 FFSAMANNTKILFRIFFPLSSVTNCSLTLETDD----DIINSNNTSDKNNSNTNNDDDND 313

Query: 308 -------------------KLAELRLSLSKSPKFAVYFSETIDDAS---SNQWSICEDFS 345
                                 EL+L++++SP FAVYF     D     +NQWSIC+DFS
Sbjct: 314 DNSNEDNDNSSEDKRNAKDNFGELKLTVTRSPTFAVYFLNNAPDEDPNLNNQWSICDDFS 373

Query: 346 EGRQVNDAFIGGSNIPHVLTGLDESLKFMNSLILDMNSTEHFPPT 390
           EGRQVNDAF+GGSNIPH L GL +SL+FMNSLILD  S+    PT
Sbjct: 374 EGRQVNDAFVGGSNIPHTLKGLQKSLRFMNSLILDYKSSNEILPT 418

>KLLA0B01584g complement(125027..126421) weakly similar to sp|P34161
           Saccharomyces cerevisiae YML027w YOX1 homoeodomain
           protein, start by similarity
          Length = 464

 Score = 61.2 bits (147), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 44/69 (63%), Gaps = 4/69 (5%)

Query: 98  KSKRTRATGEALEILKREFQLNPSPNAQNRKRISEMTGLPEKNVRIWFQNRRSKYRKS-- 155
           + KR R +    +ILK+EF++NP+P+ + R  +S +  + EK V++WFQNRR  +RK   
Sbjct: 210 RRKRRRTSKNESDILKKEFEVNPAPSKERRSELSIICNMSEKAVQVWFQNRRQNFRKKFK 269

Query: 156 --DKRMNGP 162
              K++N P
Sbjct: 270 VDSKQINSP 278

>CAGL0G07249g complement(688189..689226) similar to sp|P34161
           Saccharomyces cerevisiae YML027w YOX1 homoeodomain
           protein, start by similarity
          Length = 345

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 47/80 (58%), Gaps = 4/80 (5%)

Query: 98  KSKRTRATGEALEILKREFQLNPSPNAQNRKRISEMTGLPEKNVRIWFQNRRSKYRK--- 154
           + KR R + + L IL+ EFQ   +P+ Q R  +++   + EK V++WFQN+R   ++   
Sbjct: 155 RRKRRRTSSQELNILQAEFQRCSTPDKQTRINLAQRCNMTEKAVQVWFQNKRQAMKRHKV 214

Query: 155 -SDKRMNGPGATDNTTLVSS 173
            +D R    G+T +TT ++S
Sbjct: 215 IADNRSRSNGSTTSTTPLAS 234

>Kwal_47.18450
          Length = 370

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 42/75 (56%), Gaps = 6/75 (8%)

Query: 98  KSKRTRATGEALEILKREFQLNPSPNAQNRKRISEMTGLPEKNVRIWFQNRRSKYRKSDK 157
           + KR R +   L IL+ EF+L P+P+   R  +SE   + EK ++IWFQN+R   ++  K
Sbjct: 160 RRKRRRTSKHELNILQSEFELCPTPDKFKRIELSERCCMSEKAIQIWFQNKRQSVKRQQK 219

Query: 158 RMNGPGATDNTTLVS 172
                 A  +TTL S
Sbjct: 220 ------AVTDTTLPS 228

>YML027W (YOX1) [3938] chr13 (221406..222563) Protein involved in
           transcriptional derepression during the M/G1 phase of
           the cell cycle along with Yhp1p, contains homeodomain
           [1158 bp, 385 aa]
          Length = 385

 Score = 52.4 bits (124), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 52/89 (58%), Gaps = 5/89 (5%)

Query: 98  KSKRTRATGEALEILKREFQLNPSPNAQNRKRISEMTGLPEKNVRIWFQNRRSKYRKSDK 157
           + KR R + + L IL+ EF+  P+P+ + R  ++E   + EK V+IWFQN+R   ++  +
Sbjct: 177 RRKRRRTSSQELSILQAEFEKCPAPSKEKRIELAESCHMTEKAVQIWFQNKRQAVKR--Q 234

Query: 158 RMNGPGATDNTTLVSSFEFDKIPLAINSS 186
           R+     + +TT++ +      PL ++++
Sbjct: 235 RI---ATSKSTTIIQTVSPPSPPLDVHAT 260

>ADL394C [1347] [Homologous to ScYCR097W (HMRA1) - NSH]
           (18058..18366) [309 bp, 102 aa]
          Length = 102

 Score = 45.4 bits (106), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 32/61 (52%)

Query: 98  KSKRTRATGEALEILKREFQLNPSPNAQNRKRISEMTGLPEKNVRIWFQNRRSKYRKSDK 157
           + +RT    E  E L+  F+    PNA+ R+ I+E  GL    +RIWF N+R + +    
Sbjct: 41  QRRRTVLPKEPKEFLESVFERKRCPNAKERRAIAEKCGLTPIQIRIWFTNKRMRSKTRGA 100

Query: 158 R 158
           R
Sbjct: 101 R 101

>Sklu_797.1 YML027W, Contig c797 554-1714 reverse complement
          Length = 386

 Score = 48.5 bits (114), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 35/60 (58%)

Query: 98  KSKRTRATGEALEILKREFQLNPSPNAQNRKRISEMTGLPEKNVRIWFQNRRSKYRKSDK 157
           + KR R +   L IL+ EF+   +P+ Q R  +++   + EK V+IWFQN+R   +K  +
Sbjct: 170 RRKRRRTSKNELNILQAEFEACSTPDKQKRIELAQRCSMSEKAVQIWFQNKRQSVKKHKR 229

>AFR643C [3835] [Homologous to ScYCR097W (HMRA1) - SH]
           (1607899..1608207) [309 bp, 102 aa]
          Length = 102

 Score = 45.1 bits (105), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 32/61 (52%)

Query: 98  KSKRTRATGEALEILKREFQLNPSPNAQNRKRISEMTGLPEKNVRIWFQNRRSKYRKSDK 157
           + +RT    E  E L+  F+    PNA+ R+ I+E  GL    +RIWF N+R + +    
Sbjct: 41  QRRRTVLPKETKEFLESVFERKRWPNAKERRAIAEKCGLTPIQIRIWFTNKRMRSKTRGA 100

Query: 158 R 158
           R
Sbjct: 101 R 101

>AER456W [2956] [Homologous to ScYCR097W (HMRA1) - NSH]
           complement(1512285..1512285,1512359..1512531) [174 bp,
           57 aa]
          Length = 57

 Score = 42.7 bits (99), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 19/52 (36%), Positives = 28/52 (53%)

Query: 107 EALEILKREFQLNPSPNAQNRKRISEMTGLPEKNVRIWFQNRRSKYRKSDKR 158
           E  E L+  F+    PNA+ R+ I+E  GL    +RIWF N+R + +    R
Sbjct: 5   ETKEFLESVFERKRCPNAKERRAIAEKCGLTPIQIRIWFTNKRMRSKTRGAR 56

>Kwal_33.12991
          Length = 91

 Score = 42.0 bits (97), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 19/50 (38%), Positives = 29/50 (58%)

Query: 100 KRTRATGEALEILKREFQLNPSPNAQNRKRISEMTGLPEKNVRIWFQNRR 149
           +RT  + +    L+  F+   SPN++ RK I++  GL    VR+WF NRR
Sbjct: 40  RRTLFSKDTRLFLESVFEKKKSPNSRERKAIADKCGLTPVQVRVWFTNRR 89

>YDR451C (YHP1) [1270] chr4 complement(1361108..1362169) Protein
           involved in transcriptional derepression during the M/G1
           phase of the cell cycle along with Yox1p, contains a
           homeodomain [1062 bp, 353 aa]
          Length = 353

 Score = 44.7 bits (104), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 28/46 (60%)

Query: 109 LEILKREFQLNPSPNAQNRKRISEMTGLPEKNVRIWFQNRRSKYRK 154
           L IL+  F   P+PN   R  +SE   + EK+V+IWFQN+R   +K
Sbjct: 185 LGILQTAFDECPTPNKAKRIELSEQCNMSEKSVQIWFQNKRQAAKK 230

>Scas_641.12
          Length = 413

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 57/119 (47%), Gaps = 9/119 (7%)

Query: 98  KSKRTRATGEALEILKREFQLNPSPNAQNRKRISEMTGLPEKNVRIWFQNRRSKYRKSDK 157
           + KR R +   L IL+ EF+   +P+ Q R  +++   + +K V+IWFQN+R   ++  K
Sbjct: 184 RRKRRRTSSHELSILQAEFEKCSTPSKQVRLELAKRCSMTDKAVQIWFQNKRQSMKRVKK 243

Query: 158 RMNGPGATDNTTLVS-----SFEFDKIPLAINSSYYFIDISSLTVGSWKRLKSGNLRSD 211
              G  A       +     S    +  LA++ +  +ID  +  +      KS N+RSD
Sbjct: 244 AATGTTAAVTPPESTTTETNSLTPPRTILALSHAKKYIDTHATPLAP----KSINIRSD 298

>AER314W [2815] [Homologous to ScYML027W (YOX1) - SH; ScYDR451C
           (YHP1) - SH] complement(1218410..1219705) [1296 bp, 431
           aa]
          Length = 431

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 34/60 (56%)

Query: 98  KSKRTRATGEALEILKREFQLNPSPNAQNRKRISEMTGLPEKNVRIWFQNRRSKYRKSDK 157
           + KR R +   L IL++EF    +P+ + R  ++    + EK V+IWFQN+R   +K  K
Sbjct: 198 RRKRRRTSKHELTILQQEFDQCRTPSKEKRIELATRCNMTEKAVQIWFQNKRQSMKKKRK 257

>KLLA0C03135g complement(279869..280555)
           gi|10643642|gb|AAG21094.1|AF195067_2 Kluyveromyces
           lactis a1p, start by similarity
          Length = 228

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 31/58 (53%)

Query: 97  PKSKRTRATGEALEILKREFQLNPSPNAQNRKRISEMTGLPEKNVRIWFQNRRSKYRK 154
           P  KR+    E+  IL++ F++   PN   R  I++   L    VRIWF N+R + +K
Sbjct: 155 PTYKRSFIKHESRGILEKIFKVKQCPNTSERLYIAQKLDLTPSQVRIWFTNKRMRAKK 212

>KLLA0B14553g complement(1278622..1279308) sp|Q9HG12 Kluyveromyces
           lactis A1p, start by similarity
          Length = 228

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 31/58 (53%)

Query: 97  PKSKRTRATGEALEILKREFQLNPSPNAQNRKRISEMTGLPEKNVRIWFQNRRSKYRK 154
           P  KR+    E+  IL++ F++   PN   R  I++   L    VRIWF N+R + +K
Sbjct: 155 PTYKRSFIKHESRGILEKIFKVKQCPNTSERLYIAQKLDLTPSQVRIWFTNKRMRAKK 212

>Scas_720.1
          Length = 123

 Score = 33.9 bits (76), Expect = 0.084,   Method: Composition-based stats.
 Identities = 19/49 (38%), Positives = 25/49 (51%)

Query: 103 RATGEALEILKREFQLNPSPNAQNRKRISEMTGLPEKNVRIWFQNRRSK 151
           R T E L     E   NP PN Q +K + E+TGL +  +  WF N R +
Sbjct: 55  RGTVEVLNGWLLEHLNNPYPNVQEKKLLLELTGLTKVQLSNWFINVRRR 103

>CAGL0A03014g 305631..307136 similar to sp|P48360 Saccharomyces
           cerevisiae YDR376w ARH1, hypothetical start
          Length = 501

 Score = 33.1 bits (74), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 50/111 (45%), Gaps = 27/111 (24%)

Query: 155 SDKRMNGPGATDNTTLVSSFEFDKIPLAINSSYY-----FIDISSLTVGSWKRLKS---- 205
            DKR+  PG TD   ++SS EF         S+Y     F     L    W R+K+    
Sbjct: 127 GDKRLGIPGETDTAGVLSSREF--------VSWYNGHPDFASKEKLNSFDWSRVKNVAII 178

Query: 206 GN----------LRSDSLPQIQKLSNLSPISINTIMANATDLMVLISKKNF 246
           GN          L S+ +P+I   +++S  ++N +     + + +I++++F
Sbjct: 179 GNGNVALDISRVLLSNGIPEIWDKTDISKHALNILKHAPIETVKMIARRDF 229

>Kwal_33.12995
          Length = 110

 Score = 30.8 bits (68), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 24/46 (52%), Gaps = 3/46 (6%)

Query: 112 LKREFQLNPSPNAQNRKRIS---EMTGLPEKNVRIWFQNRRSKYRK 154
           L+  F LN S     RK+IS   E T L  K +R W  NRR K +K
Sbjct: 47  LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSKK 92

>YCR097W (HMRA1) [619] chr3
           (293831..293935,293990..294235,294288..294317)
           Homeodomain regulatory protein that acts with Alpha2p to
           repress transcription of haploid-specific genes in
           diploids [381 bp, 126 aa]
          Length = 126

 Score = 30.4 bits (67), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/55 (27%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 97  PKSKRTRATGEALEILKREFQLNPSPNAQNRKRISEMTGLPEKNVRIWFQNRRSK 151
           PK K +  + +A   L++ F+   S N++ ++ +++  G+    VR+WF N+R +
Sbjct: 71  PKGKSS-ISPQARAFLEQVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRMR 124

>ABR013W [604] [Homologous to ScYKL010C (UFD4) - SH]
           complement(412721..416995) [4275 bp, 1424 aa]
          Length = 1424

 Score = 29.6 bits (65), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 34/73 (46%), Gaps = 5/73 (6%)

Query: 318 KSPKFAVYFSETIDDASSNQWSICEDFSEGRQVNDAFIGGSNIPHVLTGLDESLKFMNSL 377
           K  KFAV+   T        W +C+   EG   ND      ++ + L  ++E + F++S+
Sbjct: 648 KKIKFAVFRPLTTQYVEKKLWQLCQTLVEGLSSND-----ESVINELREIEELVSFLHSV 702

Query: 378 ILDMNSTEHFPPT 390
               +S E++  T
Sbjct: 703 DRSEDSPEYWTRT 715

>Kwal_56.23583
          Length = 700

 Score = 29.3 bits (64), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 34/85 (40%), Gaps = 14/85 (16%)

Query: 389 PTTQLQHGIMHSMPPTDTQSTALR-----FNDD-PNLIAHDTSANPSHNSQSSFLTTNDN 442
           P T LQH I H    T   STA       FN    +L+A D S N  +      L     
Sbjct: 153 PHTLLQHSIYHKFFTTAISSTAHLSPYECFNHPVCSLLALDISQNEGYEDARDLL----- 207

Query: 443 FTSMTFDNFSSNIPKTPDFLNSTNL 467
              +TF N  +  P  P F+N  ++
Sbjct: 208 ---VTFKNMHNKTPHFPSFINVNDI 229

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.128    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,604,257
Number of extensions: 758345
Number of successful extensions: 2785
Number of sequences better than 10.0: 94
Number of HSP's gapped: 2758
Number of HSP's successfully gapped: 96
Length of query: 480
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 375
Effective length of database: 12,961,219
Effective search space: 4860457125
Effective search space used: 4860457125
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 63 (28.9 bits)