Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0D09999g50149326230.0
YMR170C (ALD2)50649518470.0
Kwal_23.350750249418380.0
YMR169C (ALD3)50649517770.0
Scas_669.950349417300.0
CAGL0F07777g50449117250.0
AFL201W49749116810.0
KLLA0C07777g51449311471e-153
Sklu_2369.551449311391e-152
KLLA0D10021g50349511361e-151
Kwal_23.350050349711351e-151
Kwal_23.591153849311381e-151
YER073W (ALD5)52047911251e-149
KLLA0E23144g50748811091e-147
CAGL0D06688g52449410941e-145
CAGL0J03212g51748710861e-144
Scas_663.452048110861e-144
KLLA0F00440g52249410841e-143
YOR374W (ALD4)51948910731e-142
CAGL0H05137g49749310711e-142
Kwal_26.675252249410681e-141
Sklu_2427.251848910651e-140
Sklu_2315.350148010531e-139
Kwal_27.1197652648010501e-138
Scas_701.1451549310471e-138
ACL044W51350110351e-136
ADR417W50750010251e-135
Scas_664.2449948910111e-133
YPL061W (ALD6)5004819911e-130
KLLA0F12628g5044767352e-91
Sklu_2087.35064607344e-91
AER007W4954786463e-78
CAGL0C04191g4914776052e-72
YBR006W (UGA2)4974765984e-71
Kwal_56.231064954775896e-70
Scas_716.634944775792e-68
KLLA0E17545g4974795601e-65
AAL075W6374854368e-47
Kwal_23.56996414854068e-43
YHR039C (MSC7)6444714023e-42
Scas_690.266514873777e-39
KLLA0C10615g6404773761e-38
CAGL0D03982g5744923591e-36
CAGL0F08965g6394813583e-36
KLLA0C10549g5764953529e-36
AAL071C5735023281e-32
CAGL0K03509g5274413262e-32
Kwal_26.75955243303051e-29
Scas_717.745223253041e-29
Kwal_23.57145764943042e-29
Scas_690.415814852936e-28
YHR037W (PUT2)5754902937e-28
KLLA0B12540g5213422723e-25
YMR110C5324822554e-23
Kwal_55.2201278958701.7
KLLA0B08327g153486665.5
Kwal_55.2183531972647.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D09999g
         (493 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D09999g complement(844368..845873) highly similar to sp|P47...  1014   0.0  
YMR170C (ALD2) [4125] chr13 complement(601561..603081) Aldehyde ...   716   0.0  
Kwal_23.3507                                                          712   0.0  
YMR169C (ALD3) [4124] chr13 complement(599351..600871) Cytoplasm...   689   0.0  
Scas_669.9                                                            671   0.0  
CAGL0F07777g complement(758205..759719) similar to sp|P47771 Sac...   669   0.0  
AFL201W [2994] [Homologous to ScYMR170C (ALD2) - SH; ScYMR169C (...   652   0.0  
KLLA0C07777g complement(682962..684506) highly similar to sp|P40...   446   e-153
Sklu_2369.5 YER073W, Contig c2369 5264-6808                           443   e-152
KLLA0D10021g 847239..848750 similar to ca|CA3272|CaALD4 Candida ...   442   e-151
Kwal_23.3500                                                          441   e-151
Kwal_23.5911                                                          442   e-151
YER073W (ALD5) [1504] chr5 (304027..305589) Mitochondrial aldehy...   437   e-149
KLLA0E23144g complement(2052418..2053941) highly similar to sp|P...   431   e-147
CAGL0D06688g 639883..641457 highly similar to sp|P46367 Saccharo...   426   e-145
CAGL0J03212g 307754..309307 highly similar to sp|P40047 Saccharo...   422   e-144
Scas_663.4                                                            422   e-144
KLLA0F00440g 31019..32587 highly similar to sp|P46367 Saccharomy...   422   e-143
YOR374W (ALD4) [5149] chr15 (1039836..1041395) Mitochondrial ald...   417   e-142
CAGL0H05137g complement(495715..497208) highly similar to sp|P54...   417   e-142
Kwal_26.6752                                                          416   e-141
Sklu_2427.2 YOR374W, Contig c2427 1739-3295                           414   e-140
Sklu_2315.3 YPL061W, Contig c2315 5950-7455                           410   e-139
Kwal_27.11976                                                         409   e-138
Scas_701.14                                                           407   e-138
ACL044W [1005] [Homologous to ScYER073W (ALD5) - SH] complement(...   403   e-136
ADR417W [2157] [Homologous to ScYOR374W (ALD4) - SH] complement(...   399   e-135
Scas_664.24                                                           394   e-133
YPL061W (ALD6) [5380] chr16 (432583..434085) Cytosolic acetaldeh...   386   e-130
KLLA0F12628g complement(1170396..1171910) similar to sp|P38067 S...   287   2e-91
Sklu_2087.3 , Contig c2087 4336-5856                                  287   4e-91
AER007W [2512] [Homologous to ScYBR006W (UGA2) - SH] complement(...   253   3e-78
CAGL0C04191g complement(409544..411019) highly similar to sp|P38...   237   2e-72
YBR006W (UGA2) [199] chr2 (246974..248467) Succinate semialdehyd...   234   4e-71
Kwal_56.23106                                                         231   6e-70
Scas_716.63                                                           227   2e-68
KLLA0E17545g 1553982..1555475 highly similar to sp|P38067 Saccha...   220   1e-65
AAL075W [112] [Homologous to ScYHR039C (MSC7) - SH] complement(2...   172   8e-47
Kwal_23.5699                                                          160   8e-43
YHR039C (MSC7) [2326] chr8 complement(184867..186801) Protein wi...   159   3e-42
Scas_690.26                                                           149   7e-39
KLLA0C10615g complement(912077..913999) similar to sp|P38694 Sac...   149   1e-38
CAGL0D03982g 397039..398763 highly similar to sp|P07275 Saccharo...   142   1e-36
CAGL0F08965g complement(880296..882215) highly similar to sp|P38...   142   3e-36
KLLA0C10549g 903888..905618 gi|31043861|emb|CAD91310.1 Kluyverom...   140   9e-36
AAL071C [116] [Homologous to ScYHR037W (PUT2) - SH] (223170..224...   130   1e-32
CAGL0K03509g complement(326043..327626) similar to sp|Q04458 Sac...   130   2e-32
Kwal_26.7595                                                          122   1e-29
Scas_717.74                                                           121   1e-29
Kwal_23.5714                                                          121   2e-29
Scas_690.41                                                           117   6e-28
YHR037W (PUT2) [2324] chr8 (181969..183696) Delta-1-pyrroline-5-...   117   7e-28
KLLA0B12540g 1094239..1095804 similar to sp|Q04458 Saccharomyces...   109   3e-25
YMR110C (YMR110C) [4067] chr13 complement(490393..491991) Protei...   102   4e-23
Kwal_55.22012                                                          32   1.7  
KLLA0B08327g 742205..746809 similar to sp|P22082 Saccharomyces c...    30   5.5  
Kwal_55.21835                                                          29   7.2  

>KLLA0D09999g complement(844368..845873) highly similar to sp|P47771
           Saccharomyces cerevisiae YMR170c ALD5 aldehyde
           dehydrogenase 2 (NAD+), start by similarity
          Length = 501

 Score = 1014 bits (2623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/493 (100%), Positives = 493/493 (100%)

Query: 1   MSLYETVNIPQLNITYEQPLGLFINNEFVKSSDGKKIESINPSTEESIVSFFAASEKDVN 60
           MSLYETVNIPQLNITYEQPLGLFINNEFVKSSDGKKIESINPSTEESIVSFFAASEKDVN
Sbjct: 1   MSLYETVNIPQLNITYEQPLGLFINNEFVKSSDGKKIESINPSTEESIVSFFAASEKDVN 60

Query: 61  SAVTAARDAFENNWSKTSGEQRGILLSKLFDLIERDKLLLAAIETLDSGKPYHSNSLADL 120
           SAVTAARDAFENNWSKTSGEQRGILLSKLFDLIERDKLLLAAIETLDSGKPYHSNSLADL
Sbjct: 61  SAVTAARDAFENNWSKTSGEQRGILLSKLFDLIERDKLLLAAIETLDSGKPYHSNSLADL 120

Query: 121 EQILQLTRYYAGGADKFTGGEYIPLNQDKYAYTMKVPYGVVAQIVPWNYPLAMASWKIQS 180
           EQILQLTRYYAGGADKFTGGEYIPLNQDKYAYTMKVPYGVVAQIVPWNYPLAMASWKIQS
Sbjct: 121 EQILQLTRYYAGGADKFTGGEYIPLNQDKYAYTMKVPYGVVAQIVPWNYPLAMASWKIQS 180

Query: 181 CLAAGNTIVIKPAENTSLSLLYFAQLVKEAGFPPGVLNILPGYGSVTGTAMASHTDIDKI 240
           CLAAGNTIVIKPAENTSLSLLYFAQLVKEAGFPPGVLNILPGYGSVTGTAMASHTDIDKI
Sbjct: 181 CLAAGNTIVIKPAENTSLSLLYFAQLVKEAGFPPGVLNILPGYGSVTGTAMASHTDIDKI 240

Query: 241 AFTGSTAVGQKVMSLAAQSNLKAVTLECGGKSPCLIFADANLDEAIPWVAGGIFYNSGQN 300
           AFTGSTAVGQKVMSLAAQSNLKAVTLECGGKSPCLIFADANLDEAIPWVAGGIFYNSGQN
Sbjct: 241 AFTGSTAVGQKVMSLAAQSNLKAVTLECGGKSPCLIFADANLDEAIPWVAGGIFYNSGQN 300

Query: 301 CTANSRIYVHEDIYEEFLTKFEEYAKSNWKFGAKFDPFDKDCTLGPVISKVQYDRIQSYV 360
           CTANSRIYVHEDIYEEFLTKFEEYAKSNWKFGAKFDPFDKDCTLGPVISKVQYDRIQSYV
Sbjct: 301 CTANSRIYVHEDIYEEFLTKFEEYAKSNWKFGAKFDPFDKDCTLGPVISKVQYDRIQSYV 360

Query: 361 EHGKASEKLGFKEFAEYPSKGYFIPPTIFSDVPNSSKLSQEEIFGPVGVVASFSTYEEAI 420
           EHGKASEKLGFKEFAEYPSKGYFIPPTIFSDVPNSSKLSQEEIFGPVGVVASFSTYEEAI
Sbjct: 361 EHGKASEKLGFKEFAEYPSKGYFIPPTIFSDVPNSSKLSQEEIFGPVGVVASFSTYEEAI 420

Query: 421 KLANDSSYGLASCVFSENARTTAQFARDIRAGTVWINSSNDEEISVPFGGFKMSGIGREL 480
           KLANDSSYGLASCVFSENARTTAQFARDIRAGTVWINSSNDEEISVPFGGFKMSGIGREL
Sbjct: 421 KLANDSSYGLASCVFSENARTTAQFARDIRAGTVWINSSNDEEISVPFGGFKMSGIGREL 480

Query: 481 GRNGVDSYLQTKA 493
           GRNGVDSYLQTKA
Sbjct: 481 GRNGVDSYLQTKA 493

>YMR170C (ALD2) [4125] chr13 complement(601561..603081) Aldehyde
           dehydrogenase (NAD(P)+), likely cytosolic [1521 bp, 506
           aa]
          Length = 506

 Score =  716 bits (1847), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/495 (68%), Positives = 406/495 (82%), Gaps = 3/495 (0%)

Query: 2   SLYETVNIPQLNITYEQPLGLFINNEFVKSSDGKKIESINPSTEESIVSFFAASEKDVNS 61
           +LY  + IPQL I+ +QPLGLFINNEF  SSDGK IE++NP+T E I SF AA+EKDV+ 
Sbjct: 3   TLYTDIEIPQLKISLKQPLGLFINNEFCPSSDGKTIETVNPATGEPITSFQAANEKDVDK 62

Query: 62  AVTAARDAFENNWSKTSGEQRGILLSKLFDLIERDKLLLAAIETLDSGKPYHSNSLADLE 121
           AV AAR AF+N WSKTS EQRGI LS L  LIE ++  LAA+ETLD+GKPYHSN+  DL 
Sbjct: 63  AVKAARAAFDNVWSKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPYHSNAKGDLA 122

Query: 122 QILQLTRYYAGGADKFTGGEYIPLNQDKYAYTMKVPYGVVAQIVPWNYPLAMASWKIQSC 181
           QILQLTRY+AG ADKF  G  IPL  +K+AYT+KVP+GVVAQIVPWNYPLAMA WK+Q  
Sbjct: 123 QILQLTRYFAGSADKFDKGATIPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACWKLQGA 182

Query: 182 LAAGNTIVIKPAENTSLSLLYFAQLVKEAGFPPGVLNILPGYGSVTGTAMASHTDIDKIA 241
           LAAGNT++IKPAENTSLSLLYFA L+K+AGFPPGV+NI+PGYGS+ G A+ASH DIDKI+
Sbjct: 183 LAAGNTVIIKPAENTSLSLLYFATLIKKAGFPPGVVNIVPGYGSLVGQALASHMDIDKIS 242

Query: 242 FTGSTAVGQKVMSLAAQSNLKAVTLECGGKSPCLIFADANLDEAIPWVAGGIFYNSGQNC 301
           FTGST VG  V+  + QSNLK VTLECGGKSP L+F DA+LD+AI W+A GIFYNSGQNC
Sbjct: 243 FTGSTKVGGFVLEASGQSNLKDVTLECGGKSPALVFEDADLDKAIDWIAAGIFYNSGQNC 302

Query: 302 TANSRIYVHEDIYEEFLTKFEEYAKSNWKFGAKFDPFDKDCTLGPVISKVQYDRIQSYVE 361
           TANSR+YV   IY++F+ KF+E AK  W    KFDPFD+ C +GPVIS  QYDRI+SY+E
Sbjct: 303 TANSRVYVQSSIYDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSYIE 362

Query: 362 HGKASEKLGFKEFAEYP---SKGYFIPPTIFSDVPNSSKLSQEEIFGPVGVVASFSTYEE 418
            GK  EKL   + +E+P   +KGYFIPPTIF+DVP +SKL Q+EIFGPV VV+ F+ Y++
Sbjct: 363 RGKREEKLDMFQTSEFPIGGAKGYFIPPTIFTDVPQTSKLLQDEIFGPVVVVSKFTNYDD 422

Query: 419 AIKLANDSSYGLASCVFSENARTTAQFARDIRAGTVWINSSNDEEISVPFGGFKMSGIGR 478
           A+KLAND+ YGLAS VF+++ +    FARDI+AGTVWINSSNDE+++VPFGGFKMSGIGR
Sbjct: 423 ALKLANDTCYGLASAVFTKDVKKAHMFARDIKAGTVWINSSNDEDVTVPFGGFKMSGIGR 482

Query: 479 ELGRNGVDSYLQTKA 493
           ELG++GVD+YLQTKA
Sbjct: 483 ELGQSGVDTYLQTKA 497

>Kwal_23.3507
          Length = 502

 Score =  712 bits (1838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/494 (67%), Positives = 416/494 (84%), Gaps = 1/494 (0%)

Query: 1   MSLYETVNIPQLNITYEQPLGLFINNEFVKSSDGKKIESINPSTEESIVSFFAASEKDVN 60
           MSL   ++IPQL++TY+QPLGL+INNEFV SSDG  IES+NP+T + + SF AA++ DV+
Sbjct: 1   MSLSTEIHIPQLDLTYQQPLGLYINNEFVASSDGGSIESVNPATGKPVASFQAATDADVD 60

Query: 61  SAVTAARDAFENNWSKTSGEQRGILLSKLFDLIERDKLLLAAIETLDSGKPYHSNSLADL 120
            AV AAR A++++W  TS EQR  LL+KL +L+E+++ LLAAIETLDSGKP+H+N+  DL
Sbjct: 61  RAVAAARKAYQSHWRHTSAEQRSALLAKLAELVEQERELLAAIETLDSGKPFHTNAKGDL 120

Query: 121 EQILQLTRYYAGGADKFTGGEYIPLNQDKYAYTMKVPYGVVAQIVPWNYPLAMASWKIQS 180
           +QI+QLT+YYAGGADKF  G++IP+  DKYAYT++ PYGVVAQ+VPWNYPLAMASWK+Q 
Sbjct: 121 DQIVQLTKYYAGGADKFNKGQHIPVGPDKYAYTVQAPYGVVAQVVPWNYPLAMASWKMQG 180

Query: 181 CLAAGNTIVIKPAENTSLSLLYFAQLVKEAGFPPGVLNILPGYGSVTGTAMASHTDIDKI 240
           CLAAGNT+VIKPAENTSLSLLYFAQL + AGFP GV+N++PG+G+V G+ +A+H D+DKI
Sbjct: 181 CLAAGNTVVIKPAENTSLSLLYFAQLFERAGFPAGVVNVVPGHGAVAGSRLAAHMDVDKI 240

Query: 241 AFTGSTAVGQKVMSLAAQSNLKAVTLECGGKSPCLIFADANLDEAIPWVAGGIFYNSGQN 300
           AFTGSTAVGQKVM LAA SNLKAVTLECGGKSP +IFADA+LD+A+ W A GI+YNSGQN
Sbjct: 241 AFTGSTAVGQKVMGLAAASNLKAVTLECGGKSPAVIFADADLDQAVEWTAAGIYYNSGQN 300

Query: 301 CTANSRIYVHEDIYEEFLTKFEEYAKSNWKFGAKFDPFDKDCTLGPVISKVQYDRIQSYV 360
           CTANSR+YV E +Y+EF+ KF  Y +  WKFGAK DPFD +CT+GPV+S+VQYDRI+ Y+
Sbjct: 301 CTANSRLYVQESVYDEFVAKFCAYVEKTWKFGAKHDPFDPECTVGPVVSQVQYDRIRGYI 360

Query: 361 EHGKASEKLGFKEFAEYP-SKGYFIPPTIFSDVPNSSKLSQEEIFGPVGVVASFSTYEEA 419
           EHGK+SE+LG ++      + G+FIPPT+F+DVP  SKLS+EEIFGPV V+A F  Y++A
Sbjct: 361 EHGKSSEQLGIRQIGVADVAPGFFIPPTLFTDVPQDSKLSREEIFGPVAVIAKFKDYDDA 420

Query: 420 IKLANDSSYGLASCVFSENARTTAQFARDIRAGTVWINSSNDEEISVPFGGFKMSGIGRE 479
           +  AND++YGLA+ VF+E+ R    FARDI AGTVWINSSNDEE+SVPFGGFKMSGIGRE
Sbjct: 421 LARANDTNYGLAAAVFTEDVRKANHFARDIDAGTVWINSSNDEEVSVPFGGFKMSGIGRE 480

Query: 480 LGRNGVDSYLQTKA 493
           LG++G+D Y Q KA
Sbjct: 481 LGQSGMDVYTQIKA 494

>YMR169C (ALD3) [4124] chr13 complement(599351..600871) Cytoplasmic,
           stress inducible aldehyde dehydrogenase, probable
           isoform of Ald2p [1521 bp, 506 aa]
          Length = 506

 Score =  689 bits (1777), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/495 (65%), Positives = 395/495 (79%), Gaps = 3/495 (0%)

Query: 2   SLYETVNIPQLNITYEQPLGLFINNEFVKSSDGKKIESINPSTEESIVSFFAASEKDVNS 61
           +LY  + IPQL I+ +QPLGLFINNEF  SSDGK IE++NP+T E I SF AA+EKDV+ 
Sbjct: 3   TLYTDIEIPQLKISLKQPLGLFINNEFCPSSDGKTIETVNPATGEPITSFQAANEKDVDK 62

Query: 62  AVTAARDAFENNWSKTSGEQRGILLSKLFDLIERDKLLLAAIETLDSGKPYHSNSLADLE 121
           AV AAR AF+N WSKTS EQRGI LS L  LIE ++  LAA+ETLD+GKP+HSN+  DL 
Sbjct: 63  AVKAARAAFDNVWSKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPFHSNAKQDLA 122

Query: 122 QILQLTRYYAGGADKFTGGEYIPLNQDKYAYTMKVPYGVVAQIVPWNYPLAMASWKIQSC 181
           QI++LTRYYAG  DKF  GE IPL  +K+AYT+KVP+GVVAQIVPWNYPLAMA  K+Q  
Sbjct: 123 QIIELTRYYAGAVDKFNMGETIPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACRKMQGA 182

Query: 182 LAAGNTIVIKPAENTSLSLLYFAQLVKEAGFPPGVLNILPGYGSVTGTAMASHTDIDKIA 241
           LAAGNT++IKPAENTSLSLLYFA L+K+AGFPPGV+N++PGYGSV G A+ +H DIDKI+
Sbjct: 183 LAAGNTVIIKPAENTSLSLLYFATLIKKAGFPPGVVNVIPGYGSVVGKALGTHMDIDKIS 242

Query: 242 FTGSTAVGQKVMSLAAQSNLKAVTLECGGKSPCLIFADANLDEAIPWVAGGIFYNSGQNC 301
           FTGST VG  V+  + QSNLK +TLECGGKSP L+F DA+LD+AI WVA GIF+NSGQ C
Sbjct: 243 FTGSTKVGGSVLEASGQSNLKDITLECGGKSPALVFEDADLDKAIEWVANGIFFNSGQIC 302

Query: 302 TANSRIYVHEDIYEEFLTKFEEYAKSNWKFGAKFDPFDKDCTLGPVISKVQYDRIQSYVE 361
           TANSR+YV   IY++F+ KF+E AK  W    KFDPFD+ C +GPVIS  QYDRI+SY+E
Sbjct: 303 TANSRVYVQSSIYDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSYIE 362

Query: 362 HGKASEKLGFKEFAEYP---SKGYFIPPTIFSDVPNSSKLSQEEIFGPVGVVASFSTYEE 418
            GK  EKL   + +E+P   +KGYFIPPTIF+DVP +SKL ++EIFGPV VV+ F+ Y++
Sbjct: 363 RGKKEEKLDMFQTSEFPIGGAKGYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNYDD 422

Query: 419 AIKLANDSSYGLASCVFSENARTTAQFARDIRAGTVWINSSNDEEISVPFGGFKMSGIGR 478
           A+KLAND+ YGLAS VF+++ +    FARDI+AGTVWIN +N EE  VPFGGFKMSGIGR
Sbjct: 423 ALKLANDTCYGLASAVFTKDVKKAHMFARDIKAGTVWINQTNQEEAKVPFGGFKMSGIGR 482

Query: 479 ELGRNGVDSYLQTKA 493
           E G  GVD+YLQ K+
Sbjct: 483 ESGDTGVDNYLQIKS 497

>Scas_669.9
          Length = 503

 Score =  671 bits (1730), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/494 (62%), Positives = 398/494 (80%), Gaps = 4/494 (0%)

Query: 3   LYETVNIPQLNITYEQPLGLFINNEFVKSSDGKKIESINPSTEESIVSFFAASEKDVNSA 62
           +++T+ IPQ +++  QP+GLFI+NEFVKSSDG +I++ NP+T+E + SF+A SE DVN A
Sbjct: 1   MFKTIEIPQHHLSIRQPIGLFISNEFVKSSDGNQIDTFNPATKEKLTSFYAGSETDVNVA 60

Query: 63  VTAARDAFENNWSKTSGEQRGILLSKLFDLIERDKLLLAAIETLDSGKPYHSNSLADLEQ 122
           V AAR ++   WSKTS EQR  LL KL  L+ERDK +LA+IET DSGKPY++N+L D++ 
Sbjct: 61  VRAARTSYTKTWSKTSPEQRTDLLLKLASLVERDKEILASIETQDSGKPYYTNALLDIDM 120

Query: 123 ILQLTRYYAGGADKFTGGEYIPLNQDKYAYTMKVPYGVVAQIVPWNYPLAMASWKIQSCL 182
           I++LT+Y+AG  DKFT GE IP++ +  AYT+KVP+GVVAQIVPWNYPLAMASWK+QSCL
Sbjct: 121 IIKLTKYFAGSTDKFTTGETIPIDHETLAYTLKVPFGVVAQIVPWNYPLAMASWKLQSCL 180

Query: 183 AAGNTIVIKPAENTSLSLLYFAQLVKEAGFPPGVLNILPGYGSVTGTAMASHTDIDKIAF 242
           AAGNT+VIKP+EN+SLSLLYFAQL+ EAGFPPGV+NI+PGYG+V G A+++H D+DKI+F
Sbjct: 181 AAGNTVVIKPSENSSLSLLYFAQLIVEAGFPPGVVNIIPGYGTVVGDALSTHPDVDKISF 240

Query: 243 TGSTAVGQKVMSLAAQSNLKAVTLECGGKSPCLIFADANLDEAIPWVAGGIFYNSGQNCT 302
           TGST VG  V+  + +SNLK VTLECGGKSP +IF DANL+EA+ W + GIF+NSGQNCT
Sbjct: 241 TGSTKVGCNVLEQSGKSNLKDVTLECGGKSPAVIFKDANLEEAVKWTSEGIFFNSGQNCT 300

Query: 303 ANSRIYVHEDIYEEFLTKFEEYAKSNWKFGAKFDPFDKDCTLGPVISKVQYDRIQSYVEH 362
           ANSRI V  DI++EF+ KF++Y K  W FG+KFDPFDKDCT+GPVIS+ QY++IQ Y+  
Sbjct: 301 ANSRILVQHDIFDEFVHKFKDYTKRKWNFGSKFDPFDKDCTVGPVISQKQYEKIQEYMTC 360

Query: 363 GKASEKLGFKEFAEYPS---KGYFIPPTIFSDVPNSSKLSQEEIFGPVGVVASFSTYEEA 419
            +    +      +YP     GYFIPPTI+++VP  SK  +EEIFGP  V++ F  Y+EA
Sbjct: 361 PEGC-PVEVSHIIDYPPDDINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVISEFRDYDEA 419

Query: 420 IKLANDSSYGLASCVFSENARTTAQFARDIRAGTVWINSSNDEEISVPFGGFKMSGIGRE 479
           + LAND+SYGLA+ VF+EN R   +FARDI AGTVW+N+SN E++++PFGGFKMSGIGRE
Sbjct: 420 LSLANDTSYGLAAAVFTENIRIAHEFARDILAGTVWVNTSNAEDVTLPFGGFKMSGIGRE 479

Query: 480 LGRNGVDSYLQTKA 493
           LGR GV+S++QTK 
Sbjct: 480 LGRTGVESFMQTKT 493

>CAGL0F07777g complement(758205..759719) similar to sp|P47771
           Saccharomyces cerevisiae YMR170c ALD5 or sp|P54114
           Saccharomyces cerevisiae YMR169c ALD4, start by
           similarity
          Length = 504

 Score =  669 bits (1725), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/491 (62%), Positives = 394/491 (80%), Gaps = 1/491 (0%)

Query: 3   LYETVNIPQLNITYEQPLGLFINNEFVKSSDGKKIESINPSTEESIVSFFAASEKDVNSA 62
           ++E +NIPQ+  +Y+QP+G+FI+NEFV SS+G+KIE+INP+TEE I SF+AA+E DV+ A
Sbjct: 4   VFEEINIPQIGRSYKQPIGIFIDNEFVPSSNGEKIETINPATEEVITSFYAATEDDVDKA 63

Query: 63  VTAARDAFENNWSKTSGEQRGILLSKLFDLIERDKLLLAAIETLDSGKPYHSNSLADLEQ 122
           V +AR+++EN W K S  ++  +L KL DLIE +K LLAA+ETLD+GKPYH+N++ D++Q
Sbjct: 64  VKSARESYENVWFKISPAEKRDMLLKLADLIEEEKPLLAALETLDAGKPYHTNAMDDIDQ 123

Query: 123 ILQLTRYYAGGADKFTGGEYIPLNQDKYAYTMKVPYGVVAQIVPWNYPLAMASWKIQSCL 182
           I+ LT+Y+AG  DKFT G+ IP++ +K  YT+K PYGV   I+PWNYPLAMASWK+Q CL
Sbjct: 124 IIHLTKYFAGATDKFTQGKTIPIDHEKLVYTLKSPYGVCGMIIPWNYPLAMASWKMQGCL 183

Query: 183 AAGNTIVIKPAENTSLSLLYFAQLVKEAGFPPGVLNILPGYGSVTGTAMASHTDIDKIAF 242
           AAGNT+VIKPAENTSLSLLY AQL K+AGFP GV+N++PG GSV G ++  H D+DKI+F
Sbjct: 184 AAGNTLVIKPAENTSLSLLYLAQLFKKAGFPKGVVNVVPGKGSVVGNSLGLHMDVDKISF 243

Query: 243 TGSTAVGQKVMSLAAQSNLKAVTLECGGKSPCLIFADANLDEAIPWVAGGIFYNSGQNCT 302
           TGST VG  ++ LA +SN+K VTLECGGKSP ++F DA++D AI ++A GIFYNSGQNCT
Sbjct: 244 TGSTKVGSSILELAGKSNMKDVTLECGGKSPAVVFQDADIDNAIEYIANGIFYNSGQNCT 303

Query: 303 ANSRIYVHEDIYEEFLTKFEEYAKSNWKFGAKFDPFDKDCTLGPVISKVQYDRIQSYVEH 362
           ANSR+YV EDIY++F+ +F E+ K NWKFG+K DPFDKDCT+GPV+S+ Q++ +  Y+ H
Sbjct: 304 ANSRVYVQEDIYDDFIKRFTEHTKENWKFGSKCDPFDKDCTVGPVVSEKQFETVNDYIRH 363

Query: 363 GKASEKLGFKEFAE-YPSKGYFIPPTIFSDVPNSSKLSQEEIFGPVGVVASFSTYEEAIK 421
           GK  E L   +  E    KGYFI PTIF+DVP  SKL +EEIFGPV VVA F  Y+EAIK
Sbjct: 364 GKEEENLQIHQTVEKCDCKGYFISPTIFTDVPQGSKLMKEEIFGPVVVVAKFKDYKEAIK 423

Query: 422 LANDSSYGLASCVFSENARTTAQFARDIRAGTVWINSSNDEEISVPFGGFKMSGIGRELG 481
           LAND++YGLAS VF++N      FARDI++GTVWINSSN+E+ +VPFGGFK SGIGRELG
Sbjct: 424 LANDTNYGLASMVFTKNISVANWFARDIKSGTVWINSSNEEDPTVPFGGFKQSGIGRELG 483

Query: 482 RNGVDSYLQTK 492
             GV+SY+Q K
Sbjct: 484 ETGVESYMQIK 494

>AFL201W [2994] [Homologous to ScYMR170C (ALD2) - SH; ScYMR169C
           (ALD3) - SH] complement(58424..59917) [1494 bp, 497 aa]
          Length = 497

 Score =  652 bits (1681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/491 (63%), Positives = 386/491 (78%), Gaps = 3/491 (0%)

Query: 3   LYETVNIPQLNITYEQPLGLFINNEFVKSSDGKKIESINPSTEESIVSFFAASEKDVNSA 62
           L+E +N+P+   TY QPLGLFI+NEFV    G ++++ NP+  E I +F+AA   DV++A
Sbjct: 4   LFEEINVPETGFTYLQPLGLFIDNEFVAPMGGSQLQTTNPANGELIATFYAAGAADVDAA 63

Query: 63  VTAARDAFENNWSKTSGEQRGILLSKLFDLIERDKLLLAAIETLDSGKPYHSNSLADLEQ 122
           V AAR A+E  W  TS ++RG LL++L +L++ ++ +LA IETLDSGKPYH+N+LADL+Q
Sbjct: 64  VAAARRAYEERWRHTSAQERGALLARLAELVDEEREVLAGIETLDSGKPYHTNALADLDQ 123

Query: 123 ILQLTRYYAGGADKFTGGEYIPLNQDKYAYTMKVPYGVVAQIVPWNYPLAMASWKIQSCL 182
           +  +TRYYAGGADK   G+   L+  K AYT++VPYGVVAQIVPWNYPLAMASWK Q CL
Sbjct: 124 VAYVTRYYAGGADKMHQGDAFALSHTKQAYTLEVPYGVVAQIVPWNYPLAMASWKAQGCL 183

Query: 183 AAGNTIVIKPAENTSLSLLYFAQLVKEAGFPPGVLNILPGYGSVTGTAMASHTDIDKIAF 242
           AAGN +VIKP+ENTSLSLLYFA LV+ AGFPPGV N+LPG G   G  +A H  +DKIAF
Sbjct: 184 AAGNCVVIKPSENTSLSLLYFASLVRRAGFPPGVFNVLPGLGPEVGQRLAEHKGVDKIAF 243

Query: 243 TGSTAVGQKVMSLAAQSNLKAVTLECGGKSPCLIFADANLDEAIPWVAGGIFYNSGQNCT 302
           TGSTAVGQKVM+ AA SNLK VTLECGGKSP +IFADA+LD A+ +VA GIFYNSGQNCT
Sbjct: 244 TGSTAVGQKVMAAAAMSNLKDVTLECGGKSPAVIFADADLDSAVNYVAAGIFYNSGQNCT 303

Query: 303 ANSRIYVHEDIYEEFLTKFEEYAKSNWKFGAKFDPFDKDCTLGPVISKVQYDRIQSYVEH 362
           ANSRIYV E +Y+ FL KF  + +S + FG+    F KDC +GPVISK QYDR+  Y+ H
Sbjct: 304 ANSRIYVQEAVYDAFLDKFRAHVRSTYSFGSGL--FSKDCNMGPVISKTQYDRVMGYINH 361

Query: 363 GKASEKLGFKEFAEYPSKGYFIPPTIFSDVPNSSKLSQEEIFGPVGVVASFSTYEEAIKL 422
           G  +EKL +++F   P KGY+IPPTIF DVP SS+L +EEIFGPV VVA F  Y+EAI+ 
Sbjct: 362 G-INEKLAYEQFGSVPEKGYYIPPTIFLDVPQSSRLCREEIFGPVAVVAKFKDYDEAIRY 420

Query: 423 ANDSSYGLASCVFSENARTTAQFARDIRAGTVWINSSNDEEISVPFGGFKMSGIGRELGR 482
           AND++YGLASCVF+EN R   +F RD+++GTVW+NSSNDEE+ VPFGGFKMSGIGRELG+
Sbjct: 421 ANDTNYGLASCVFTENIRVAHRFVRDVQSGTVWVNSSNDEEVGVPFGGFKMSGIGRELGK 480

Query: 483 NGVDSYLQTKA 493
            G+ +YLQTKA
Sbjct: 481 AGLQTYLQTKA 491

>KLLA0C07777g complement(682962..684506) highly similar to sp|P40047
           Saccharomyces cerevisiae YER073w ALD5 aldehyde
           dehydrogenase (NAD+), mitochondrial, start by similarity
          Length = 514

 Score =  446 bits (1147), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 237/493 (48%), Positives = 315/493 (63%), Gaps = 8/493 (1%)

Query: 1   MSLYETVNIPQLNITYEQPLGLFINNEFVKSSDGKKIESINPSTEESIVSFFAASEKDVN 60
           + L   V +P   ITYEQP GLFIN EFV S   K  E +NPS EE I   + A E DV+
Sbjct: 20  LPLKVPVQLPN-GITYEQPTGLFINGEFVPSRQHKTFEVLNPSNEEEITHIYEAREDDVD 78

Query: 61  SAVTAARDAFENNWSKTSGEQRGILLSKLFDLIERDKLLLAAIETLDSGKPYHSNSLADL 120
            AV AA+ AF N WS    E R   L KL DLI++    LA+IE+LD+GK     S  D+
Sbjct: 79  IAVAAAKKAFNNGWSTAEPEDRAKCLLKLADLIDQHAETLASIESLDNGKSLFC-SRGDV 137

Query: 121 EQILQLTRYYAGGADKFTGGEYIPLNQDKYAYTMKVPYGVVAQIVPWNYPLAMASWKIQS 180
             + +  R  AG ADK  G + I    D ++YT + P GV  QI+PWN+PL M SWK+  
Sbjct: 138 ALVAKYLRSCAGWADKIYG-KVIDTGADHFSYTKREPLGVCGQIIPWNFPLLMWSWKVGP 196

Query: 181 CLAAGNTIVIKPAENTSLSLLYFAQLVKEAGFPPGVLNILPGYGSVTGTAMASHTDIDKI 240
            LA GNT+V+KPAE T LS LY  QLV+EAG P GV+NI+PG+G + G  + +H DI K+
Sbjct: 197 ALATGNTVVLKPAEATPLSALYACQLVQEAGVPKGVVNIIPGFGKIVGERICTHPDIKKV 256

Query: 241 AFTGSTAVGQKVMSLAAQSNLKAVTLECGGKSPCLIFADANLDEAIPWVAGGIFYNSGQN 300
           AFTGSTA G+ +M   A S +K VTLE GGKSP ++F DA+LD+A+  +A GIFYNSG+ 
Sbjct: 257 AFTGSTATGRHIMKTCADS-IKKVTLELGGKSPNIVFGDADLDKAVKNIAFGIFYNSGEV 315

Query: 301 CTANSRIYVHEDIYEEFLTKFEEYAKSNWKFGAKFDPFDKDCTLGPVISKVQYDRIQSYV 360
           C A SRIYV + +YEE L KF++YA+S  K G   +PF+++   G   S++Q D+I SYV
Sbjct: 316 CCAGSRIYVQDTVYEEVLEKFKQYAES-LKVG---NPFEENVFQGAQTSQMQIDKILSYV 371

Query: 361 EHGKASEKLGFKEFAEYPSKGYFIPPTIFSDVPNSSKLSQEEIFGPVGVVASFSTYEEAI 420
           + G +             +KGYFI PTIF+DV    ++ +EEIFGPV  V+ F+T +E +
Sbjct: 372 DVGTSEGARVITGGERIGNKGYFIKPTIFADVKEDMQIVKEEIFGPVVTVSKFTTVDEVV 431

Query: 421 KLANDSSYGLASCVFSENARTTAQFARDIRAGTVWINSSNDEEISVPFGGFKMSGIGREL 480
             ANDS YGLA+ + +++       +  ++AGTVWIN+ N+   +VPFGGF  SGIGRE+
Sbjct: 432 AKANDSEYGLAAGIHTKDVNKAIDVSNRVKAGTVWINTYNNFHQNVPFGGFGQSGIGREM 491

Query: 481 GRNGVDSYLQTKA 493
           G   +D+Y QTKA
Sbjct: 492 GAEALDNYTQTKA 504

>Sklu_2369.5 YER073W, Contig c2369 5264-6808
          Length = 514

 Score =  443 bits (1139), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 236/493 (47%), Positives = 312/493 (63%), Gaps = 8/493 (1%)

Query: 1   MSLYETVNIPQLNITYEQPLGLFINNEFVKSSDGKKIESINPSTEESIVSFFAASEKDVN 60
           + L   V +P   ITYEQP GLFIN EFV S   K  E INPS EE +   + A E DV+
Sbjct: 20  LPLRVPVTLPN-GITYEQPTGLFINGEFVPSRQHKTFEVINPSNEEEVTHVYEAREDDVD 78

Query: 61  SAVTAARDAFENNWSKTSGEQRGILLSKLFDLIERDKLLLAAIETLDSGKPYHSNSLADL 120
            AV AA+ AF+N WS    E R   L KL DLIE++   LA IE+LD+GK     S  D+
Sbjct: 79  IAVAAAKKAFDNGWSTAEPEFRAQCLYKLADLIEKNAETLAGIESLDNGKSLFC-SRGDV 137

Query: 121 EQILQLTRYYAGGADKFTGGEYIPLNQDKYAYTMKVPYGVVAQIVPWNYPLAMASWKIQS 180
             + +  R  AG +DK  G + I    D +AYT + P GV  QI+PWN+PL M SWKI  
Sbjct: 138 ALVSKYLRSCAGWSDKLFG-KVIDTGSDHFAYTKREPLGVCGQIIPWNFPLLMWSWKIGP 196

Query: 181 CLAAGNTIVIKPAENTSLSLLYFAQLVKEAGFPPGVLNILPGYGSVTGTAMASHTDIDKI 240
            LA GNT+V+KPAE T LS LY +QL +EAG P GV+NI+PG+G + G  + +H ++ K+
Sbjct: 197 ALATGNTVVLKPAEATPLSALYASQLCQEAGIPKGVVNIIPGFGKIVGERLCTHPEVKKV 256

Query: 241 AFTGSTAVGQKVMSLAAQSNLKAVTLECGGKSPCLIFADANLDEAIPWVAGGIFYNSGQN 300
           AFTGSTA G+ +M  AA S +K VTLE GGKSP ++F DA+LD+A+  +A GIF+NSG+ 
Sbjct: 257 AFTGSTATGRHIMKTAADS-IKKVTLELGGKSPNIVFGDADLDKAVKNIAFGIFFNSGEV 315

Query: 301 CTANSRIYVHEDIYEEFLTKFEEYAKSNWKFGAKFDPFDKDCTLGPVISKVQYDRIQSYV 360
           C A SR+YV + +YEE L KF+EY +S  K G   +PF+     G   SK+Q D+I SYV
Sbjct: 316 CCAGSRVYVQDTVYEEVLQKFKEYTES-LKVG---NPFEDGVFQGAQTSKMQIDKILSYV 371

Query: 361 EHGKASEKLGFKEFAEYPSKGYFIPPTIFSDVPNSSKLSQEEIFGPVGVVASFSTYEEAI 420
           + G            +   KGYFI PTIF+DV    ++ +EEIFGP+  V+ FS+ +E I
Sbjct: 372 DIGTKEGARIITGGEKKGEKGYFIKPTIFADVKEDMRIVKEEIFGPIVSVSKFSSVDEVI 431

Query: 421 KLANDSSYGLASCVFSENARTTAQFARDIRAGTVWINSSNDEEISVPFGGFKMSGIGREL 480
            +ANDS YGLA+ + +++       +  I+AGT+WIN+ N    SVPFGGF  SGIGRE+
Sbjct: 432 AMANDSEYGLAAGIHTKDVNKAIDVSNRIKAGTIWINTYNAFHQSVPFGGFGQSGIGREM 491

Query: 481 GRNGVDSYLQTKA 493
           G   +D+Y Q KA
Sbjct: 492 GAEALDNYTQVKA 504

>KLLA0D10021g 847239..848750 similar to ca|CA3272|CaALD4 Candida
           albicans aldehyde dehydrogenase, mitochondrial (by
           homology), start by similarity
          Length = 503

 Score =  442 bits (1136), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 235/495 (47%), Positives = 322/495 (65%), Gaps = 31/495 (6%)

Query: 16  YEQPLGLFINNEFVKSSDGKKIESINPSTEESIVSFFAASEK-DVNSAVTAARDAFENNW 74
           Y+QPLGLFINNE+V++   + + S NPS+ E I     A  K DV+ AV AARDAF   W
Sbjct: 14  YQQPLGLFINNEYVEAHGSETLTSYNPSSGEEICKVQCADPKIDVDLAVKAARDAFPG-W 72

Query: 75  SKTSGEQRGILLSKLFDLIERDKLLLAAIETLDSGKPYHSNSLADLEQILQLTRYYAGGA 134
             T   ++  L  KL  L+ERD  +L+ IE+LD+GKP  +N+  D+ +++++ +YYAG  
Sbjct: 73  KATPAIEKRDLFYKLAGLLERDIDILSKIESLDTGKPIANNAKYDILEVVEVLKYYAGWI 132

Query: 135 DKFTGGEYIPLNQDKYAYTMKVPYGVVAQIVPWNYPLAMASWKIQSCLAAGNTIVIKPAE 194
           DK  G  + P + +K AYT+  P GVV  I+P+NYPLAM SWK  + +A GNT V K A+
Sbjct: 133 DKAGGQSFAP-SSEKLAYTLHQPLGVVGCIIPFNYPLAMMSWK-WTAIATGNTTVFKSAD 190

Query: 195 NTSLSLLYFAQLVKEAGFPPGVLNILPGYGSVTGTAMASHTDIDKIAFTGSTAVGQKVMS 254
            T LS+LYFA+LVKEAGFP GV N+L G G+  G+A+  HT +DKIAFTGSTAVGQ +  
Sbjct: 191 QTPLSILYFAKLVKEAGFPAGVFNVLSGTGASVGSAIVKHTGVDKIAFTGSTAVGQIIQQ 250

Query: 255 LAAQSNLKAVTLECGGKSPCLIFADANLDEAIPWVAGGIFYNSGQNCTANSRIYVHEDIY 314
            +A  NLK +TLECGGKS  +IF D +L++A+ W A GIF N GQ C+  SR++V E IY
Sbjct: 251 QSA-VNLKPITLECGGKSANMIFEDCDLEQAVKWSAWGIFNNMGQICSGTSRVFVQESIY 309

Query: 315 EEFLTKFEEYAKSNWKFGAKFDPFDKDCTLGPVISKVQYDRIQSYVEHGKASEKLGFKEF 374
           EEF+ +  ++ K  +  GA   P D    +GP +SK Q +R+  Y+       K+G +E 
Sbjct: 310 EEFVAQLADHVKKTYIVGA---PSDDAVIVGPQVSKKQQERVLEYI-------KIGIEEG 359

Query: 375 AEYP----------------SKGYFIPPTIFSDVPNSSKLSQEEIFGPVGVVASFSTYEE 418
            + P                + GY++ PTI +DV  S ++++EEIFGPV VV SF  Y+E
Sbjct: 360 CKVPLGGLGAPEPIANDPALANGYYVKPTILADVKASYRIAKEEIFGPVIVVGSFKDYKE 419

Query: 419 AIKLANDSSYGLASCVFSENARTTAQFARDIRAGTVWINSSNDEEISVPFGGFKMSGIGR 478
           A+ +ANDS YGL S +FS++  T  +FA+D+ AG VWINSSND +I+VPFGG KMSG GR
Sbjct: 420 ALDIANDSDYGLGSAIFSKDIVTCHKFAQDVEAGMVWINSSNDVDINVPFGGVKMSGHGR 479

Query: 479 ELGRNGVDSYLQTKA 493
           ELG  G+ ++   K+
Sbjct: 480 ELGEYGLANFTNVKS 494

>Kwal_23.3500
          Length = 503

 Score =  441 bits (1135), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 236/497 (47%), Positives = 318/497 (63%), Gaps = 18/497 (3%)

Query: 7   VNIPQLNITYEQPLGLFINNEFVKSSDGKKIESINPSTEESIVSFFAA-SEKDVNSAVTA 65
           V +P L  +Y QPLGLFINNE+V S   +KIES + +T E I +  AA +  DV+ AV+A
Sbjct: 6   VQLP-LGGSYTQPLGLFINNEYVDSHSSEKIESFDAATGEVIAAVQAADASVDVDLAVSA 64

Query: 66  ARDAFENNWSKTSGEQRGILLSKLFDLIERDKLLLAAIETLDSGKPYHSNSLADLEQILQ 125
           AR AF   W  T   ++  LL KL  L+E +K +LAA+E+LDSGKP  SN++ D+E +  
Sbjct: 65  ARAAFPG-WRDTPTTEKRDLLLKLASLVEEEKEMLAAVESLDSGKPLGSNAIHDVEALAG 123

Query: 126 LTRYYAGGADKFTGGEYIPLNQDKYAYTMKVPYGVVAQIVPWNYPLAMASWKIQSCLAAG 185
           + +YYAG  DK  G  Y P  Q +  YT+  P GVV  I+P+NYPL M +WK  + +A G
Sbjct: 124 ILKYYAGWVDKAQGQSYAPSTQ-RLTYTLHQPLGVVGCIIPFNYPLGMMAWK-WTAVATG 181

Query: 186 NTIVIKPAENTSLSLLYFAQLVKEAGFPPGVLNILPGYGSVTGTAMASHTDIDKIAFTGS 245
           NT V K AE T LS+LYFAQLV  AGFPPGV N+L G G+  G AMA HT IDKIAFTGS
Sbjct: 182 NTTVFKSAEQTPLSILYFAQLVVRAGFPPGVFNVLSGRGATVGDAMARHTGIDKIAFTGS 241

Query: 246 TAVGQKVMSLAAQSNLKAVTLECGGKSPCLIFADANLDEAIPWVAGGIFYNSGQNCTANS 305
           T+VGQ++   AA  NLKA+TLECGGKSP L+FADA+ ++A+ W A GIFYN GQ C+  S
Sbjct: 242 TSVGQQIQRTAA-VNLKALTLECGGKSPALVFADADFEQAVRWTAAGIFYNMGQICSGTS 300

Query: 306 RIYVHEDIYEEFLTKFEEYAKSNWKFGAKFDPFDKDCTLGPVISKVQYDRIQSYVEHG-- 363
           R YV + IY++F+     +    +  G    P      +GP +S+ Q +R+Q+Y+  G  
Sbjct: 301 RCYVEDSIYDKFVDALAAHVADTYVVGP---PSQSTTRVGPQVSRTQQERVQNYIRKGVE 357

Query: 364 -KASEKLGFKEFAE------YPSKGYFIPPTIFSDVPNSSKLSQEEIFGPVGVVASFSTY 416
             A   LG +   E          G+++ PTI +DV  S  +++EEIFGPV  V+ FS Y
Sbjct: 358 EGARLVLGGEGLPETIANDERHRNGFYVRPTILADVKQSHTVAREEIFGPVIAVSKFSDY 417

Query: 417 EEAIKLANDSSYGLASCVFSENARTTAQFARDIRAGTVWINSSNDEEISVPFGGFKMSGI 476
           +EA++LANDS YGL S +F+ +     +FA ++ +G  +INSSN+ + + PFGG KMSG 
Sbjct: 418 DEALRLANDSEYGLGSAIFTSDLNRAHKFASEVESGICYINSSNELDPACPFGGIKMSGY 477

Query: 477 GRELGRNGVDSYLQTKA 493
           GRELG  G+ ++   KA
Sbjct: 478 GRELGEYGLANFTNVKA 494

>Kwal_23.5911
          Length = 538

 Score =  442 bits (1138), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 229/493 (46%), Positives = 316/493 (64%), Gaps = 8/493 (1%)

Query: 1   MSLYETVNIPQLNITYEQPLGLFINNEFVKSSDGKKIESINPSTEESIVSFFAASEKDVN 60
           + L   + +P   +TY+QP GLFIN EFV S   K  E +NPSTE+ I   + A E DV+
Sbjct: 44  LPLRVPITLPS-GVTYDQPTGLFINGEFVPSRQHKTFEVLNPSTEQEIAHVYEAREDDVD 102

Query: 61  SAVTAARDAFENNWSKTSGEQRGILLSKLFDLIERDKLLLAAIETLDSGKPYHSNSLADL 120
            A+ AA+ AFE+ WS    E R   L KL DL+++   +LA IE+LD+GK     S  D+
Sbjct: 103 VAIAAAKRAFEDKWSTADPEFRSRCLYKLADLVDQHAEILAGIESLDNGKSLLC-SRTDV 161

Query: 121 EQILQLTRYYAGGADKFTGGEYIPLNQDKYAYTMKVPYGVVAQIVPWNYPLAMASWKIQS 180
           + + +  R  AG ADK  G   I      ++YT++ P GV AQI+PWN+PL M SWK+  
Sbjct: 162 DLVAKYLRSCAGWADKIFG-RTIDTGSGHFSYTLREPLGVCAQIIPWNFPLLMWSWKLGP 220

Query: 181 CLAAGNTIVIKPAENTSLSLLYFAQLVKEAGFPPGVLNILPGYGSVTGTAMASHTDIDKI 240
            LA GNT+V+KPAE T LS LY +QLV+EAG P GV+NILPG+G + G  + +H D+ KI
Sbjct: 221 ALATGNTVVLKPAEATPLSALYASQLVQEAGIPAGVVNILPGFGKLLGERLCTHKDVKKI 280

Query: 241 AFTGSTAVGQKVMSLAAQSNLKAVTLECGGKSPCLIFADANLDEAIPWVAGGIFYNSGQN 300
           AFTGSTA G+ +M  AA   +K VTLE GGKSP ++FADA+L++A+  +A GIF+NSG+ 
Sbjct: 281 AFTGSTATGRHIMRTAA-GTIKKVTLELGGKSPNIVFADADLEKAVRNIAFGIFFNSGEV 339

Query: 301 CTANSRIYVHEDIYEEFLTKFEEYAKSNWKFGAKFDPFDKDCTLGPVISKVQYDRIQSYV 360
           C A SR+YV + +YEE L KF+ Y ++  K G   DPF +    G   S++Q D+I  YV
Sbjct: 340 CCAGSRVYVQDTVYEEVLEKFKAYTET-LKVG---DPFQEGVFQGSQTSQMQIDKILDYV 395

Query: 361 EHGKASEKLGFKEFAEYPSKGYFIPPTIFSDVPNSSKLSQEEIFGPVGVVASFSTYEEAI 420
           + G A           +  KGYF+ PTIF+DV    ++ +EEIFGP+  ++ FST +E I
Sbjct: 396 QVGTAEGARVITGGERHGDKGYFVKPTIFADVTEDMRIVKEEIFGPIVTISKFSTVDEVI 455

Query: 421 KLANDSSYGLASCVFSENARTTAQFARDIRAGTVWINSSNDEEISVPFGGFKMSGIGREL 480
           ++ANDS YGLA+ + +++       +  ++AGTVWIN+ N+   SVPFGGF  SGIGRE+
Sbjct: 456 EMANDSEYGLAAGIHTKDVNKAIDVSNRVKAGTVWINTYNNFHQSVPFGGFGQSGIGREM 515

Query: 481 GRNGVDSYLQTKA 493
           G   +D+Y Q KA
Sbjct: 516 GAEALDNYTQVKA 528

>YER073W (ALD5) [1504] chr5 (304027..305589) Mitochondrial aldehyde
           dehydrogenase [1563 bp, 520 aa]
          Length = 520

 Score =  437 bits (1125), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 226/479 (47%), Positives = 308/479 (64%), Gaps = 7/479 (1%)

Query: 15  TYEQPLGLFINNEFVKSSDGKKIESINPSTEESIVSFFAASEKDVNSAVTAARDAFENNW 74
           TYEQP GLFIN EFV S   K  + INPS EE I + + A E DV+ AV AA+ AFE  W
Sbjct: 39  TYEQPTGLFINGEFVASKQKKTFDVINPSNEEKITTVYKAMEDDVDEAVAAAKKAFETKW 98

Query: 75  SKTSGEQRGILLSKLFDLIERDKLLLAAIETLDSGKPYHSNSLADLEQILQLTRYYAGGA 134
           S    E R   L  L DL+E+ +  LAAIE++D+GK     +  D+  + +  R   G A
Sbjct: 99  SIVEPEVRAKALFNLADLVEKHQETLAAIESMDNGKSLFC-ARGDVALVSKYLRSCGGWA 157

Query: 135 DKFTGGEYIPLNQDKYAYTMKVPYGVVAQIVPWNYPLAMASWKIQSCLAAGNTIVIKPAE 194
           DK  G   I   ++ + Y++K P GV  QI+PWN+PL M SWKI   LA GNT+V+KPAE
Sbjct: 158 DKIYG-NVIDTGKNHFTYSIKEPLGVCGQIIPWNFPLLMWSWKIGPALATGNTVVLKPAE 216

Query: 195 NTSLSLLYFAQLVKEAGFPPGVLNILPGYGSVTGTAMASHTDIDKIAFTGSTAVGQKVMS 254
            T LS L+ +QL +EAG P GV+NILPG G V G  +++H D+ KIAFTGSTA G+ +M 
Sbjct: 217 TTPLSALFASQLCQEAGIPAGVVNILPGSGRVVGERLSAHPDVKKIAFTGSTATGRHIMK 276

Query: 255 LAAQSNLKAVTLECGGKSPCLIFADANLDEAIPWVAGGIFYNSGQNCTANSRIYVHEDIY 314
           +AA + +K VTLE GGKSP ++FADA+LD+A+  +A GIFYNSG+ C A SRIY+ + +Y
Sbjct: 277 VAADT-VKKVTLELGGKSPNIVFADADLDKAVKNIAFGIFYNSGEVCCAGSRIYIQDTVY 335

Query: 315 EEFLTKFEEYAKSNWKFGAKFDPFDKDCTLGPVISKVQYDRIQSYVEHGKASEKLGFKEF 374
           EE L K ++Y +S  K G   DPFD++   G   S  Q  +I  YV+  K+         
Sbjct: 336 EEVLQKLKDYTES-LKVG---DPFDEEVFQGAQTSDKQLHKILDYVDVAKSEGARLVTGG 391

Query: 375 AEYPSKGYFIPPTIFSDVPNSSKLSQEEIFGPVGVVASFSTYEEAIKLANDSSYGLASCV 434
           A + SKGYF+ PT+F+DV    ++ +EE+FGP+  V+ FST +E I +ANDS YGLA+ +
Sbjct: 392 ARHGSKGYFVKPTVFADVKGDMRIVKEEVFGPIVTVSKFSTVDEVIAMANDSQYGLAAGI 451

Query: 435 FSENARTTAQFARDIRAGTVWINSSNDEEISVPFGGFKMSGIGRELGRNGVDSYLQTKA 493
            + +       ++ ++AGTVWIN+ N+   +VPFGGF  SGIGRE+G   + +Y QTK+
Sbjct: 452 HTNDINKAVDVSKRVKAGTVWINTYNNFHQNVPFGGFGQSGIGREMGEAALSNYTQTKS 510

>KLLA0E23144g complement(2052418..2053941) highly similar to
           sp|P54115 Saccharomyces cerevisiae YPL061w ALD6 aldehyde
           dehydrogenase, cytosolic, start by similarity
          Length = 507

 Score =  431 bits (1109), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 227/488 (46%), Positives = 313/488 (64%), Gaps = 6/488 (1%)

Query: 6   TVNIPQLNITYEQPLGLFINNEFVKSSDGKKIESINPSTEESIVSFFAASEKDVNSAVTA 65
           ++ +P   +TY+QP GLFINN+F+KS DGK ++  NPSTEE IV   +A+ +DV  AV A
Sbjct: 20  SITLPN-GLTYQQPTGLFINNQFIKSQDGKTLKVENPSTEEIIVEVQSATSQDVEYAVEA 78

Query: 66  ARDAFENNWSKTSGEQRGILLSKLFDLIERDKLLLAAIETLDSGKPYHSNSLADLEQILQ 125
           A  AF + WS    ++RG LL KL DLIE  K L+A+IE+ D+GK   + +  D+  ++ 
Sbjct: 79  ADAAFNSEWSTMDPKKRGSLLFKLADLIEAQKELIASIESADNGKTL-ALARGDVGLVID 137

Query: 126 LTRYYAGGADKFTGGEYIPLNQDKYAYTMKVPYGVVAQIVPWNYPLAMASWKIQSCLAAG 185
             R  AG ADK  GG  I        +T K P GV  QI+PWN+PL M SWKI   L AG
Sbjct: 138 YIRSAAGYADKL-GGRTINTGDGYANFTYKEPLGVCGQIIPWNFPLMMLSWKIAPALVAG 196

Query: 186 NTIVIKPAENTSLSLLYFAQLVKEAGFPPGVLNILPGYGSVTGTAMASHTDIDKIAFTGS 245
           NT+++KPA  T L+ L+FA L KEAG P GV+NI+PG G   G  + +H  I KIAFTGS
Sbjct: 197 NTVILKPASPTPLNALFFASLCKEAGIPAGVVNIVPGPGRSVGDTITNHPKIRKIAFTGS 256

Query: 246 TAVGQKVMSLAAQSNLKAVTLECGGKSPCLIFADANLDEAIPWVAGGIFYNSGQNCTANS 305
           T +G+ V   AAQSNLK VTLE GGKS  L+F DAN+ + IP +  GIF N+GQ C++ S
Sbjct: 257 TDIGRDVAIKAAQSNLKKVTLELGGKSAHLVFEDANIKKTIPNLVNGIFKNAGQICSSGS 316

Query: 306 RIYVHEDIYEEFLTKFEEYAKSNWKFGAKFDPFDKDCTLGPVISKVQYDRIQSYVEHGKA 365
           RIYV + IY++ L++F+ Y ++  K G+   PFD+      + +K Q++ I +Y++ GK 
Sbjct: 317 RIYVQDTIYDQLLSEFKTYLETEIKVGS---PFDESNFQAAINNKAQFETILNYIDIGKK 373

Query: 366 SEKLGFKEFAEYPSKGYFIPPTIFSDVPNSSKLSQEEIFGPVGVVASFSTYEEAIKLAND 425
                        +KGYFI PT+F +V    ++ +EEIFGPV  ++ FST +EA+ LAND
Sbjct: 374 EGASILTGGERVGNKGYFIKPTVFYNVKEDMRIVKEEIFGPVVTISKFSTVDEAVALAND 433

Query: 426 SSYGLASCVFSENARTTAQFARDIRAGTVWINSSNDEEISVPFGGFKMSGIGRELGRNGV 485
           S +GL + + +EN     + A+ ++AGTVWIN+ ND + +VPFGG+K SG GRE+G    
Sbjct: 434 SEFGLGAGIETENISVALKVAKRLKAGTVWINTYNDFDAAVPFGGYKQSGYGREMGEEAF 493

Query: 486 DSYLQTKA 493
           +SY Q KA
Sbjct: 494 ESYTQIKA 501

>CAGL0D06688g 639883..641457 highly similar to sp|P46367
           Saccharomyces cerevisiae YOR374w ALD4 or sp|P40047
           Saccharomyces cerevisiae YER073w ALD5, hypothetical
           start
          Length = 524

 Score =  426 bits (1094), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 225/494 (45%), Positives = 311/494 (62%), Gaps = 9/494 (1%)

Query: 1   MSLYETVNIPQLNITYEQPLGLFINNEFVKSSDGKKIESINPSTEESIVSFFAASEKDVN 60
           + L+  + +P   + YEQP GLFINN+FV S   K  E INPSTEE I   +   E DV 
Sbjct: 33  LPLHVPIKLPN-GLEYEQPTGLFINNQFVPSKQHKTFEVINPSTEEEICHIYEGREDDVE 91

Query: 61  SAVTAARDAFEN-NWSKTSGEQRGILLSKLFDLIERDKLLLAAIETLDSGKPYHSNSLAD 119
           SAV AA  AF+N +W+     +RG  L KL +LIE+DK ++A+IE+LD+GK  +S +  D
Sbjct: 92  SAVQAADTAFKNGSWTDIDPFERGQALYKLAELIEKDKEIVASIESLDNGKAINS-ARGD 150

Query: 120 LEQILQLTRYYAGGADKFTGGEYIPLNQDKYAYTMKVPYGVVAQIVPWNYPLAMASWKIQ 179
           ++ ++   +  AG ADK  G   +    + + Y  K P GV  QI+PWN+PL M +WKI 
Sbjct: 151 VQLVINYLKSSAGVADKIDG-RLVNTGSNYFNYVKKEPLGVCGQIIPWNFPLLMWAWKIA 209

Query: 180 SCLAAGNTIVIKPAENTSLSLLYFAQLVKEAGFPPGVLNILPGYGSVTGTAMASHTDIDK 239
             L  GNT+V+K AE+T LS LY ++ + +AG PPGV+NI+ G+G + G A+ +H  I K
Sbjct: 210 PALVTGNTVVLKTAESTPLSALYVSKYIPKAGIPPGVINIVSGFGKIVGEALTTHPKIKK 269

Query: 240 IAFTGSTAVGQKVMSLAAQSNLKAVTLECGGKSPCLIFADANLDEAIPWVAGGIFYNSGQ 299
           IAFTGSTA G+ + S AAQ+ LK VTLE GGKSP ++FADA+L +A+  +  GI+YNSG+
Sbjct: 270 IAFTGSTATGKHIYSSAAQT-LKKVTLELGGKSPNIVFADADLKKAVQNIILGIYYNSGE 328

Query: 300 NCTANSRIYVHEDIYEEFLTKFEEYAKSNWKFGAKFDPFDKDCTLGPVISKVQYDRIQSY 359
            C A SR+YV E IY+EF  +F+  A    K G   +PFD+    G   S++Q D+I SY
Sbjct: 329 VCCAGSRVYVEESIYDEFAQEFKT-ASEALKVG---NPFDESTFQGAQTSQMQLDKILSY 384

Query: 360 VEHGKASEKLGFKEFAEYPSKGYFIPPTIFSDVPNSSKLSQEEIFGPVGVVASFSTYEEA 419
           VE GK               KGYFI PTIF DV    ++ +EEIFGPV  V  F   +  
Sbjct: 385 VEIGKKEGATLITGGERIGEKGYFIKPTIFGDVTEDMRIVKEEIFGPVVTVTKFKDLDHV 444

Query: 420 IKLANDSSYGLASCVFSENARTTAQFARDIRAGTVWINSSNDEEISVPFGGFKMSGIGRE 479
           +++ANDS YGLA+ + + N  +  + A  ++AGTVW+N+ ND   ++PFGGF  SG+GRE
Sbjct: 445 VQMANDSEYGLAAGIHTTNINSAVKVADRLKAGTVWVNTYNDFHQNIPFGGFNASGLGRE 504

Query: 480 LGRNGVDSYLQTKA 493
           + +  +D YLQ KA
Sbjct: 505 MSKEALDGYLQAKA 518

>CAGL0J03212g 307754..309307 highly similar to sp|P40047
           Saccharomyces cerevisiae YER073w ALD5 or sp|P46367
           Saccharomyces cerevisiae YOR374w ALD4, start by
           similarity
          Length = 517

 Score =  422 bits (1086), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 222/487 (45%), Positives = 309/487 (63%), Gaps = 8/487 (1%)

Query: 7   VNIPQLNITYEQPLGLFINNEFVKSSDGKKIESINPSTEESIVSFFAASEKDVNSAVTAA 66
           V +P   I Y QP GLFIN EFVKS +GK  + +NPSTEE+I + + A   DV+ AV AA
Sbjct: 29  VTLPN-GIKYMQPTGLFINGEFVKSHEGKTFDVLNPSTEETIATLYEAQAADVDIAVKAA 87

Query: 67  RDAFENNWSKTSGEQRGILLSKLFDLIERDKLLLAAIETLDSGKPYHSNSLADLEQILQL 126
           ++AFEN+WS+   E R   L  L DL+E +   LA I++LD+GK     S AD+  + + 
Sbjct: 88  KEAFENHWSREDPEVRARALFNLADLVEANLETLAGIDSLDNGKSLLC-SRADVALVAKY 146

Query: 127 TRYYAGGADKFTGGEYIPLNQDKYAYTMKVPYGVVAQIVPWNYPLAMASWKIQSCLAAGN 186
            R   G ADK  G + I   +  + Y++K P GV  QI+PWN+PL M SWKI   LA GN
Sbjct: 147 LRSCGGWADKIYG-DVIDTGKSHFTYSVKEPLGVCGQIIPWNFPLLMWSWKIGPALATGN 205

Query: 187 TIVIKPAENTSLSLLYFAQLVKEAGFPPGVLNILPGYGSVTGTAMASHTDIDKIAFTGST 246
           T+V+KPAE T LS L+ ++L +EAG P GV+NI+PG G   G  + +H DI K+AFTGST
Sbjct: 206 TVVLKPAELTPLSALFASKLCQEAGIPAGVVNIIPGPGKTVGERICTHPDIKKVAFTGST 265

Query: 247 AVGQKVMSLAAQSNLKAVTLECGGKSPCLIFADANLDEAIPWVAGGIFYNSGQNCTANSR 306
           A G ++M  AA S +K VTLE GGKSP ++FADA+L++A+  +A GIF+NSG+ C A SR
Sbjct: 266 ATGSRIMKTAADS-IKKVTLELGGKSPNIVFADADLEQAVENIAHGIFFNSGEVCCAGSR 324

Query: 307 IYVHEDIYEEFLTKFEEYAKSNWKFGAKFDPFDKDCTLGPVISKVQYDRIQSYVEHGKAS 366
           IYV +  Y+E L + ++Y +S  K G   +PF  +   G   S+ Q D+I  YV+ GK  
Sbjct: 325 IYVQDKCYDEVLDRLKKYTES-LKVG---NPFGDNTYQGSQTSQQQLDKILEYVDIGKQE 380

Query: 367 EKLGFKEFAEYPSKGYFIPPTIFSDVPNSSKLSQEEIFGPVGVVASFSTYEEAIKLANDS 426
                        KGYF  PT+F+DV  + ++ ++EIFGP+  V+ FST +E I +ANDS
Sbjct: 381 GARIVTGGERIGEKGYFFKPTVFADVKENMRIVKDEIFGPIVTVSQFSTVDEVIAMANDS 440

Query: 427 SYGLASCVFSENARTTAQFARDIRAGTVWINSSNDEEISVPFGGFKMSGIGRELGRNGVD 486
            YGLA+ + + +     + +  ++AGT+WIN+ N    +VPFGGF  SGIGRE+G   +D
Sbjct: 441 QYGLAAGIHTNDVNKAVEVSSRLKAGTIWINTYNAFHQNVPFGGFGQSGIGREMGSAALD 500

Query: 487 SYLQTKA 493
           +Y Q K+
Sbjct: 501 NYTQVKS 507

>Scas_663.4
          Length = 520

 Score =  422 bits (1086), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 228/481 (47%), Positives = 305/481 (63%), Gaps = 8/481 (1%)

Query: 14  ITYEQPLGLFINNEFVKSSDGKKIESINPSTEESIVSFFAASEKDVNSAVTAARDAFEN- 72
           + +EQP GLFINN+ V S  GK  E INPSTE+ I   +   E DV+ AV AA DAF N 
Sbjct: 40  LEFEQPTGLFINNKNVPSKQGKTFEVINPSTEDEICHIYEGREDDVDIAVKAASDAFNNG 99

Query: 73  NWSKTSGEQRGILLSKLFDLIERDKLLLAAIETLDSGKPYHSNSLADLEQILQLTRYYAG 132
           +WS      RG  L KL +LIE+DK ++A+IE+LD+GK  +S +  D+E ++   +  AG
Sbjct: 100 SWSTIDPIYRGQALYKLAELIEKDKEIIASIESLDNGKAINS-ARGDVELVVNYLKSSAG 158

Query: 133 GADKFTGGEYIPLNQDKYAYTMKVPYGVVAQIVPWNYPLAMASWKIQSCLAAGNTIVIKP 192
            A+K  G   I    + + YT + P GV  QI+PWN+PL M +WKI   L  GNT+V+K 
Sbjct: 159 MANKLDG-RLIDSGSNYFNYTKREPLGVCGQIIPWNFPLLMWAWKIAPALITGNTVVLKT 217

Query: 193 AENTSLSLLYFAQLVKEAGFPPGVLNILPGYGSVTGTAMASHTDIDKIAFTGSTAVGQKV 252
           AE+T LS LY A+ + EAG PPGV+NI+ G+G + G AM SH  I KIAFTGSTA G+ +
Sbjct: 218 AESTPLSALYAAKYIPEAGIPPGVVNIVSGFGKIVGEAMTSHPLIKKIAFTGSTATGKHI 277

Query: 253 MSLAAQSNLKAVTLECGGKSPCLIFADANLDEAIPWVAGGIFYNSGQNCTANSRIYVHED 312
              AA S LK VTLE GGKSP +IFADANL +A+  V  GI+YNSG+ C A SR+YV E 
Sbjct: 278 YQNAAAS-LKKVTLELGGKSPNIIFADANLKKAVQNVITGIYYNSGEVCCAGSRVYVQES 336

Query: 313 IYEEFLTKFEEYAKSNWKFGAKFDPFDKDCTLGPVISKVQYDRIQSYVEHGKASEKLGFK 372
           IY+E + + +  A    K G   DPFD+    G   S++Q ++I  YVE GK        
Sbjct: 337 IYDELIEEIKA-ASEAVKVG---DPFDETTFQGAQTSQMQLNKILKYVEIGKNEGAQLIT 392

Query: 373 EFAEYPSKGYFIPPTIFSDVPNSSKLSQEEIFGPVGVVASFSTYEEAIKLANDSSYGLAS 432
                  KGYF+ PTIF  V    ++ +EEIFGPV  ++ F T +E +++ANDS YGLA+
Sbjct: 393 GGERVGKKGYFVKPTIFGGVQEDMRIVKEEIFGPVVTISKFKTLDEVVQMANDSEYGLAA 452

Query: 433 CVFSENARTTAQFARDIRAGTVWINSSNDEEISVPFGGFKMSGIGRELGRNGVDSYLQTK 492
            + + N  T  + A  ++AGTVWIN+ ND   +VPFGGF  SG+GRE+G   +++YLQ+K
Sbjct: 453 GIHTSNINTATKVADRLKAGTVWINTYNDFHCNVPFGGFNASGLGREMGTEALENYLQSK 512

Query: 493 A 493
           A
Sbjct: 513 A 513

>KLLA0F00440g 31019..32587 highly similar to sp|P46367 Saccharomyces
           cerevisiae YOR374w ALD4 aldehyde dehydrogenase,
           mitochondrial, start by similarity
          Length = 522

 Score =  422 bits (1084), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 232/494 (46%), Positives = 307/494 (62%), Gaps = 9/494 (1%)

Query: 1   MSLYETVNIPQLNITYEQPLGLFINNEFVKSSDGKKIESINPSTEESIVSFFAASEKDVN 60
           + L   V++P   I+YEQP GLFINN+FV S  GK  E ++PSTEE I   +   E+DV+
Sbjct: 31  LPLKVKVDLPN-GISYEQPTGLFINNQFVPSKQGKTFEVLSPSTEEEITHVYEGREEDVD 89

Query: 61  SAVTAARDAFENN-WSKTSGEQRGILLSKLFDLIERDKLLLAAIETLDSGKPYHSNSLAD 119
           +AV AA  AF++  WSK     R   LSKL D IE+D   +A+IE+LD+GK   S++  D
Sbjct: 90  AAVEAADKAFKSGVWSKVDPLVRSQCLSKLADYIEKDLDTIASIESLDNGKAI-SSAKGD 148

Query: 120 LEQILQLTRYYAGGADKFTGGEYIPLNQDKYAYTMKVPYGVVAQIVPWNYPLAMASWKIQ 179
           ++ ++   R  AG ADK   G  I      ++YT++ P GV  QI+PWN+PL M +WKI 
Sbjct: 149 VQLVVNYLRSAAGYADK-VDGRVIDTGSTHFSYTVREPLGVCGQIIPWNFPLLMWAWKIA 207

Query: 180 SCLAAGNTIVIKPAENTSLSLLYFAQLVKEAGFPPGVLNILPGYGSVTGTAMASHTDIDK 239
             LA GNT+V+K AE+T LS LY +Q + +AG P GV+NI+ G+G + G A+ +H  I K
Sbjct: 208 PALATGNTVVLKTAESTPLSALYVSQYIPKAGIPDGVVNIVSGFGKIVGEAITTHPKIKK 267

Query: 240 IAFTGSTAVGQKVMSLAAQSNLKAVTLECGGKSPCLIFADANLDEAIPWVAGGIFYNSGQ 299
           +AFTGSTA G+ +   A   NLK VTLE GGKSP ++FADANL  A+     GI+YNSG+
Sbjct: 268 VAFTGSTATGRHIYQNAG-VNLKKVTLELGGKSPNVVFADANLKSAVQNSLLGIYYNSGE 326

Query: 300 NCTANSRIYVHEDIYEEFLTKFEEYAKSNWKFGAKFDPFDKDCTLGPVISKVQYDRIQSY 359
            C A SR+YV E IY++FL + +  A    K G   DPFD +   G   S+ Q D+I  Y
Sbjct: 327 VCCAGSRLYVEESIYDDFLKEIKS-ASEALKVG---DPFDAETFQGAQTSQNQLDKILKY 382

Query: 360 VEHGKASEKLGFKEFAEYPSKGYFIPPTIFSDVPNSSKLSQEEIFGPVGVVASFSTYEEA 419
           VE GK               KGYF+ PTIF+DV  S ++ +EEIFGPV  V  F T +E 
Sbjct: 383 VEIGKNEGATLITGGERIGDKGYFVRPTIFADVEESMRIVKEEIFGPVVTVTKFKTIDEL 442

Query: 420 IKLANDSSYGLASCVFSENARTTAQFARDIRAGTVWINSSNDEEISVPFGGFKMSGIGRE 479
           I+ ANDS YGLA+ + + N  T  Q +  + AGTVWIN+ ND    VPFGGF  SGIGRE
Sbjct: 443 IEKANDSEYGLAAGIHTSNINTAIQVSNRLNAGTVWINTYNDFHHCVPFGGFNASGIGRE 502

Query: 480 LGRNGVDSYLQTKA 493
           +G   +D+Y Q KA
Sbjct: 503 MGSEALDNYTQVKA 516

>YOR374W (ALD4) [5149] chr15 (1039836..1041395) Mitochondrial
           aldehyde dehydrogenase [1560 bp, 519 aa]
          Length = 519

 Score =  417 bits (1073), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 225/489 (46%), Positives = 308/489 (62%), Gaps = 24/489 (4%)

Query: 14  ITYEQPLGLFINNEFVKSSDGKKIESINPSTEESIVSFFAASEKDVNSAVTAARDAFEN- 72
           + YEQP GLFINN+FV S   K  E INPSTEE I   +   E DV  AV AA  AF N 
Sbjct: 39  LEYEQPTGLFINNKFVPSKQNKTFEVINPSTEEEICHIYEGREDDVEEAVQAADRAFSNG 98

Query: 73  NWSKTSGEQRGILLSKLFDLIERDKLLLAAIETLDSGKPYHSNSLADLEQILQLTRYYAG 132
           +W+      RG  L +L +LIE+DK ++A+IETLD+GK   S+S  D++ ++   +  AG
Sbjct: 99  SWNGIDPIDRGKALYRLAELIEQDKDVIASIETLDNGKAI-SSSRGDVDLVINYLKSSAG 157

Query: 133 GADKFTGGEYIPLNQDKYAYTMKVPYGVVAQIVPWNYPLAMASWKIQSCLAAGNTIVIKP 192
            ADK  G   I   +  ++YT + P GV  QI+PWN+PL M +WKI   L  GNT+V+K 
Sbjct: 158 FADKIDG-RMIDTGRTHFSYTKRQPLGVCGQIIPWNFPLLMWAWKIAPALVTGNTVVLKT 216

Query: 193 AENTSLSLLYFAQLVKEAGFPPGVLNILPGYGSVTGTAMASHTDIDKIAFTGSTAVGQKV 252
           AE+T LS LY ++ + +AG PPGV+NI+ G+G + G A+ +H  I K+AFTGSTA G+ +
Sbjct: 217 AESTPLSALYVSKYIPQAGIPPGVINIVSGFGKIVGEAITNHPKIKKVAFTGSTATGRHI 276

Query: 253 MSLAAQSNLKAVTLECGGKSPCLIFADANLDEAIPWVAGGIFYNSGQNCTANSRIYVHED 312
              AA + LK VTLE GGKSP ++FADA L +A+  +  GI+YNSG+ C A SR+YV E 
Sbjct: 277 YQSAA-AGLKKVTLELGGKSPNIVFADAELKKAVQNIILGIYYNSGEVCCAGSRVYVEES 335

Query: 313 IYEEFLTKFEEYAKSNWKFGAKFDPFDKDCTLGPVISKVQYDRIQSYVEHGK-------- 364
           IY++F+ +F+  ++S  K G   DPFD+    G   S++Q ++I  YV+ GK        
Sbjct: 336 IYDKFIEEFKAASES-IKVG---DPFDESTFQGAQTSQMQLNKILKYVDIGKNEGATLIT 391

Query: 365 ASEKLGFKEFAEYPSKGYFIPPTIFSDVPNSSKLSQEEIFGPVGVVASFSTYEEAIKLAN 424
             E+LG        SKGYFI PT+F DV    ++ +EEIFGPV  V  F + +E I +AN
Sbjct: 392 GGERLG--------SKGYFIKPTVFGDVKEDMRIVKEEIFGPVVTVTKFKSADEVINMAN 443

Query: 425 DSSYGLASCVFSENARTTAQFARDIRAGTVWINSSNDEEISVPFGGFKMSGIGRELGRNG 484
           DS YGLA+ + + N  T  + A  + AGTVWIN+ ND   +VPFGGF  SG+GRE+  + 
Sbjct: 444 DSEYGLAAGIHTSNINTALKVADRVNAGTVWINTYNDFHHAVPFGGFNASGLGREMSVDA 503

Query: 485 VDSYLQTKA 493
           + +YLQ KA
Sbjct: 504 LQNYLQVKA 512

>CAGL0H05137g complement(495715..497208) highly similar to sp|P54115
           Saccharomyces cerevisiae YPL061w ALD6, hypothetical
           start
          Length = 497

 Score =  417 bits (1071), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 225/493 (45%), Positives = 311/493 (63%), Gaps = 13/493 (2%)

Query: 5   ETVNIPQLNITYEQPLGLFINNEFVKSSDGKKIESINPSTEESIVSFFAASEKDVNSAVT 64
           +T+ +P   +TYEQP GLFINNEFV+SSDGK +   NPST+E IV  F+A+++DV+ AV 
Sbjct: 9   KTIKLPN-GLTYEQPTGLFINNEFVESSDGKTMTIENPSTQEPIVDVFSATKEDVDYAVD 67

Query: 65  AARDAFE-NNWSKTSGEQRGILLSKLFDLIERDKLLLAAIETLDSGKPYHSNSLADLEQI 123
            A  AFE ++W+    + R   LSKL DL+E    L+A+IETLD+GK   + S  D++  
Sbjct: 68  CAERAFEKSDWATQDPKVRARYLSKLADLMEEQLELIASIETLDNGKTI-ALSRGDVQLS 126

Query: 124 LQLTRYYAGGADKFTGGEYIPLNQDKYAYTMKVPYGVVAQIVPWNYPLAMASWKIQSCLA 183
           +   R  A  ADK  G   I        YT++ P GV AQI+PWN+PL M SWK+   LA
Sbjct: 127 INCIRDAASYADKVDG-RSIDTGDGYMNYTIREPIGVCAQIIPWNFPLMMLSWKVGPALA 185

Query: 184 AGNTIVIKPAENTSLSLLYFAQLVKEAGFPPGVLNILPGYGSVTGTAMASHTDIDKIAFT 243
            GN IV+KPA  T L+ LYF+ L K+ G P GV+NI+PG G + GTA+ +H  + K+AFT
Sbjct: 186 MGNCIVLKPASATPLNALYFSSLCKQVGIPAGVVNIIPGPGGMVGTALTTHPKVRKVAFT 245

Query: 244 GSTAVGQKVMSLAAQSNLKAVTLECGGKSPCLIFADANLDEAIPWVAGGIFYNSGQNCTA 303
           GST +G+ +   A+ SNLK +TLE GGKS  L+F DANL++ +P +  GIF N+GQ C++
Sbjct: 246 GSTDIGKDIAVKASASNLKKITLELGGKSAHLVFNDANLEKTLPNLVNGIFKNAGQICSS 305

Query: 304 NSRIYVHEDIYEEFLTKFEEYAKSNWKFGAKFDPFDKDCTLGPVISKVQYDRIQSYVEHG 363
            SRIY    IY+  L +F+ Y + N K G   +PFD+    G + +K QY+ I  Y+  G
Sbjct: 306 GSRIYAQAGIYDRLLKEFKAYIEKNIKVG---NPFDESNFQGAITNKEQYNTILKYINIG 362

Query: 364 K---ASEKLGFKEFAEYPSKGYFIPPTIFSDVPNSSKLSQEEIFGPVGVVASFSTYEEAI 420
           K   A    G +  AE   KGYFI PT+F DV    ++ +EEIFGP   ++ F   E+ +
Sbjct: 363 KEEGAKVLTGGETAAE---KGYFIKPTVFYDVKEDMRVVKEEIFGPCVTISKFEEIEDGV 419

Query: 421 KLANDSSYGLASCVFSENARTTAQFARDIRAGTVWINSSNDEEISVPFGGFKMSGIGREL 480
            +ANDS +GL + + +EN  T  + A+ + +GTVWIN+ ND +  VPFGG+K SG GRE+
Sbjct: 420 AMANDSEFGLGAGIETENLSTALKVAKMLHSGTVWINTYNDFDSRVPFGGYKQSGYGREM 479

Query: 481 GRNGVDSYLQTKA 493
           G    + Y QTKA
Sbjct: 480 GSEVYECYTQTKA 492

>Kwal_26.6752
          Length = 522

 Score =  416 bits (1068), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 225/494 (45%), Positives = 305/494 (61%), Gaps = 9/494 (1%)

Query: 1   MSLYETVNIPQLNITYEQPLGLFINNEFVKSSDGKKIESINPSTEESIVSFFAASEKDVN 60
           + L   V +P   I YEQP GLFINN+FV++  GK  E I+P+TEE I   + A E DV 
Sbjct: 27  LPLRVPVKMPN-GIEYEQPTGLFINNKFVRAKQGKTFEVISPATEEEITHVYEAREDDVE 85

Query: 61  SAVTAARDAFENN-WSKTSGEQRGILLSKLFDLIERDKLLLAAIETLDSGKPYHSNSLAD 119
            A+ AA  AF++  WS+     R   L+KL +LIE D   +A+IETLD+GK   S +  D
Sbjct: 86  DAIAAADQAFKSGVWSQVDPLVRAKALNKLAELIEDDLETIASIETLDNGKAITS-ARGD 144

Query: 120 LEQILQLTRYYAGGADKFTGGEYIPLNQDKYAYTMKVPYGVVAQIVPWNYPLAMASWKIQ 179
           ++ +    R  AG  DK  G   I      ++YT++ P GV  QI+PWN+PL M +WK+ 
Sbjct: 145 VQLVANYLRSCAGWCDKVDG-RLINTGSTHFSYTVRQPLGVCGQIIPWNFPLLMWAWKVG 203

Query: 180 SCLAAGNTIVIKPAENTSLSLLYFAQLVKEAGFPPGVLNILPGYGSVTGTAMASHTDIDK 239
             LA GNT+V+K AE+T LS LY +Q + +AG PPGV+NI+ G+G + G A+ +H  I K
Sbjct: 204 PALATGNTVVLKTAESTPLSALYVSQFISKAGIPPGVVNIISGFGKIIGEALTTHPKIKK 263

Query: 240 IAFTGSTAVGQKVMSLAAQSNLKAVTLECGGKSPCLIFADANLDEAIPWVAGGIFYNSGQ 299
           IAFTGSTA G+ +   A  SNLK VTLE GGKSP ++F DA+L +A+  +  GI+YNSG+
Sbjct: 264 IAFTGSTATGRHIYQNAG-SNLKKVTLELGGKSPNMVFGDADLKQAVQNIILGIYYNSGE 322

Query: 300 NCTANSRIYVHEDIYEEFLTKFEEYAKSNWKFGAKFDPFDKDCTLGPVISKVQYDRIQSY 359
            C A SR+YV E +Y++FL +F+  A+ N K G   DPFD     G   S++Q  +I  Y
Sbjct: 323 VCCAGSRVYVEESVYDQFLEEFKAAAE-NVKVG---DPFDDATFQGAQTSQMQLSKILKY 378

Query: 360 VEHGKASEKLGFKEFAEYPSKGYFIPPTIFSDVPNSSKLSQEEIFGPVGVVASFSTYEEA 419
           VE GK              +KG+FI PTIF +V    ++ +EEIFGPV  V+ F T +E 
Sbjct: 379 VEIGKEEGATLVTGGERIGNKGFFIKPTIFGNVEEDMRIVKEEIFGPVVTVSKFKTIDEL 438

Query: 420 IKLANDSSYGLASCVFSENARTTAQFARDIRAGTVWINSSNDEEISVPFGGFKMSGIGRE 479
           I+ ANDS YGLA+ V + +     + +  + AGTVW+N+ ND    VPFGGF  SGIGRE
Sbjct: 439 IEKANDSEYGLAAGVHTSDINKALEVSNRVNAGTVWVNTFNDFHHCVPFGGFNASGIGRE 498

Query: 480 LGRNGVDSYLQTKA 493
           +G   +DSY Q KA
Sbjct: 499 MGSEALDSYTQVKA 512

>Sklu_2427.2 YOR374W, Contig c2427 1739-3295
          Length = 518

 Score =  414 bits (1065), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 230/489 (47%), Positives = 301/489 (61%), Gaps = 24/489 (4%)

Query: 14  ITYEQPLGLFINNEFVKSSDGKKIESINPSTEESIVSFFAASEKDVNSAVTAARDAFEN- 72
           I YEQP GLFINN+FV S  GK  E I+PSTEE I   +   E+DV+ AV AA  AF+N 
Sbjct: 39  IEYEQPTGLFINNKFVPSKQGKTFEVISPSTEEEICHIYEGREEDVDLAVEAADKAFKNG 98

Query: 73  NWSKTSGEQRGILLSKLFDLIERDKLLLAAIETLDSGKPYHSNSLADLEQILQLTRYYAG 132
           +WS      R   L+KL DLIE+DK  +A+IE+LD+GK   S +  D+  ++   R  AG
Sbjct: 99  SWSTVDPLVRANALNKLADLIEKDKETIASIESLDNGKAITS-ARGDISLVVNYLRSSAG 157

Query: 133 GADKFTGGEYIPLNQDKYAYTMKVPYGVVAQIVPWNYPLAMASWKIQSCLAAGNTIVIKP 192
            ADK  G   I      ++YT + P  V  QI+PWN+PL M +WKI   LA GNT+V+K 
Sbjct: 158 YADKIDG-RLINTGSTHFSYTRREPLCVCGQIIPWNFPLLMWAWKIAPALATGNTVVLKT 216

Query: 193 AENTSLSLLYFAQLVKEAGFPPGVLNILPGYGSVTGTAMASHTDIDKIAFTGSTAVGQKV 252
           AE+T LS LY +Q + +AG PPGV+NI+ G+G + G A+ +H  I K+AFTGSTA G+ +
Sbjct: 217 AESTPLSALYVSQYIPKAGIPPGVVNIVSGFGKIVGEAITTHPKIKKVAFTGSTATGRHI 276

Query: 253 MSLAAQSNLKAVTLECGGKSPCLIFADANLDEAIPWVAGGIFYNSGQNCTANSRIYVHED 312
              A   NLK VTLE GGKSP +IFADANL EA+  V  GI++NSG+ C A SR+YV E 
Sbjct: 277 YQNAG-VNLKKVTLELGGKSPNIIFADANLKEAVKNVILGIYFNSGEVCCAGSRVYVEES 335

Query: 313 IYEEFLTKFEEYAKSNWKFGAKFDPFDKDCTLGPVISKVQYDRIQSYVEHGK-------- 364
           IY++ + + +  A    K G   DPFD+    G   S+ Q D+I  YVE G+        
Sbjct: 336 IYDKAVEEIKA-ASEAVKVG---DPFDESTFQGAQTSQNQLDKILKYVEIGRKEGATLVT 391

Query: 365 ASEKLGFKEFAEYPSKGYFIPPTIFSDVPNSSKLSQEEIFGPVGVVASFSTYEEAIKLAN 424
             E+LG         KGYFI PTIFSDV  + ++ +EEIFGPV  +  F   E+ ++ AN
Sbjct: 392 GGERLG--------DKGYFIKPTIFSDVEENMRIVKEEIFGPVVTITKFKDVEDLVEKAN 443

Query: 425 DSSYGLASCVFSENARTTAQFARDIRAGTVWINSSNDEEISVPFGGFKMSGIGRELGRNG 484
           DS YGLA+ + + N       +  + AGTVWIN+ ND   SVPFGGF  SGIGRE+G   
Sbjct: 444 DSEYGLAAGIHTSNINNAINVSNRLNAGTVWINTFNDFHHSVPFGGFNASGIGREMGSEA 503

Query: 485 VDSYLQTKA 493
           +D+Y Q KA
Sbjct: 504 LDNYTQVKA 512

>Sklu_2315.3 YPL061W, Contig c2315 5950-7455
          Length = 501

 Score =  410 bits (1053), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 215/480 (44%), Positives = 298/480 (62%), Gaps = 5/480 (1%)

Query: 14  ITYEQPLGLFINNEFVKSSDGKKIESINPSTEESIVSFFAASEKDVNSAVTAARDAFENN 73
           ++YEQP GLFINNEF+KS D K ++  NPSTEE +   ++A++ DV  AV  A  AF ++
Sbjct: 21  LSYEQPTGLFINNEFIKSQDQKTLKVENPSTEEIVAEVYSATKDDVEYAVECADKAFNSS 80

Query: 74  WSKTSGEQRGILLSKLFDLIERDKLLLAAIETLDSGKPYHSNSLADLEQILQLTRYYAGG 133
           WS      R   L KL +L+E  K L+++IE LD+GK   + +  D+  ++   +  AG 
Sbjct: 81  WSTCDPRIRASYLFKLANLVEERKELISSIEALDNGKTL-ALARGDVGLVVDYLKIAAGY 139

Query: 134 ADKFTGGEYIPLNQDKYAYTMKVPYGVVAQIVPWNYPLAMASWKIQSCLAAGNTIVIKPA 193
           ADK  GG  I   +    YT++ P GV  QI+PWN+PL M SWKI   LAAGNT+V+KPA
Sbjct: 140 ADKL-GGRTINTGEGYVNYTLREPVGVCGQIIPWNFPLMMLSWKIAPALAAGNTVVLKPA 198

Query: 194 ENTSLSLLYFAQLVKEAGFPPGVLNILPGYGSVTGTAMASHTDIDKIAFTGSTAVGQKVM 253
             T L+ LYFA L KE G P GV+NI+PG G   G  + +H  I KIAFTGST +G+ V 
Sbjct: 199 SPTPLNALYFASLCKEVGIPDGVVNIVPGPGRSVGDTITNHPKIRKIAFTGSTEIGRDVA 258

Query: 254 SLAAQSNLKAVTLECGGKSPCLIFADANLDEAIPWVAGGIFYNSGQNCTANSRIYVHEDI 313
             AA SNLK VTLE GGKS  L+F D  L++ +  +  GIF N+GQ C++ SRIYV E I
Sbjct: 259 IKAAASNLKKVTLELGGKSAHLVFDDCKLEKTLQNLVNGIFKNAGQICSSGSRIYVQEGI 318

Query: 314 YEEFLTKFEEYAKSNWKFGAKFDPFDKDCTLGPVISKVQYDRIQSYVEHGKASEKLGFKE 373
           ++  L  F+EY ++N K G+   PFD+    G + +K Q+D + +Y+  GK         
Sbjct: 319 HDRLLAAFKEYLENNIKVGS---PFDESNYQGAINNKSQFDTVINYINIGKEEGAKLLTG 375

Query: 374 FAEYPSKGYFIPPTIFSDVPNSSKLSQEEIFGPVGVVASFSTYEEAIKLANDSSYGLASC 433
                 KGYFI PT+F DV    ++ +EEIFGPV  ++ F   E+ + +ANDS +GL + 
Sbjct: 376 GERVGDKGYFIRPTVFYDVKEDMRIVKEEIFGPVVTISKFKDIEDGVAMANDSEFGLGAG 435

Query: 434 VFSENARTTAQFARDIRAGTVWINSSNDEEISVPFGGFKMSGIGRELGRNGVDSYLQTKA 493
           + +EN  T  + ++ ++AGTVW+N+ ND + SVPFGG K SG GRE+G    ++Y Q KA
Sbjct: 436 IETENLSTALKVSKMLKAGTVWVNTYNDFDASVPFGGCKQSGYGREMGEEVFEAYTQVKA 495

>Kwal_27.11976
          Length = 526

 Score =  409 bits (1050), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 218/480 (45%), Positives = 296/480 (61%), Gaps = 5/480 (1%)

Query: 14  ITYEQPLGLFINNEFVKSSDGKKIESINPSTEESIVSFFAASEKDVNSAVTAARDAFENN 73
           +TYEQP GLFINNEFVKS +G  I   +P+TE+ IV   + +++DV  AV  A  AF ++
Sbjct: 46  LTYEQPTGLFINNEFVKSHNGATIAVEDPATEKKIVEVQSGTKEDVEYAVECAEKAFNSS 105

Query: 74  WSKTSGEQRGILLSKLFDLIERDKLLLAAIETLDSGKPYHSNSLADLEQILQLTRYYAGG 133
           WS      R   L KL DLIE+ K L+++IE +D+GK     +  D+  ++   R  AG 
Sbjct: 106 WSTGDPRVRARALLKLADLIEQRKELISSIECMDNGKALFL-AKNDVRIVIDYIRSSAGF 164

Query: 134 ADKFTGGEYIPLNQDKYAYTMKVPYGVVAQIVPWNYPLAMASWKIQSCLAAGNTIVIKPA 193
           ADK  G   I        YT++ P GV  QI+PWN+PL M SWKI   LAAGNT+++KPA
Sbjct: 165 ADKLDG-RTINTGDGYVNYTLREPVGVCGQIIPWNFPLLMLSWKIAPALAAGNTVILKPA 223

Query: 194 ENTSLSLLYFAQLVKEAGFPPGVLNILPGYGSVTGTAMASHTDIDKIAFTGSTAVGQKVM 253
             T L+ LYFA L KEAG P GV+NI+PG G   G  + +H  I KIAFTGST  G+ + 
Sbjct: 224 SPTPLNALYFASLCKEAGIPAGVVNIIPGPGRDVGETLTTHPKIRKIAFTGSTGTGKGIA 283

Query: 254 SLAAQSNLKAVTLECGGKSPCLIFADANLDEAIPWVAGGIFYNSGQNCTANSRIYVHEDI 313
             AAQSNLK VTLE GGKS  ++F DANL++ IP +  GIF N+GQ C++ SRIYV E I
Sbjct: 284 VKAAQSNLKKVTLELGGKSAHMVFNDANLEKTIPNLVNGIFLNAGQICSSGSRIYVQEGI 343

Query: 314 YEEFLTKFEEYAKSNWKFGAKFDPFDKDCTLGPVISKVQYDRIQSYVEHGKASEKLGFKE 373
           Y++ L  F++Y +     G+   PFD+    G + +K Q+D I +YV  GK         
Sbjct: 344 YDKLLPAFKKYVEEVITVGS---PFDESNFQGAINNKAQFDTIMNYVGIGKEEGAKVLTG 400

Query: 374 FAEYPSKGYFIPPTIFSDVPNSSKLSQEEIFGPVGVVASFSTYEEAIKLANDSSYGLASC 433
                 +GYFI PTIF DV    ++ +EEIFGPV  ++ F   E+ + +AN+S +GL + 
Sbjct: 401 GKRSGDQGYFIRPTIFYDVNEDMRIVKEEIFGPVVTISKFKEIEDGVAMANNSEFGLGAG 460

Query: 434 VFSENARTTAQFARDIRAGTVWINSSNDEEISVPFGGFKMSGIGRELGRNGVDSYLQTKA 493
           + +E+  T  + ++ ++AGTVW+N+ ND + SVPFGG K SG G E+G    DSY  TKA
Sbjct: 461 IQTESVSTALKVSKMLKAGTVWVNTYNDFDSSVPFGGCKQSGYGSEMGIEAFDSYTTTKA 520

>Scas_701.14
          Length = 515

 Score =  407 bits (1047), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 226/493 (45%), Positives = 300/493 (60%), Gaps = 9/493 (1%)

Query: 1   MSLYETVNIPQLNITYEQPLGLFINNEFVKSSDGKKIESINPSTEESIVSFFAASEKDVN 60
           + L   V +P   + YEQP GLFIN +FV S   K  E INPSTEE I   + A E DV+
Sbjct: 22  LPLRVPVTLPN-GLKYEQPTGLFINGDFVPSKQNKIFEVINPSTEEVITPVYEAMEDDVD 80

Query: 61  SAVTAARDAFENNWSKTSGEQRGILLSKLFDLIERDKLLLAAIETLDSGKPYHSNSLADL 120
               AA      +WS    E R   L KL +L+E++  LLA+IET D+GK     S  D+
Sbjct: 81  -IAVAAAKKAFKSWSIADPEVRASALFKLANLVEKNAELLASIETADNGKSLLC-SRGDV 138

Query: 121 EQILQLTRYYAGGADKFTGGEYIPLNQDKYAYTMKVPYGVVAQIVPWNYPLAMASWKIQS 180
             + +  R   G ADK  G   I    + +AYT + P GV  QI+PWN+PL M SWKI  
Sbjct: 139 ALVSKYLRSCGGWADKING-NVINTGDNHFAYTTREPLGVCGQIIPWNFPLLMWSWKIGP 197

Query: 181 CLAAGNTIVIKPAENTSLSLLYFAQLVKEAGFPPGVLNILPGYGSVTGTAMASHTDIDKI 240
            LA GNT+V+KPAE T LS L+ +QL  EAG P GV+NI+PG G V G  +  H D+ KI
Sbjct: 198 ALATGNTVVLKPAETTPLSALFASQLCIEAGIPKGVVNIIPGSGRVVGEKLCKHPDVKKI 257

Query: 241 AFTGSTAVGQKVMSLAAQSNLKAVTLECGGKSPCLIFADANLDEAIPWVAGGIFYNSGQN 300
           AFTGST  G  +M  AA + +K VTLE GGKSP ++FADA+LD+AI  +A GIFYNSG+ 
Sbjct: 258 AFTGSTKTGSHIMKTAADT-VKKVTLELGGKSPNIVFADADLDKAIENIAFGIFYNSGEV 316

Query: 301 CTANSRIYVHEDIYEEFLTKFEEYAKSNWKFGAKFDPFDKDCTLGPVISKVQYDRIQSYV 360
           C A SRIYV + +Y+  L KF++Y + N K G   DPFD+    G   SK Q  +I  YV
Sbjct: 317 CCAGSRIYVQDTVYDTVLNKFKKYTE-NLKVG---DPFDESTFQGAQTSKAQLTKILKYV 372

Query: 361 EHGKASEKLGFKEFAEYPSKGYFIPPTIFSDVPNSSKLSQEEIFGPVGVVASFSTYEEAI 420
           + G             + +KGYF+ PTIF+DV    ++ +EE+FGP+  ++ FST +E I
Sbjct: 373 KVGTDEGARVVTGGERFGNKGYFVKPTIFADVKEDMQIVKEEVFGPLVTISKFSTVDEVI 432

Query: 421 KLANDSSYGLASCVFSENARTTAQFARDIRAGTVWINSSNDEEISVPFGGFKMSGIGREL 480
            +ANDS YGLA+ + +++       ++ I+AGTVWIN+ N    +VPFGGF  SGIGRE+
Sbjct: 433 DMANDSQYGLAAGIHTKDVNKAIHVSKRIQAGTVWINTYNAFHQNVPFGGFGQSGIGREM 492

Query: 481 GRNGVDSYLQTKA 493
           G   +D+Y Q K+
Sbjct: 493 GAAALDNYTQVKS 505

>ACL044W [1005] [Homologous to ScYER073W (ALD5) - SH]
           complement(286308..287849) [1542 bp, 513 aa]
          Length = 513

 Score =  403 bits (1035), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 225/501 (44%), Positives = 315/501 (62%), Gaps = 25/501 (4%)

Query: 1   MSLYETVNIPQLNITYEQPLGLFINNEFVKSSDGKKIESINPSTEESIVSFFAASEKDVN 60
           + L   V +P  N +YEQP GLFI+ +FV S   K  E I+P TEE I   + A E+DV+
Sbjct: 20  LPLTVQVRLPNGN-SYEQPTGLFIDGKFVPSHQAKTFEVIDPGTEEEITHVYEAREEDVD 78

Query: 61  SAVTAARDAFENNWSKTSGEQRGILLSKLFDLIERDKLLLAAIETLDSGKPYHSNSLADL 120
           +AV AA+ AF   WS+   E R   L KL DLIE+ +  LA IE+LD+GK     S  D+
Sbjct: 79  AAVAAAKRAFLP-WSRADPEVRAQCLFKLADLIEKHQETLANIESLDNGKSLLC-SRGDV 136

Query: 121 EQILQLTRYYAGGADKFTGGEYIPLNQDKYAYTMKVPYGVVAQIVPWNYPLAMASWKIQS 180
             + +  R   G ADK  G   +    D ++YT + P GV  QI+PWN+PL M SWKI  
Sbjct: 137 ALVARYLRTCGGWADKIYG-NVMETGPDHFSYTRREPLGVCGQIIPWNFPLLMWSWKIGP 195

Query: 181 CLAAGNTIVIKPAENTSLSLLYFAQLVKEAGFPPGVLNILPGYGSVTGTAMASHTDIDKI 240
            LA GNT+V+KPAE+T LS LY   L  EAG P GV+NI+PG+G + G  + +H D+ K+
Sbjct: 196 ALATGNTVVLKPAESTPLSALYVCNLANEAGIPKGVMNIVPGFGKIVGEHLCTHPDVKKV 255

Query: 241 AFTGSTAVGQKVMSLAAQSNLKAVTLECGGKSPCLIFADANLDEAIPWVAGGIFYNSGQN 300
           AFTGSTA G+ +M   A++ +K VTLE GGKSP ++FADA++D+A+  +  GIFYN+G+ 
Sbjct: 256 AFTGSTATGRHIMRTCAET-VKKVTLELGGKSPNIVFADADIDKAVKNIGFGIFYNAGEV 314

Query: 301 CTANSRIYVHEDIYEEFLTKFEEYAKSNWKFGAKFDPFDKDCTLGPVISKVQYDRIQSYV 360
           C A SR+YV + +Y+E L KF+++++ N K G   +PF++    G   S++Q D+I SYV
Sbjct: 315 CCAGSRVYVQDSVYDEVLEKFKQFSE-NLKVG---NPFEEGVFQGAQTSQMQVDKILSYV 370

Query: 361 EHG--------KASEKLGFKEFAEYPSKGYFIPPTIFSDVPNSSKLSQEEIFGPVGVVAS 412
           + G           E+LG         KG+FI PTIF+DV  + ++ ++EIFGPV  V+ 
Sbjct: 371 DIGVKEGARIVAGGERLG--------RKGFFIKPTIFADVNENMRVVKDEIFGPVVTVSK 422

Query: 413 FSTYEEAIKLANDSSYGLASCVFSENARTTAQFARDIRAGTVWINSSNDEEISVPFGGFK 472
           FST +E I +AN+S YGLA+ + + +       +  I+AGTVW+N+ ND   +VPFGGF 
Sbjct: 423 FSTVDEVIAMANNSQYGLAAGIHTTDINKAIDVSNQIKAGTVWVNTYNDFHPNVPFGGFG 482

Query: 473 MSGIGRELGRNGVDSYLQTKA 493
            SGIG E+G   +D+Y QTKA
Sbjct: 483 QSGIGSEMGVQALDNYTQTKA 503

>ADR417W [2157] [Homologous to ScYOR374W (ALD4) - SH]
           complement(1457469..1458992) [1524 bp, 507 aa]
          Length = 507

 Score =  399 bits (1025), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 225/500 (45%), Positives = 308/500 (61%), Gaps = 25/500 (5%)

Query: 3   LYETVNIPQLNITYEQPLGLFINNEFVKSSDGKKIESINPSTEESIVSFFAASEKDVNSA 62
           L  T+ +P   + YEQP GLFINNEFV+S  G  +E I P+TEE +   +  + +DV+ A
Sbjct: 18  LSVTIKLPN-GVEYEQPTGLFINNEFVRSKLGGMMEVIAPATEEVVTRVYEGTSEDVDIA 76

Query: 63  VTAARDAFEN-NWSKTSGEQRGILLSKLFDLIERDKLLLAAIETLDSGKPYHSNSLADLE 121
           V+AA+ AF++  W       R   LSKL DLIE D  ++A+IE LD+GK + S++  D+ 
Sbjct: 77  VSAAQKAFKSGKWFGADPMVRVKALSKLADLIEEDLEVIASIEFLDNGKVF-SHARFDIG 135

Query: 122 QILQLTRYYAGGADKFTGGEYIPLNQDKYAYTMKVPYGVVAQIVPWNYPLAMASWKIQSC 181
            ++   R  AG ADK  G   I        YT + P GV  QI+PWN+PL M +WK+   
Sbjct: 136 MVVNYLRCCAGLADKVDG-RSIDTGSSHLTYTRREPIGVCGQIIPWNFPLLMWAWKVGPA 194

Query: 182 LAAGNTIVIKPAENTSLSLLYFAQLVKEAGFPPGVLNILPGYGSVTGTAMASHTDIDKIA 241
           LA GNT+V+K AE T LS LY +  V++AG P GV+NI+ GYG   G A+  H  + KIA
Sbjct: 195 LATGNTVVLKTAEFTPLSALYVSNHVRKAGIPAGVVNIISGYGKTVGEAIIRHPGVKKIA 254

Query: 242 FTGSTAVGQKVMSLAAQSNLKAVTLECGGKSPCLIFADANLDEAIPWVAGGIFYNSGQNC 301
           FTGSTA G+ +  +AA+ +LK V+LE GGKSP +IFADA+L +A   V   IF+N G+ C
Sbjct: 255 FTGSTATGRHIYEVAAK-DLKKVSLELGGKSPNIIFADADLKKAAQNVLNSIFFNGGEVC 313

Query: 302 TANSRIYVHEDIYEEFLTKFEEYAKSNWKFGAKFDPFDKDCTLGPVISKVQYDRIQSYVE 361
            A SR+Y+ E IYEEFL + +  A+S  K G   DP  KD   G   S++Q D+I SY+E
Sbjct: 314 CAGSRMYIEEPIYEEFLQEIKAVAES-VKVG---DPSWKDTFQGAQTSQMQLDKILSYIE 369

Query: 362 HGK--------ASEKLGFKEFAEYPSKGYFIPPTIFSDVPNSSKLSQEEIFGPVGVVASF 413
            GK          E+LG         KGY++ PTIF+DV    ++ +EEIFGPV  V  F
Sbjct: 370 IGKQEGARVVTGGERLG--------EKGYYVKPTIFADVREDMRIVKEEIFGPVVTVTKF 421

Query: 414 STYEEAIKLANDSSYGLASCVFSENARTTAQFARDIRAGTVWINSSNDEEISVPFGGFKM 473
           +  ++ +++AND+ YGLA+ V+S + +     A  + AGTVWIN+ ND   SVPFGG+K 
Sbjct: 422 TNIDDLLEMANDTQYGLAAGVYSSSMKKAIDVANRLDAGTVWINTYNDFHCSVPFGGYKG 481

Query: 474 SGIGRELGRNGVDSYLQTKA 493
           SG GRE+G   V++Y Q KA
Sbjct: 482 SGFGREMGAEVVENYTQVKA 501

>Scas_664.24
          Length = 499

 Score =  394 bits (1011), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 215/489 (43%), Positives = 298/489 (60%), Gaps = 8/489 (1%)

Query: 6   TVNIPQLNITYEQPLGLFINNEFVKSSDGKKIESINPSTEESIVSFFAASEKDVNSAVTA 65
           T+ +P   ITY QP GLFINNEF+KS D K I+  NP+T E +    + + +DV  AV +
Sbjct: 13  TITLPN-GITYNQPTGLFINNEFMKSQDYKTIKVENPATAEIVCEVSSGTSEDVEYAVES 71

Query: 66  ARDAF-ENNWSKTSGEQRGILLSKLFDLIERDKLLLAAIETLDSGKPYHSNSLADLEQIL 124
           A  AF + +W+    + RG  LSKL DL+E +  L+A+IETLD+GK   + S  D+   +
Sbjct: 72  AEHAFNDTDWATQDPKIRGRYLSKLADLMEENLELMASIETLDNGKTL-ALSRGDVGLAI 130

Query: 125 QLTRYYAGGADKFTGGEYIPLNQDKYAYTMKVPYGVVAQIVPWNYPLAMASWKIQSCLAA 184
              R  A  ADK  G   I        +T+K P GV  QI+PWN+PL M SWKI   LA 
Sbjct: 131 NCIRDAASYADKING-RTINSGDGYMNFTVKEPIGVCGQIIPWNFPLMMLSWKIAPALAM 189

Query: 185 GNTIVIKPAENTSLSLLYFAQLVKEAGFPPGVLNILPGYGSVTGTAMASHTDIDKIAFTG 244
           GN I++KPA  T L+ L+FA L K+ G P GV+NI+PG G   G A+ +H  I K AFTG
Sbjct: 190 GNVIILKPASATPLNALFFASLCKKVGIPAGVVNIIPGPGRTVGNAITTHPRIRKAAFTG 249

Query: 245 STAVGQKVMSLAAQSNLKAVTLECGGKSPCLIFADANLDEAIPWVAGGIFYNSGQNCTAN 304
           ST +G+ +   A+ SNLK +TLE GGKS  L+F DAN+++ +P +  GIF N+GQ C++ 
Sbjct: 250 STEIGKDIAIKASGSNLKKITLELGGKSAHLVFDDANIEKTLPNLVNGIFKNAGQICSSG 309

Query: 305 SRIYVHEDIYEEFLTKFEEYAKSNWKFGAKFDPFDKDCTLGPVISKVQYDRIQSYVEHGK 364
           SRIYV E IY++ +  F++Y + N K G   DPFD+    G + ++ QY+ I  Y++ GK
Sbjct: 310 SRIYVQEGIYDKLMPAFKKYVE-NLKVG---DPFDESNFQGAITNREQYETILKYIKIGK 365

Query: 365 ASEKLGFKEFAEYPSKGYFIPPTIFSDVPNSSKLSQEEIFGPVGVVASFSTYEEAIKLAN 424
                         +KGYFI PTIF DV    ++ +EEIFGPV  V+ F   E+ + +AN
Sbjct: 366 EEGAKILTGGETIGNKGYFIKPTIFYDVKEDMEIVREEIFGPVVTVSKFKDIEDGVAMAN 425

Query: 425 DSSYGLASCVFSENARTTAQFARDIRAGTVWINSSNDEEISVPFGGFKMSGIGRELGRNG 484
            S +GL + + +EN  T  + A+ +++GTVWIN+ ND +  VPFGG K SG GRE+G   
Sbjct: 426 ASEFGLGAGIETENLSTALKVAKMLKSGTVWINTYNDFDSRVPFGGVKQSGYGREMGEEV 485

Query: 485 VDSYLQTKA 493
            D Y + KA
Sbjct: 486 YDCYTEVKA 494

>YPL061W (ALD6) [5380] chr16 (432583..434085) Cytosolic acetaldehyde
           dehydrogenase [1503 bp, 500 aa]
          Length = 500

 Score =  386 bits (991), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 208/481 (43%), Positives = 291/481 (60%), Gaps = 6/481 (1%)

Query: 14  ITYEQPLGLFINNEFVKSSDGKKIESINPSTEESIVSFFAASEKDVNSAVTAARDAFENN 73
           +TYEQP GLFINN+F+K+ DGK     +PSTE ++    +A+ +DV  A+  A  AF + 
Sbjct: 20  LTYEQPTGLFINNKFMKAQDGKTYPVEDPSTENTVCEVSSATTEDVEYAIECADRAFHDT 79

Query: 74  -WSKTSGEQRGILLSKLFDLIERDKLLLAAIETLDSGKPYHSNSLADLEQILQLTRYYAG 132
            W+     +RG LLSKL D +E    L+++IE LD+GK   + +  D+   +   R  A 
Sbjct: 80  EWATQDPRERGRLLSKLADELESQIDLVSSIEALDNGKTL-ALARGDVTIAINCLRDAAA 138

Query: 133 GADKFTGGEYIPLNQDKYAYTMKVPYGVVAQIVPWNYPLAMASWKIQSCLAAGNTIVIKP 192
            ADK  G   I        +T   P GV  QI+PWN+P+ M +WKI   LA GN  ++KP
Sbjct: 139 YADKVNG-RTINTGDGYMNFTTLEPIGVCGQIIPWNFPIMMLAWKIAPALAMGNVCILKP 197

Query: 193 AENTSLSLLYFAQLVKEAGFPPGVLNILPGYGSVTGTAMASHTDIDKIAFTGSTAVGQKV 252
           A  T L+ LYFA L K+ G P GV+NI+PG G   G A+ +   I K+AFTGST VG+ V
Sbjct: 198 AAVTPLNALYFASLCKKVGIPAGVVNIVPGPGRTVGAALTNDPRIRKLAFTGSTEVGKSV 257

Query: 253 MSLAAQSNLKAVTLECGGKSPCLIFADANLDEAIPWVAGGIFYNSGQNCTANSRIYVHED 312
              +++SNLK +TLE GGKS  L+F DAN+ + +P +  GIF N+GQ C++ SRIYV E 
Sbjct: 258 AVDSSESNLKKITLELGGKSAHLVFDDANIKKTLPNLVNGIFKNAGQICSSGSRIYVQEG 317

Query: 313 IYEEFLTKFEEYAKSNWKFGAKFDPFDKDCTLGPVISKVQYDRIQSYVEHGKASEKLGFK 372
           IY+E L  F+ Y ++  K G   +PFDK    G + ++ Q+D I +Y++ GK        
Sbjct: 318 IYDELLAAFKAYLETEIKVG---NPFDKANFQGAITNRQQFDTIMNYIDIGKKEGAKILT 374

Query: 373 EFAEYPSKGYFIPPTIFSDVPNSSKLSQEEIFGPVGVVASFSTYEEAIKLANDSSYGLAS 432
              +   KGYFI PT+F DV    ++ +EEIFGPV  VA F T EE +++AN S +GL S
Sbjct: 375 GGEKVGDKGYFIRPTVFYDVNEDMRIVKEEIFGPVVTVAKFKTLEEGVEMANSSEFGLGS 434

Query: 433 CVFSENARTTAQFARDIRAGTVWINSSNDEEISVPFGGFKMSGIGRELGRNGVDSYLQTK 492
            + +E+  T  + A+ ++AGTVWIN+ ND +  VPFGG K SG GRE+G     +Y + K
Sbjct: 435 GIETESLSTGLKVAKMLKAGTVWINTYNDFDSRVPFGGVKQSGYGREMGEEVYHAYTEVK 494

Query: 493 A 493
           A
Sbjct: 495 A 495

>KLLA0F12628g complement(1170396..1171910) similar to sp|P38067
           Saccharomyces cerevisiae YBR006w UGA2 succinate
           semialdehyde dehydrogenase P9.1.f7. 1, start by
           similarity
          Length = 504

 Score =  287 bits (735), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 171/476 (35%), Positives = 259/476 (54%), Gaps = 13/476 (2%)

Query: 23  FINNEFVKSSDGKKIESINPSTEESIVSFFAASEKDVNSAVTAARDAFENNWSKTSGEQR 82
           FIN ++ ++ D  K    NPST ++I         D N A+  A DAF   + +T+  +R
Sbjct: 32  FINGKWTETDD--KFAVTNPSTGDTIREVTNCGVSDFNKAIEIAHDAF-GTFRQTNVRER 88

Query: 83  GILLSKLFDLIERDKLLLAAIETLDSGKPYHSNSLADLEQILQLTRYYAGGADKFTGGEY 142
             +L  +++L+  +K  LA I TL++GKPY  +SL ++       +++A  A +  G + 
Sbjct: 89  AQILDNIYNLMLENKQDLAKILTLENGKPY-KDSLGEIVYSAMFFKWFAEEAPRIYG-DI 146

Query: 143 IP--LNQDKYAYTMKVPYGVVAQIVPWNYPLAMASWKIQSCLAAGNTIVIKPAENTSLSL 200
           IP  ++ D+  +T++ P GV+  + PWN+P AM + K+   +A GNT VIKPA  T LS 
Sbjct: 147 IPSAVSSDQKIFTIRQPLGVIGILTPWNFPSAMIARKLAPVIATGNTCVIKPAHETPLSA 206

Query: 201 LYFAQLVKEAGFPPGVLNILP-GYGSVTGTAMASHTDIDKIAFTGSTAVGQKVMSLAAQ- 258
           L    + ++AG P GV NILP  + S  G  +  H  + KI FTGST +GQ +M  +++ 
Sbjct: 207 LALGVIAEKAGLPAGVCNILPTNHTSEIGEYVCEHELVKKITFTGSTKIGQLLMGQSSKG 266

Query: 259 SNLKAVTLECGGKSPCLIFADANLDEAIPWVAGGIFYNSGQNCTANSRIYVHEDIYEEFL 318
            N+K  ++E GG +P ++F DA+LD A+  + G  F  SGQ C   +RI+VHED+Y+EF 
Sbjct: 267 KNIKKFSMELGGNAPYIVFKDADLDRALDGIIGCKFRQSGQTCICANRIFVHEDLYDEFS 326

Query: 319 TKFEEYAKSNWKFGAKFDPFDKDCTLGPVISKVQYDRIQSYVEHGKASEKLGFKEFAEYP 378
            +  +     +K G   D F    T GP+I     D++ S V+  K          +   
Sbjct: 327 KRLVDKIDKTFKLG---DGFQDGVTHGPLIHDKSIDKVASLVQDAKTKGADVLIGGSRAS 383

Query: 379 SKG-YFIPPTIFSDVPNSSKLSQEEIFGPVGVVASFSTYEEAIKLANDSSYGLASCVFSE 437
           S G  F  PT+  +V  S  +  EEIFGPV  +  F   +E IK AND+  GLA   +S+
Sbjct: 384 SLGPLFYQPTVLGNVTESMDIFYEEIFGPVAPLIKFKDVDEVIKRANDTDVGLAGYFYSQ 443

Query: 438 NARTTAQFARDIRAGTVWINSSNDEEISVPFGGFKMSGIGRELGRNGVDSYLQTKA 493
           N  T    A  +  G V +N+    E +VPFGG K SG+G+E  + G+D Y + KA
Sbjct: 444 NISTIFDAAEKLNVGMVGVNTGEISEPAVPFGGVKNSGLGKEGSKYGIDDYTELKA 499

>Sklu_2087.3 , Contig c2087 4336-5856
          Length = 506

 Score =  287 bits (734), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 174/460 (37%), Positives = 253/460 (55%), Gaps = 12/460 (2%)

Query: 40  INPSTEESIVSFFAASEKDVNSAVTAARDAFENNWSKTSGEQRGILLSKLFDLIERDKLL 99
           INPST+E I         + N+A+  A+ +F+ +  +TS  +R  +L  ++DLI+  K  
Sbjct: 48  INPSTQEEIAQIANCGVGEYNNAINFAQQSFKTH-RETSLRERSQILYNIYDLIQEHKKD 106

Query: 100 LAAIETLDSGKPYHSNSLADLEQILQLTRYYAGGADKFTGGEYIPLN--QDKYAYTMKVP 157
           LA + TL++GKP   +SL ++E      R++A  A +  G   IP +    K  +T++ P
Sbjct: 107 LARLITLENGKPI-KDSLGEIEYSASYFRWFAEEAPRIYG-NIIPSSGSSKKQIFTIRQP 164

Query: 158 YGVVAQIVPWNYPLAMASWKIQSCLAAGNTIVIKPAENTSLSLLYFAQLVKEAGFPPGVL 217
            GVV  + PWN+P AM + K+  C+A GN+ VIKPA  T LS L F  LV++AG   G+ 
Sbjct: 165 LGVVGILTPWNFPSAMIARKLAPCIATGNSCVIKPAHETPLSALAFGWLVEQAGLAAGLC 224

Query: 218 NILPG-YGSVTGTAMASHTDIDKIAFTGSTAVGQKVM--SLAAQSNLKAVTLECGGKSPC 274
           NILP  Y SVTG  + SH  I K+ FTGSTAVG+ +M   L     +K +++E GG +P 
Sbjct: 225 NILPTTYTSVTGEYICSHDLIRKVTFTGSTAVGKALMGQCLKDSKVIKKISMELGGNAPF 284

Query: 275 LIFADANLDEAIPWVAGGIFYNSGQNCTANSRIYVHEDIYEEFLTKFEEYAKSNWKFGAK 334
           ++F DA+L  +I  + G  F  SGQ C   +RI+VHEDIY+EF  K  E  ++++  G  
Sbjct: 285 IVFKDADLMRSIDGLIGCKFRQSGQTCICANRIFVHEDIYDEFAKKLVERIETSFTLGDG 344

Query: 335 FDPFDKDCTLGPVISKVQYDRIQSYVEHGKASEKLGFKEFAEYPSKG-YFIPPTIFSDVP 393
           FDP     T GP+I +   D++   V   K              S G  F  PT+ S V 
Sbjct: 345 FDP---KVTHGPLIHESAVDKVVKLVHDAKTKGAQVLTGGTRASSLGPLFYRPTVLSGVN 401

Query: 394 NSSKLSQEEIFGPVGVVASFSTYEEAIKLANDSSYGLASCVFSENARTTAQFARDIRAGT 453
            S  +   EIFGPV  +  F + +E I+ AN +  GLA   +S N +T    A  +  G 
Sbjct: 402 ESMDIFHTEIFGPVASLVKFKSVDEVIERANATDVGLAGYFYSSNLQTVFDVATRLEVGM 461

Query: 454 VWINSSNDEEISVPFGGFKMSGIGRELGRNGVDSYLQTKA 493
           V +NSS   + ++PFGG K SGIGRE    G++ Y + K+
Sbjct: 462 VGVNSSAISDAAMPFGGIKNSGIGREGSMFGIEDYTELKS 501

>AER007W [2512] [Homologous to ScYBR006W (UGA2) - SH]
           complement(644674..646161) [1488 bp, 495 aa]
          Length = 495

 Score =  253 bits (646), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 167/478 (34%), Positives = 255/478 (53%), Gaps = 17/478 (3%)

Query: 21  GLFINNEFVKSSDGKKIESINPSTEESIVSFFAASEKDVNSAVTAARDAFENNWSKTSGE 80
           G +IN E++ S+  +     +P+T++ I         +  +A+ AA  +F++ + KTS  
Sbjct: 19  GAYINGEWITSAK-ESFNVTDPATDQVIAELPDFDSGEAEAALKAAHASFQS-YKKTSPT 76

Query: 81  QRGILLSKLFDLIERDKLLLAAIETLDSGKPYHSNSLADLEQILQLTRYYAGGADKFTGG 140
           QR   L  L+DLI  +   LAAI T ++GK     +L ++       ++++  A +  G 
Sbjct: 77  QRSEWLRNLYDLIMENAEDLAAIVTWENGKSLR-EALVEIRYGATFFKWFSEEALRLYGT 135

Query: 141 EYIPLNQDKYAYTMKVPYGVVAQIVPWNYPLAMASWKIQSCLAAGNTIVIKPAENTSLSL 200
              P N    A+T++ P GV A I PWN+P AM S K    LAAG T++IKP   T LS 
Sbjct: 136 TIQPSNPGNRAFTIRQPVGVCALICPWNFPNAMISRKAAPALAAGCTVIIKPDPQTPLSS 195

Query: 201 LYFAQLVKEAGFPPGVLNILP--GYGSVTGTAMASHTDIDKIAFTGSTAVGQKVMSLAAQ 258
           L  A L ++AGFPPGV+N++P   Y    G  +   + + K++FTGSTAVG+ +M  AA 
Sbjct: 196 LALAHLAEKAGFPPGVINVVPTSKYTKDIGVLLCESSLVRKVSFTGSTAVGKILMQQAA- 254

Query: 259 SNLKAVTLECGGKSPCLIFADANLDEAIPWVAGGIFYNSGQNCTANSRIYVHEDIYEEFL 318
           S +K V+ E GG +P +I  DA++++ +  V    F   GQ C   +R+YVH  I ++F 
Sbjct: 255 STVKKVSFELGGNAPVIIMGDADMEKTVEEVLATKFRGMGQTCICANRLYVHRSIIDDFS 314

Query: 319 TKFEEYAKSNWKFGAKFDPFDKDCTLGPVISKVQYDRIQSYVEHGKASEKLGFKEF---A 375
           ++  +  +   K G   + F +  T G +I+    ++++    H K + + G K      
Sbjct: 315 SRLVKKVE-GLKLG---NGFQEGVTHGSLINNAAIEKVE---RHAKDAIERGAKVLLPGG 367

Query: 376 EYPSKG-YFIPPTIFSDVPNSSKLSQEEIFGPVGVVASFSTYEEAIKLANDSSYGLASCV 434
             P  G +F  PT+ SDV   S L++EE FGP+  +  F T EE +  AND+ YGLAS V
Sbjct: 368 RAPELGPHFYSPTVLSDVKPDSVLTREETFGPLCAMIPFDTVEEVVGYANDTQYGLASYV 427

Query: 435 FSENARTTAQFARDIRAGTVWINSSNDEEISVPFGGFKMSGIGRELGRNGVDSYLQTK 492
           FSEN +T    A  +  G V  N+    +  VPFGG K SG G E   +G++ Y   K
Sbjct: 428 FSENIKTVYSIAEALDFGMVACNTGLFSDSMVPFGGIKESGFGIEGSLHGINDYTVLK 485

>CAGL0C04191g complement(409544..411019) highly similar to sp|P38067
           Saccharomyces cerevisiae YBR006w UGA2 succinate
           semialdehyde dehydrogenase, hypothetical start
          Length = 491

 Score =  237 bits (605), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 169/477 (35%), Positives = 244/477 (51%), Gaps = 17/477 (3%)

Query: 23  FINNEFVKSSDGKKIESINPSTEESIVSFFAASEKDVNSAVTAARDAFENNWSKTSGEQR 82
           +IN E+VK S+ +  E  +PST E I          V+ AV AA DAF+  +  T   QR
Sbjct: 16  YINGEWVKDSN-EFFEVDDPSTGEIIAKLPEHDIAVVDRAVDAAYDAFQK-YKNTLPRQR 73

Query: 83  GILLSKLFDLIERDKLLLAAIETLDSGKPYHSNSLADLEQILQLTRYYAGGADKFTGGEY 142
              L  LF+L+  +   LA I T ++GK    +S A+++       +YA  A +  G   
Sbjct: 74  ATWLRNLFNLMTENAEDLAKIITWENGKSL-PDSRAEIKYAASYYEWYAEEAPRIYGATI 132

Query: 143 IPLNQDKYAYTMKVPYGVVAQIVPWNYPLAMASWKIQSCLAAGNTIVIKPAENTSLSLLY 202
            P   +    T + P GV   I PWN+P AM + K+ + LAAG T+V+KP  +T LS L 
Sbjct: 133 QPSIPNNRVITKRQPVGVCGIICPWNFPSAMITRKVGAALAAGCTVVVKPDSHTPLSALA 192

Query: 203 FAQLVKEAGFPPGVLNILPGYGSV--TGTAMASHTDIDKIAFTGSTAVGQKVMSLAAQSN 260
              LV++AGFP GV N++    +    G  +  H  + K+ FTGST +G+ +M   A S 
Sbjct: 193 MTVLVEKAGFPKGVFNVVLSQHNTPKLGKRLCEHPKVKKVTFTGSTRIGKTLME-QASST 251

Query: 261 LKAVTLECGGKSPCLIFADANLDEAIPWVAGGIFYNSGQNCTANSRIYVHEDIYEEFLTK 320
           LK  + E GG +P ++F DA+LD A+       F   GQ C   +R YV + I +EF  K
Sbjct: 252 LKKCSFELGGNAPFIVFDDADLDLAVDQAIASKFRGMGQTCVCTNRFYVQDTIADEFAEK 311

Query: 321 FEEYAKSNWKFGAKFDPFDKDCTLGPVISKVQYDRIQSYVEHGKASEKLGFK---EFAEY 377
                K  +K G   D   +  T G + +  Q D++    EH K + + G K   E    
Sbjct: 312 LVTKVK-QFKIG---DGMKEGVTHGCLTNAKQADKVD---EHKKDAIEKGAKVLLEGGRM 364

Query: 378 PSKGY-FIPPTIFSDVPNSSKLSQEEIFGPVGVVASFSTYEEAIKLANDSSYGLASCVFS 436
           P  G  F  P +  +VP S+ +++EE FGP+  + +F T EE +  AND+  GLAS VF+
Sbjct: 365 PDLGKNFYAPVVLKNVPQSAMVAKEETFGPLCPIFTFKTVEEVLGYANDTELGLASYVFT 424

Query: 437 ENARTTAQFARDIRAGTVWINSSNDEEISVPFGGFKMSGIGRELGRNGVDSYLQTKA 493
           +N  T    +  + AG V  N+    + SVPFGG K SG GRE    G+D Y   K+
Sbjct: 425 KNVNTLFTVSEALEAGMVSCNTGLFSDSSVPFGGVKESGFGREGSLYGIDDYTTVKS 481

>YBR006W (UGA2) [199] chr2 (246974..248467) Succinate semialdehyde
           dehydrogenase (4-Aminobutyrate catabolic enzyme) [1494
           bp, 497 aa]
          Length = 497

 Score =  234 bits (598), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 152/476 (31%), Positives = 242/476 (50%), Gaps = 17/476 (3%)

Query: 23  FINNEFVKSSDGKKIESINPSTEESIVSFFAASEKDVNSAVTAARDAFENNWSKTSGEQR 82
           +I+ ++VK +D +  E ++P++ E I          V  A+  A + F+  +  T+  +R
Sbjct: 22  YIDGKWVKGTD-EVFEVVDPASGEIIARVPEQPVSVVEEAIDVAYETFKT-YKNTTPRER 79

Query: 83  GILLSKLFDLIERDKLLLAAIETLDSGKPYHSNSLADLEQILQLTRYYAGGADKFTGGEY 142
              L  +++L+  +   LA I TL++GK     +  +++       +YA  A +  G   
Sbjct: 80  AKWLRNMYNLMLENLDDLATIITLENGKAL-GEAKGEIKYAASYFEWYAEEAPRLYGATI 138

Query: 143 IPLNQDKYAYTMKVPYGVVAQIVPWNYPLAMASWKIQSCLAAGNTIVIKPAENTSLSLLY 202
            PLN     +T++ P GV   I PWN+P AM + K  + LA G T+VIKP   T LS L 
Sbjct: 139 QPLNPHNRVFTIRQPVGVCGIICPWNFPSAMITRKAAAALAVGCTVVIKPDSQTPLSALA 198

Query: 203 FAQLVKEAGFPPGVLNILPGYGSV--TGTAMASHTDIDKIAFTGSTAVGQKVMSLAAQSN 260
            A L ++AGFP G  N++  + +    G  +     + K+ FTGST VG K++   + S 
Sbjct: 199 MAYLAEKAGFPKGSFNVILSHANTPKLGKTLCESPKVKKVTFTGSTNVG-KILMKQSSST 257

Query: 261 LKAVTLECGGKSPCLIFADANLDEAIPWVAGGIFYNSGQNCTANSRIYVHEDIYEEFLTK 320
           LK ++ E GG +P ++F DA+LD+A+       F   GQ C   +R+YVH  I ++F   
Sbjct: 258 LKKLSFELGGNAPFIVFEDADLDQALEQAMACKFRGLGQTCVCANRLYVHSSIIDKFAKL 317

Query: 321 FEEYAKSNWKFGAKFDPFDKDCTLGPVISKVQYDRIQSY----VEHGKASEKLGFKEFAE 376
             E  K  +  G   DP     T G VI+    ++++ +    ++ G      G +    
Sbjct: 318 LAERVK-KFVIGHGLDP---KTTHGCVINSSAIEKVERHKQDAIDKGAKVVLEGGRLTEL 373

Query: 377 YPSKGYFIPPTIFSDVPNSSKLSQEEIFGPVGVVASFSTYEEAIKLANDSSYGLASCVFS 436
            P+   F  P I S VP+++ +S+EE FGP+  + SF T EE +  AND+ +GLA+ VFS
Sbjct: 374 GPN---FYAPVILSHVPSTAIVSKEETFGPLCPIFSFDTMEEVVGYANDTEFGLAAYVFS 430

Query: 437 ENARTTAQFARDIRAGTVWINSSNDEEISVPFGGFKMSGIGRELGRNGVDSYLQTK 492
           +N  T    +  +  G V  N+    + S+PFGG K SG GRE    G++ Y   K
Sbjct: 431 KNVNTLYTVSEALETGMVSCNTGVFSDCSIPFGGVKESGFGREGSLYGIEDYTVLK 486

>Kwal_56.23106
          Length = 495

 Score =  231 bits (589), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 156/477 (32%), Positives = 249/477 (52%), Gaps = 17/477 (3%)

Query: 23  FINNEFVKSSDGKKIESINPSTEESIVSFFAASEKDVNSAVTAARDAFENNWSKTSGEQR 82
           F+N +++K S G + E  +P+  E I          V+ A+ AA +AF++ + KT+G +R
Sbjct: 20  FVNGKWIKDS-GAEFEVTDPANGEVIAKLPDQDVGIVDEAIDAAYEAFQS-FKKTTGRER 77

Query: 83  GILLSKLFDLIERDKLLLAAIETLDSGKPYHSNSLADLEQILQLTRYYAGGADKFTGGEY 142
             LL K+  L+  +   L  I + ++GKP  +  + +++       +YA  A +  G   
Sbjct: 78  ATLLRKMHSLMLENVEDLGKILSWENGKPL-AEGIGEIKYAASFYEWYAEEAPRINGTTI 136

Query: 143 IPLNQDKYAYTMKVPYGVVAQIVPWNYPLAMASWKIQSCLAAGNTIVIKPAENTSLSLLY 202
                    +T + P GV   I PWN+P AM + K+ + LAAG T+VIKP   T LS L 
Sbjct: 137 NSAISTNRVFTERQPVGVCGIICPWNFPSAMITRKVGAALAAGCTVVIKPDSQTPLSALA 196

Query: 203 FAQLVKEAGFPPGVLNILPGYGSVT--GTAMASHTDIDKIAFTGSTAVGQKVMSLAAQSN 260
            A L ++AG P GV N++  +      G  +     + K++FTGST VG+ +M  +A S 
Sbjct: 197 LAHLAEKAGVPAGVFNVVLSHTKTPEFGLKLCESPKVKKVSFTGSTNVGKILMKQSA-ST 255

Query: 261 LKAVTLECGGKSPCLIFADANLDEAIPWVAGGIFYNSGQNCTANSRIYVHEDIYEEFLTK 320
           +K ++ E GG +P ++F DA+LD+A+       F   GQ C   +R+YV + I +EF T+
Sbjct: 256 MKKLSFELGGNAPFIVFEDADLDKAVEQAIACKFRGLGQTCVCANRLYVQKSILDEFETR 315

Query: 321 FEEYAKSNWKFGAKFDPFDKDCTLGPVISKVQYDRIQSYVEHGKASEKLGFK---EFAEY 377
           F E   + +  G     F +  T G +I+    +++++   H K + + G K   E    
Sbjct: 316 FAEKV-NQFVIG---HAFKEGVTHGCLINPKAIEKVEA---HTKDAIEKGAKVVVEGGRL 368

Query: 378 PSKG-YFIPPTIFSDVPNSSKLSQEEIFGPVGVVASFSTYEEAIKLANDSSYGLASCVFS 436
           P  G  F  PT+ S VP  + ++ +E FGP+  +  F T EE ++ AND+  GLA+ VFS
Sbjct: 369 PDLGPSFYAPTVVSQVPQDAIVASQETFGPLCAIIPFETTEEVVRWANDTEVGLAAYVFS 428

Query: 437 ENARTTAQFARDIRAGTVWINSSNDEEISVPFGGFKMSGIGRELGRNGVDSYLQTKA 493
           +N  T    +  +  G V  N+    E +VPFGG K SG GRE   +G++ Y   K+
Sbjct: 429 KNIDTIYTVSEALETGMVSCNTGVFSECAVPFGGVKESGFGREGSLHGIEDYTVIKS 485

>Scas_716.63
          Length = 494

 Score =  227 bits (579), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 151/477 (31%), Positives = 244/477 (51%), Gaps = 13/477 (2%)

Query: 21  GLFINNEFVKSSDGKKIESINPSTEESIVSFFAASEKDVNSAVTAARDAFENNWSKTSGE 80
           G  IN  ++ S+  +  +  +P++   I +    +  DV  A+ AA  AF+  +  T+  
Sbjct: 17  GSLINGNWI-SAAKETFDVTDPASGSKIATLPEQTSSDVEQAIDAAAKAFKT-YKNTTPR 74

Query: 81  QRGILLSKLFDLIERDKLLLAAIETLDSGKPYHSNSLADLEQILQLTRYYAGGADKFTGG 140
           QR   L  +F+L+  +   LA + + ++GK   S S  +++       +YA  A +  G 
Sbjct: 75  QRAQWLRNMFNLMMENLEDLAKLISWENGKAL-SESRGEIKYAASFFEWYAEEAPRIYGT 133

Query: 141 EYIPLNQDKYAYTMKVPYGVVAQIVPWNYPLAMASWKIQSCLAAGNTIVIKPAENTSLSL 200
                      +T++ P GV   I PWN+P AM + K+ + L AG T+++KP   T LS 
Sbjct: 134 TIQTATASNRVFTLRQPVGVCGIICPWNFPSAMITRKVAAALTAGCTVIVKPDSQTPLSG 193

Query: 201 LYFAQLVKEAGFPPGVLNILPGYGSV--TGTAMASHTDIDKIAFTGSTAVGQKVMSLAAQ 258
           L    L++EAGFP GV N++  + +    G  +     + KI+FTGST+VG+ +M  +A 
Sbjct: 194 LALGYLLEEAGFPEGVCNVILSHKNTPACGLTLCESPVVKKISFTGSTSVGKILMKQSA- 252

Query: 259 SNLKAVTLECGGKSPCLIFADANLDEAIPWVAGGIFYNSGQNCTANSRIYVHEDIYEEFL 318
           S LK ++ E GG +P ++F DA+L+ A+       F   GQ C  ++RIYVH  I ++F 
Sbjct: 253 STLKKLSFELGGNAPVIVFEDADLEVAVEQTIASKFRGLGQTCVCSNRIYVHSSIIDKFA 312

Query: 319 TKFEEYAKSNWKFGAKFDPFDKD-CTLGPVISKVQYDRIQSYVEHGKASEKLGFKEFAEY 377
              E  A    KF     P   D  T G +I+    ++++S+V           ++    
Sbjct: 313 ---ELVAAKVRKF--TIGPGLSDGVTHGCIINGKAIEKVESHVNDAITKGAQIIEKGGLI 367

Query: 378 PSKG-YFIPPTIFSDVPNSSKLSQEEIFGPVGVVASFSTYEEAIKLANDSSYGLASCVFS 436
           PS G  F  P + S V   + +++EE FGP+  + SF T EE I  AND+ +GLA+ +FS
Sbjct: 368 PSLGPNFYAPVVLSHVTKDALVAKEETFGPLCPIFSFDTLEEVIGYANDTEFGLAAYIFS 427

Query: 437 ENARTTAQFARDIRAGTVWINSSNDEEISVPFGGFKMSGIGRELGRNGVDSYLQTKA 493
           ++  T    A  + AG V  N+    + ++PFGG K SG GRE   +G++ Y   K+
Sbjct: 428 KDIDTVYTAAEALEAGMVSCNTGIFSDCAMPFGGVKESGFGREGSLHGIEDYTVLKS 484

>KLLA0E17545g 1553982..1555475 highly similar to sp|P38067
           Saccharomyces cerevisiae YBR006w UGA2 succinate
           semialdehyde dehydrogenase, start by similarity
          Length = 497

 Score =  220 bits (560), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 154/479 (32%), Positives = 249/479 (51%), Gaps = 19/479 (3%)

Query: 21  GLFINNEFVKSSDGKKIESINPSTEESIVSFFAASEKDVNSAVTAARDAFENNWSKTSGE 80
           G F++ ++++++  +     +P+T E I +    S + ++ A+ +A +AF   + KT+ +
Sbjct: 20  GAFVDGQWLETAS-ETFNVTDPATLEVIATLPDQSIEVIHEAIDSAAEAFRL-FKKTTPK 77

Query: 81  QRGILLSKLFDLIERDKLLLAAIETLDSGKPYHSNSLADLEQILQLTRYYAGGADKFTGG 140
            R   L  L++L+  +   LA I T ++GK   S +  +++       +YA  A +  G 
Sbjct: 78  TRSTWLRNLYNLMMENVDDLAKIITWENGKAL-SEAQGEVKYAASYFEWYAEEAVRMYGT 136

Query: 141 EYIPLNQDKYAYTMKVPYGVVAQIVPWNYPLAMASWKIQSCLAAGNTIVIKPAENTSLSL 200
              P N    A+T++ P GV   I PWN+P AM + K  + LAAG T+V+KP   T LS 
Sbjct: 137 TIQPNNGSNRAFTVRQPVGVCGIICPWNFPSAMITRKAGAALAAGCTVVVKPDSQTPLSA 196

Query: 201 LYFAQLVKEAGFPPGVLNIL------PGYGSVTGTAMASHTDIDKIAFTGSTAVGQKVMS 254
           L  A L ++AGFP GV N++      P +G     A+     + KI+FTGST VG+ +M 
Sbjct: 197 LALAHLAEKAGFPKGVFNVVLTATRTPEFG----LALCESPKVKKISFTGSTNVGKILMK 252

Query: 255 LAAQSNLKAVTLECGGKSPCLIFADANLDEAIPWVAGGIFYNSGQNCTANSRIYVHEDIY 314
            +A S +K ++ E GG +P ++F DA+L++A+       F   GQ C   +RIYV   I 
Sbjct: 253 QSA-STMKKLSFELGGNAPVIVFDDADLEQAVTQTILSKFRGLGQTCVCANRIYVQRTII 311

Query: 315 EEFLTKFEEYAKSNWKFGAKFDPFDKDCTLGPVISKVQYDRIQSYVEHGKASEKLGFKEF 374
           + F    E+ AK   +F       D   T G +I++    +++++V+             
Sbjct: 312 DSFA---EKLAKQVNEFVIGHG-LDSKTTHGCLINENAIKKVEAHVKDALEKGAKTVVAG 367

Query: 375 AEYPSKG-YFIPPTIFSDVPNSSKLSQEEIFGPVGVVASFSTYEEAIKLANDSSYGLASC 433
              P  G  F  PT+ S VP+++ ++++E FGP+  +  F T EE +  AND+  GLAS 
Sbjct: 368 GRLPELGPNFYAPTVLSHVPSTAVVNKDETFGPLCALIPFDTMEEVVGYANDTELGLASY 427

Query: 434 VFSENARTTAQFARDIRAGTVWINSSNDEEISVPFGGFKMSGIGRELGRNGVDSYLQTK 492
           VFS+N  T    A  +  G V  N+    E ++PFGG K SG GRE   +G++ Y   K
Sbjct: 428 VFSKNIDTVYTVAEALETGMVSCNTGLFSECTIPFGGVKESGFGREGSLHGIEDYTVIK 486

>AAL075W [112] [Homologous to ScYHR039C (MSC7) - SH]
           complement(213684..215597) [1914 bp, 637 aa]
          Length = 637

 Score =  172 bits (436), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 139/485 (28%), Positives = 225/485 (46%), Gaps = 40/485 (8%)

Query: 37  IESINPSTEESIVSFFAASEKDVNSAVTAARDAFENNWSKTSGEQRGILLSKLFDLIERD 96
           I++  P+T + + SF + S++D++    AA  A + +W+KTS  QR  +L  +   +  +
Sbjct: 107 IQNYCPATGQFLGSFRSMSKEDIDERFAAAAKA-QVSWAKTSFAQRRQVLKTMQKFVLEN 165

Query: 97  KLLLAAIETLDSGKPYHSNSLADLEQILQLTRYYAGGADKFTGGEYIPLNQDKYA----Y 152
           + +LA +   DSGK     SL ++   ++  ++     ++        L   K A    +
Sbjct: 166 QEMLARVACRDSGKTMLDASLGEIMVTMEKLQWMIKHGER-------TLRPSKRAGPANF 218

Query: 153 TMKV---------PYGVVAQIVPWNYPLAMASWKIQSCLAAGNTIVIKPAENTSLSLLYF 203
            MK+         P GVV  +V WNY        I +   AGN +VIK +E    S  +F
Sbjct: 219 FMKLYKGGEVRYEPLGVVGAVVSWNYSFHNTLGPIIASTFAGNGVVIKCSEQVVWSSEFF 278

Query: 204 AQLVKEA----GFPPGVLNIL----PGYGSVTGTAMASHTDIDKIAFTGSTAVGQKVMSL 255
            +L +E+    G  P ++ +     P     T     SH  +  + F GS  V   V++ 
Sbjct: 279 VKLARESLKVCGHDPELVQLCYCFPPSETDDTANYFTSHPSLRHLTFIGSKPVAHHVLAC 338

Query: 256 AAQSNLKAVTLECGGKSPCLIFADA-NLDEAIPWVAGGIFYNSGQNCTANSRIYVHEDIY 314
           AA+S L  V +E GGK   ++   A +L+     +  G F ++GQNC    R+ V +  Y
Sbjct: 339 AAKS-LTPVVVELGGKDALVVLDSAKDLESLSSIIMRGTFQSAGQNCIGIERVIVCQKNY 397

Query: 315 EEFLTKFEEYAKSNWKFGAKFDPFDKDCTLGPVISKVQYD----RIQSYVEHGKASEKLG 370
           +  L K  E+  S  + GA  D  + D  +G +IS  ++D     IQ  V  G      G
Sbjct: 398 DA-LVKILEHRISELRVGADIDNLE-DVDVGAMISDNRFDYMEELIQDAVSQGARLLHGG 455

Query: 371 FK-EFAEYPSKGYFIPPTIFSDVPNSSKLSQEEIFGPVGVVASFSTYEEAIKLANDSSYG 429
            +    +YP +G++  PT+  DV    ++SQ E+FGPV  V      E+ I++AND+ +G
Sbjct: 456 SRYTHPKYP-QGHYFQPTLLVDVTTDMRISQNEVFGPVLTVMKAKDIEDCIRIANDTPFG 514

Query: 430 LASCVFSENARTTAQFARDIRAGTVWINSSNDEEIS-VPFGGFKMSGIGRELGRNGVDSY 488
           L   VF +N +     A  +  G V IN      +  +PFGG   SG GR  G  G+   
Sbjct: 515 LGGSVFGKNRKDCNYVANHMNVGNVAINDFATYYVCQLPFGGIGSSGYGRFGGEEGLLGL 574

Query: 489 LQTKA 493
             +K+
Sbjct: 575 CNSKS 579

>Kwal_23.5699
          Length = 641

 Score =  160 bits (406), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 131/485 (27%), Positives = 221/485 (45%), Gaps = 38/485 (7%)

Query: 36  KIESINPSTEESIVSFFAASEKDVNSAVTAARDAFENNWSKTSGEQRGILLSKLFDLIER 95
           +I+   P+T + + S+ + +E D++  V+ A +A +  W+KT+ E+R  +L  L D I  
Sbjct: 110 RIQCYCPATGQFLGSYPSMNEDDIDQLVSKATEA-QVKWAKTTLEERTRVLVSLQDYILE 168

Query: 96  DKLLLAAIETLDSGKPYHSNSLADLEQILQLTRYYAGGADK------FTGGEYIPLNQDK 149
           ++  +A +   DSGK     S+ ++   L+  ++     +K       +G     +   K
Sbjct: 169 NQDSIARVACRDSGKTMLDASMGEILVTLEKLQWIIKNGEKALQPSKRSGPTNFFMKWYK 228

Query: 150 YAYTMKVPYGVVAQIVPWNYPLAMASWKIQSCLAAGNTIVIKPAENTSLSLLYFAQLVKE 209
            A     P GVV  +V WNYP       I + +  GN IVIK +E    S  +FA + K+
Sbjct: 229 GAEVRYEPLGVVGALVSWNYPFHNLLGPIMAAIFTGNAIVIKCSEQVVWSSEFFASMCKK 288

Query: 210 A----GFPPGVLNIL----PGYGSVTGTAMASHTDIDKIAFTGSTAVGQKVMSLAAQSNL 261
                GF P ++ +     P          +SH  +  + F GS  V   V++ A++S L
Sbjct: 289 CLESNGFDPNLIQLCYCRPPSATDNAANHYSSHPGLKHLTFIGSKPVAHHVLAAASKS-L 347

Query: 262 KAVTLECGGKSPCLIFADA--NLDEAIPWVAGGIFYNSGQNCTANSRIYVHEDIYEEFLT 319
             V +E GGK   LI  D+  +L      +  G F +SGQNC    R+ V    Y+E ++
Sbjct: 348 TPVVVELGGKD-ALIALDSVKDLPALSSIIMRGTFQSSGQNCIGIERVIVSAKNYDELVS 406

Query: 320 KFEEYAKSNWKFGAKFDPFDKDCTLGPVISKVQYDRIQSYVE----------HGKASEKL 369
             E+      + G+  D  + D  +G +IS  +++ ++  V+          HG +  K 
Sbjct: 407 ILEKRV-GQLRLGSDIDNLE-DVDMGAMISDNRFEELERMVQDAIKQGARLLHGGSRYK- 463

Query: 370 GFKEFAEYPSKGYFIPPTIFSDVPNSSKLSQEEIFGPVGVVASFSTYEEAIKLANDSSYG 429
                  YP +G++  PT+  DV    +++Q E+FGP+  V      ++ I+LAN + +G
Sbjct: 464 ----HPNYP-QGHYFQPTLLVDVTPLMEIAQNEVFGPIMTVMRAEDTQDCIRLANSAPFG 518

Query: 430 LASCVFSENARTTAQFARDIRAGTVWINS-SNDEEISVPFGGFKMSGIGRELGRNGVDSY 488
           L   VF  +       A  +  G V IN  +      +PFGG   SG G+  G  G+   
Sbjct: 519 LGGSVFGSDYAECNYVANHLTTGNVAINDFATFYVCQLPFGGINGSGYGKFGGEEGLTGL 578

Query: 489 LQTKA 493
              K+
Sbjct: 579 CNAKS 583

>YHR039C (MSC7) [2326] chr8 complement(184867..186801) Protein with
           strong similarity to aldehyde dehydrogenases [1935 bp,
           644 aa]
          Length = 644

 Score =  159 bits (402), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 123/471 (26%), Positives = 217/471 (46%), Gaps = 26/471 (5%)

Query: 37  IESINPSTEESIVSFFAASEKDVNSAVTAARDAFENNWSKTSGEQRGILLSKLFDLIERD 96
           I+   P+T + + SF + +E D++  V+ A  A ++ W  +   +R  +L+ L D I  +
Sbjct: 112 IQCHCPATGQYLGSFPSKTEADIDEMVSKAGKA-QSTWGNSDFSRRLRVLASLHDYILNN 170

Query: 97  KLLLAAIETLDSGKPYHSNSLADLEQILQLTRYYAGGADKFTGGEYIP------LNQDKY 150
           + L+A +   DSGK     S+ ++   L+  ++      +       P      +   K 
Sbjct: 171 QDLIARVACRDSGKTMLDASMGEILVTLEKIQWTIKHGQRALQPSRRPGPTNFFMKWYKG 230

Query: 151 AYTMKVPYGVVAQIVPWNYPLAMASWKIQSCLAAGNTIVIKPAENTSLSLLYFAQLVKEA 210
           A     P GV++ IV WNYP       I + L  GN IV+K +E    S  +F +L+++ 
Sbjct: 231 AEIRYEPLGVISSIVSWNYPFHNLLGPIIAALFTGNAIVVKCSEQVVWSSEFFVELIRKC 290

Query: 211 ----GFPPGVLNIL----PGYGSVTGTAMASHTDIDKIAFTGSTAVGQKVMSLAAQSNLK 262
                  P ++ +     P     +     SH     I F GS  V   ++  AA+S L 
Sbjct: 291 LEACDEDPDLVQLCYCLPPTENDDSANYFTSHPGFKHITFIGSQPVAHYILKCAAKS-LT 349

Query: 263 AVTLECGGKSPCLIFADA-NLDEAIPWVAGGIFYNSGQNCTANSRIYVHEDIYEEFLTKF 321
            V +E GGK   ++   A NLD     +  G F +SGQNC    R+ V ++ Y++ +   
Sbjct: 350 PVVVELGGKDAFIVLDSAKNLDALSSIIMRGTFQSSGQNCIGIERVIVSKENYDDLVKIL 409

Query: 322 EEYAKSN-WKFGAKFDPFDKDCTLGPVISKVQYDRIQSYVEHGKASEKLGFK-----EFA 375
            +   +N  + G+  D  + +  +G +IS  ++D +++ V+   A      +     +  
Sbjct: 410 NDRMTANPLRQGSDIDHLE-NVDMGAMISDNRFDELEALVKDAVAKGARLLQGGSRFKHP 468

Query: 376 EYPSKGYFIPPTIFSDVPNSSKLSQEEIFGPVGVVASFSTYEEAIKLANDSSYGLASCVF 435
           +YP +G++  PT+  DV    K++Q E+FGP+ V+      +  ++LAN + +GL   VF
Sbjct: 469 KYP-QGHYFQPTLLVDVTPEMKIAQNEVFGPILVMMKAKNTDHCVQLANSAPFGLGGSVF 527

Query: 436 SENARTTAQFARDIRAGTVWINS-SNDEEISVPFGGFKMSGIGRELGRNGV 485
             + +     A  ++ G V IN  +      +PFGG   SG G+  G  G+
Sbjct: 528 GADIKECNYVANSLQTGNVAINDFATFYVCQLPFGGINGSGYGKFGGEEGL 578

>Scas_690.26
          Length = 651

 Score =  149 bits (377), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 133/487 (27%), Positives = 214/487 (43%), Gaps = 28/487 (5%)

Query: 32  SDGKKIESINPSTEESIVSFFAASEKDVNSAVTAARDAFENNWSKTSGEQRGILLSKLFD 91
           S+   I+   P+T + I SF + ++ +++  +  A  A ++ WS +S E+R  +L+ L +
Sbjct: 110 SNPNHIQCYCPATGQYIASFPSKTKTELDDMIQRAEIA-QSKWSTSSMERRLRVLTSLRE 168

Query: 92  LIERDKLLLAAIETLDSGKPYHSNSLADLEQILQLTRYYAGGADKFTGGEYIP------L 145
            I  ++ ++A+I   DSGK     S+ ++   L+  ++              P      +
Sbjct: 169 YILSNQEMIASIACRDSGKTKLDASMGEILVTLEKLQWLITHGPSVLKPSRRPGPTNFFM 228

Query: 146 NQDKYAYTMKVPYGVVAQIVPWNYPLAMASWKIQSCLAAGNTIVIKPAENTSLSLLYFAQ 205
              K A     P GVV+ IV WNYP       I   L  GN IV+K +E    S   F Q
Sbjct: 229 KWYKGAEIRYEPLGVVSAIVSWNYPFHNLWGPIIDSLFTGNAIVMKCSEQVVWSSEIFVQ 288

Query: 206 LVKEA----GFPPGVLNI---LP-----GYGSVTGTAMASHTDIDKIAFTGSTAVGQKVM 253
           L++E     G  P ++ +   LP          T     SH     I F GS  V  +++
Sbjct: 289 LLRECLIQCGEDPELIQLFYCLPPNLEEDSNEETANYFTSHKAFKSITFIGSQQVSHQIL 348

Query: 254 SLAAQSNLKAVTLECGGKSPCLIFADA-NLDEAIPWVAGGIFYNSGQNCTANSRIYVHED 312
             AA++ +  V +E GGK   ++     +L      +  G F +SGQNC    R+ V E 
Sbjct: 349 RCAAEA-ITPVVVELGGKDAFIVLDSVKDLQSISSIILRGTFQSSGQNCIGIERVIVSEK 407

Query: 313 IYEEFLTKFEEYAKSNWKFGAKFDPFDKDCTLGPVISKVQYDRIQSYVEHG--KASEKL- 369
            Y   +        ++            D  +G +IS  ++D ++  V+    K +  L 
Sbjct: 408 NYATLVEILSNRMNASPMRQGSDIDSIDDIDVGAMISDNRFDELELLVKDAVSKGARLLC 467

Query: 370 GFKEFA--EYPSKGYFIPPTIFSDVPNSSKLSQEEIFGPVGVVASFSTYEEAIKLANDSS 427
           G   F   +YP   YF  PT+  DV    K++Q E+FGP+ V+   +  E  IKLAN + 
Sbjct: 468 GGSRFQHPKYPQGNYF-QPTLLVDVTPDMKIAQNEVFGPILVMMRANDTEHCIKLANSAP 526

Query: 428 YGLASCVFSENARTTAQFARDIRAGTVWINS-SNDEEISVPFGGFKMSGIGRELGRNGVD 486
           +GL   VF  N +     A +++ G V IN  +      +PFGG   SG G+  G  G+ 
Sbjct: 527 FGLGGSVFGSNMQECNYVANELKTGNVAINDFATFYVCQLPFGGIHGSGYGKFGGEEGLL 586

Query: 487 SYLQTKA 493
                K+
Sbjct: 587 RLCNAKS 593

>KLLA0C10615g complement(912077..913999) similar to sp|P38694
           Saccharomyces cerevisiae YHR039c, start by similarity
          Length = 640

 Score =  149 bits (376), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 125/477 (26%), Positives = 214/477 (44%), Gaps = 24/477 (5%)

Query: 37  IESINPSTEESIVSFFAASEKDVNSAVTAARDAFENNWSKTSGEQRGILLSKLFDLIERD 96
           I+S  P+T + + SF + S+ D++  V  A  A +  W+KTS ++R  +L  L + I  +
Sbjct: 110 IQSYCPATGQFLGSFKSMSDTDIDEIVLLAERA-QLQWAKTSLKERLQVLLSLKNFILEN 168

Query: 97  KLLLAAIETLDSGKPYHSNSLADLEQILQLTRYYAGGADKFTGGEYIP------LNQDKY 150
           +  +A +   DSGK     S+ ++   L+  ++     +        P      +   K 
Sbjct: 169 QEAIARVACRDSGKTMLDASMGEILVTLEKIQWIIEHGEDVLKPSARPGPTNFFMKWYKG 228

Query: 151 AYTMKVPYGVVAQIVPWNYPLAMASWKIQSCLAAGNTIVIKPAENTSLSLLYFAQLVKEA 210
           A     P GVV  IV WNYP       I + +  GN +V+K +E    S  +F  LV+EA
Sbjct: 229 AEVRYEPLGVVGAIVSWNYPFHNLLGPIVASIFTGNAVVVKCSEQVVWSSKFFTLLVQEA 288

Query: 211 ----GFPPGVLNI---LPGYGSV-TGTAMASHTDIDKIAFTGSTAVGQKVMSLAAQSNLK 262
               G  P ++ +   LP  G+        SH     + F GS  V   V+  AA S L 
Sbjct: 289 LKACGHDPNLVQLCYCLPPTGNDDAANYFTSHPVFKHLTFIGSKPVAHHVLKAAADS-LT 347

Query: 263 AVTLECGGKSPCLIFADANLDEAIP-WVAGGIFYNSGQNCTANSRIYVHEDIYEEFLTKF 321
            V +E GGK   ++       +A+   +  G F ++GQNC    R+ V    Y+  ++  
Sbjct: 348 PVVVELGGKDAFIVLDSVKDLQALSSIIMRGTFQSAGQNCIGIERVIVSAKNYDALVSIL 407

Query: 322 EEYAKSNWKFGAKFDPFDKDCTLGPVISKVQYDRIQSYVEHG--KASEKLGFKEFAEYPS 379
            +      + G+  D  + D  +G +IS  ++ ++++ +     K ++ L       +P+
Sbjct: 408 NDRV-GQLRLGSDIDNLE-DVDMGAMISDNRFGQLENLISDALSKGAKLLHGGSRYNHPN 465

Query: 380 --KGYFIPPTIFSDVPNSSKLSQEEIFGPVGVVASFSTYEEAIKLANDSSYGLASCVFSE 437
             +G+F  PT+  DV    ++S  E+FGP+  V      ++ I+LAN + +GL   +F  
Sbjct: 466 YPQGHFFQPTLLVDVTEDMQISHNEVFGPILTVMRAKDTDDCIRLANAAPFGLGGSIFGA 525

Query: 438 NARTTAQFARDIRAGTVWINS-SNDEEISVPFGGFKMSGIGRELGRNGVDSYLQTKA 493
           +     + A  +  G V IN  +      +PFGG   SG G+  G  G+      K+
Sbjct: 526 DFGECNRVANSLTTGNVAINDFATFYVCQLPFGGLNGSGYGKFGGEEGLLGLCNAKS 582

>CAGL0D03982g 397039..398763 highly similar to sp|P07275
           Saccharomyces cerevisiae YHR037w PUT2
           1-pyrroline-5-carboxylate dehydrogenase, start by
           similarity
          Length = 574

 Score =  142 bits (359), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 135/492 (27%), Positives = 227/492 (46%), Gaps = 42/492 (8%)

Query: 22  LFINNEFVKSSDGKKI-ESINPSTEESIVSFFA-ASEKDVNSAVTAARDAFENNWSKTSG 79
           L IN E V +  G+ +    NP+  E +++  A A+  D+ SA+ AA+ A E  W     
Sbjct: 62  LVINGERVYADRGRAVFAQTNPANHEQVLANVAQATRDDIKSAIGAAKQAKEK-WYNMPF 120

Query: 80  EQRGILLSKLFDLIE-RDKLLLAAIETLDSGKPYHSNSLADLEQILQLTRYYAGGADKFT 138
             R  +  K  DLI  + +  + A   L  GK  +   +  + ++    R+    AD+  
Sbjct: 121 YDRAAIFMKAADLISTKYRYDMLAATMLGQGKNVYQAEIDCITELSDFFRFNVKYADELY 180

Query: 139 GG---EYIPLNQDKYAYTMKVPYGVVAQIVPWNYPLAMASWKIQSCLAAGNTIVIKPAEN 195
                E +P   ++  Y  +   G V  + P+N+  A+A+  I +    GNT+V KP++ 
Sbjct: 181 ATQPIESVPGIWNRAEY--RPLEGFVYAVSPFNF-TAIAANLIGAPALMGNTVVWKPSQT 237

Query: 196 TSLSLLYFAQLVKEAGFPPGVLNILPGYG-SVTGTAMASHTDIDKIAFTGSTAVGQ---- 250
            +LS      +++EAG P GV+N +PG    +T   +AS  D   + FTGSTAV +    
Sbjct: 238 AALSNYLLLTVLEEAGLPKGVINFVPGDPVEITDEVLASR-DFSALHFTGSTAVFKQLYG 296

Query: 251 KVMSLAAQSNLK---AVTLECGGKSPCLIFADANLDEAIPWVAGGIFYNSGQNCTANSRI 307
           K+ S  A++  +    +  E GGK+  L+   AN+  A+     G F   GQ C+A SR+
Sbjct: 297 KIQSGVAENKYRDYPRIVGETGGKNYHLVHPSANVPHAVFNTIRGAFEFQGQKCSATSRL 356

Query: 308 YVHEDIYEEFLTKFEEYAKSNWKFGAKFDPFDKDCT----------LGPVISKVQYDRIQ 357
           Y+ + + EEF         +N     K  P +   +          +GPVI +  ++++ 
Sbjct: 357 YLPKSMSEEFFRDMFGTLSNN-----KVVPVNTSASAISGGNLHGFMGPVIHEQSFNKLS 411

Query: 358 SYVEHGKASEKLGFKEFAEY-PSKGYFIPPTIFSDVPNSSKLSQEEIFGPVGVVASF--S 414
           + +E  K   +L      +Y  S+G++I PTI      + K    E FGP+  V  +  S
Sbjct: 412 AAIEEAKKDPELEILYGGQYDKSQGWYIGPTIIRTTNPNHKFLTTEFFGPILTVYEYQDS 471

Query: 415 TYEEAIKLANDS-SYGLASCVFSENARTTAQFARDIR--AGTVWINSSNDEEISVP--FG 469
            +++  +L N++  YGL   +FS +       +  +R  AG  +IN      +     FG
Sbjct: 472 QFKDICELINETGEYGLTGSIFSRDRDAIIYASEKLRFSAGNFYINDKCTGAVVAQQWFG 531

Query: 470 GFKMSGIGRELG 481
           G +MSG   + G
Sbjct: 532 GARMSGTNDKAG 543

>CAGL0F08965g complement(880296..882215) highly similar to sp|P38694
           Saccharomyces cerevisiae YHR039c, hypothetical start
          Length = 639

 Score =  142 bits (358), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 123/481 (25%), Positives = 221/481 (45%), Gaps = 26/481 (5%)

Query: 27  EFVKSSDGKKIESINPSTEESIVSFFAASEKDVNSAVTAARDAFENNWSKTSGEQRGILL 86
           + V  S  + I+S  P+T + +  F + +  +++  V  A +A +  W+++S  +R  +L
Sbjct: 97  KLVDDSKPRHIQSYCPATGQYLGEFKSMTADEIDELVGNA-NAAQMKWAESSIAKRLEVL 155

Query: 87  SKLFDLIERDKLLLAAIETLDSGKPYHSNSLAD----LEQILQLTRYYAGGAD--KFTGG 140
           + L   I  ++ L+A +   DSGK     S+ +    LE+I  + ++     +  +  G 
Sbjct: 156 ATLQKFILENQDLIAKVACRDSGKTMLDASMGEILVTLEKIQWILKHGPSTLEPSRRPGP 215

Query: 141 EYIPLNQDKYAYTMKVPYGVVAQIVPWNYPLAMASWKIQSCLAAGNTIVIKPAENTSLSL 200
               +   K A     P GV++ IV WNYP       I + +  GN I++K +E    S 
Sbjct: 216 TNFFMKFYKGAEVRYEPLGVISSIVSWNYPFHNLMGPIIASIFTGNAIIVKCSEQVVWSS 275

Query: 201 LYFAQLVKEA----GFPPGVLNIL----PGYGSVTGTAMASHTDIDKIAFTGSTAVGQKV 252
            +F ++V++          ++ +     P           SH  I  I F GS +V   +
Sbjct: 276 EFFIEMVRKCLDVCDVDSNIVQLCYCLPPTKDDDAANHFTSHPGIKHITFIGSQSVASHI 335

Query: 253 MSLAAQSNLKAVTLECGGKSPCLIFADA-NLDEAIPWVAGGIFYNSGQNCTANSRIYVHE 311
           ++ A++S L  V +E GGK   ++     +LD     +  G F +SGQNC    R+ V E
Sbjct: 336 LNCASKS-LTPVVVELGGKDAFIVLDSVKDLDALSSIILRGTFQSSGQNCIGIERVIVSE 394

Query: 312 DIYEEFLTKFEEYAKSN-WKFGAKFDPFDKDCTLGPVISKVQYDRIQSYVEHG--KASEK 368
             Y++ +   E+  K    + G+  D  +    +G +IS  ++  +++ ++    K +  
Sbjct: 395 KNYDQLVNILEKRMKETPLRQGSDIDHLEV-VDMGAMISDNRFKTLEALIQDAVSKGARL 453

Query: 369 L-GFKEF--AEYPSKGYFIPPTIFSDVPNSSKLSQEEIFGPVGVVASFSTYEEAIKLAND 425
           L G  ++   +YP +G++  PT+  DV     ++Q E+FGPV V+         I+LAN 
Sbjct: 454 LYGGSQYNHPKYP-QGHYFQPTLLVDVTPDMDIAQNEVFGPVLVMMKAKDTSNCIELANA 512

Query: 426 SSYGLASCVFSENARTTAQFARDIRAGTVWINS-SNDEEISVPFGGFKMSGIGRELGRNG 484
           + +GL   VF  +       A  ++ G V IN  +      +PFGG   SG G+  G  G
Sbjct: 513 APFGLGGSVFGSDYSECNFVANKLKTGNVAINDFATFYVCQLPFGGINGSGYGKFGGEEG 572

Query: 485 V 485
           +
Sbjct: 573 L 573

>KLLA0C10549g 903888..905618 gi|31043861|emb|CAD91310.1
           Kluyveromyces lactis delta 1-pyrroline-5-carboxylate
           dehydrogenase, start by similarity
          Length = 576

 Score =  140 bits (352), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 137/495 (27%), Positives = 226/495 (45%), Gaps = 39/495 (7%)

Query: 22  LFINNEFVKSSD--GKK--IESINPSTE-ESIVSFFAASEKDVNSAVTAARDAFENNWSK 76
           L IN E +  +D  GK+   + +NP+   E + +   A+ +DV +A+ A++ A ++ W K
Sbjct: 63  LVINGERIYYNDDGGKRGIFQQLNPANHSEVLANVTQATNEDVKAAIQASKQA-KDKWYK 121

Query: 77  TSGEQRGILLSKLFDLI-ERDKLLLAAIETLDSGKPYHSNSLADLEQILQLTRYYAGGAD 135
               +R  +  K  DLI  + +  + A   L  GK  +   +  + ++    R+    A+
Sbjct: 122 LPYYERASVFMKAADLICTKYRYDMLAATMLGQGKNVYQAEIDCITELADFFRFNVKYAN 181

Query: 136 KFTGGEYIPLNQDKYAYTMKVPY-GVVAQIVPWNYPLAMASWKIQSCLAAGNTIVIKPAE 194
           +    + I  +   +      P  G V  + P+N+  A+A   I +    GNT+V KP++
Sbjct: 182 ELYAQQPIESSPGVWNRAEYRPLEGFVYAVTPFNF-TAIAGNLIGAPALMGNTVVWKPSQ 240

Query: 195 NTSLSLLYFAQLVKEAGFPPGVLNILPGYGSVTGTAMASHTDIDKIAFTGSTAVG----- 249
           N +LS      +++EAG P GV+N +PG        + S ++   + FTGSTAV      
Sbjct: 241 NANLSNYLLLTVLEEAGLPNGVVNFVPGNAVEVTKEVLSDSEFAALHFTGSTAVFKQLYG 300

Query: 250 --QKVMSLAAQSNLKAVTLECGGKSPCLIFADANLDEAIPWVAGGIFYNSGQNCTANSRI 307
             QK +      +   +  E GGK+  LI   AN+  ++     G F   GQ C+A SR+
Sbjct: 301 DIQKGVVNGLYRDYPRIVGETGGKNFHLIHPSANIPHSVLSTLRGAFEFQGQKCSATSRV 360

Query: 308 YVHEDIYEEFLTK----FEEYAKSNWKFGAKFDPFDKDCTLGPVISKVQYDRIQSYVEHG 363
           Y+ E   EEF         E    N    +K +  D    +GPVI +  +D++   ++  
Sbjct: 361 YLPESKSEEFFRDLGGVLSEVQPVNTS-ASKINGGDLHGFIGPVIHEGSFDKLAKVIDDA 419

Query: 364 KASEKL-----GFKEFAEYPSKGYFIPPTIFSDV-PNSSKLSQEEIFGPVGVVASF--ST 415
           K   +L     GF +     SKGY+I PTI     P    LSQ E FGP+  V  +  + 
Sbjct: 420 KNDPELEIVFGGFHD----KSKGYYIQPTIIKTTNPRHPYLSQ-EFFGPILTVYEYPDAK 474

Query: 416 YEEAIKLANDSS-YGLASCVFSEN--ARTTAQFARDIRAGTVWINSSNDEEISVP--FGG 470
           +E+  +L + +S YGL   +F+ +  A   A       AG  +IN  +   +     FGG
Sbjct: 475 FEDVCELVDSTSQYGLTGSIFARDREAIKIADEKLKYSAGNFYINDKSTGAVVAQQWFGG 534

Query: 471 FKMSGIGRELGRNGV 485
            +MSG   + G   +
Sbjct: 535 ARMSGTNDKAGSGNI 549

>AAL071C [116] [Homologous to ScYHR037W (PUT2) - SH]
           (223170..224891) [1722 bp, 573 aa]
          Length = 573

 Score =  130 bits (328), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 129/502 (25%), Positives = 218/502 (43%), Gaps = 50/502 (9%)

Query: 22  LFINNEFVKSSDGKKIE---SINPSTEESIVSFFA-ASEKDVNSAVTAARDAFENNWSKT 77
           L IN E +  +D  K E    +NP+    +++    AS +DV +AV AA+DA +  W +T
Sbjct: 61  LVINGERIYFNDAGKRELFKQVNPARHTQVLAHVTQASREDVRAAVRAAQDA-KQKWYET 119

Query: 78  SGEQRGILLSKLFDLI-ERDKLLLAAIETLDSGKPYHSNSLADLEQILQLTRYYAGGADK 136
               R  +  K  DL+  + +  + A   L  GK      +  + ++    R+    A++
Sbjct: 120 PFYDRAAVFLKAADLVATKYRYDMLAATMLGQGKNVQQAEIDCITELADFFRFNVKYAEE 179

Query: 137 -------------FTGGEYIPLNQDKYAYTMKVPYGVVAQIVPWNYPLAMASWKIQSCLA 183
                        +   EY PL             G V  + P+N+  A+A   + +   
Sbjct: 180 LYQQQPAESSPGVWNRSEYRPLE------------GFVYAVSPFNF-TAIAGNLVGAPAL 226

Query: 184 AGNTIVIKPAENTSLSLLYFAQLVKEAGFPPGVLNILPGYGSVTGTAMASHTDIDKIAFT 243
            GNT+V KP++N +LS      +++EAG P GV+N +PG        + +   +  + FT
Sbjct: 227 MGNTVVWKPSQNAALSNYLLLTVLEEAGLPRGVINFVPGNPVDVTEEVLADKALGGLHFT 286

Query: 244 GSTAVGQKVMSLAAQ-------SNLKAVTLECGGKSPCLIFADANLDEAIPWVAGGIFYN 296
           GSTAV +++     Q        +   +  E GGK+  L+   ANL  A+     G F  
Sbjct: 287 GSTAVFKQLYGKIQQGVVSGLYRDYPRIVGETGGKNFHLVHPSANLPHAVLSTLRGAFEF 346

Query: 297 SGQNCTANSRIYVHEDIYEEFLTKFE---EYAKSNWKFGAKFDPFDKDCTLGPVISKVQY 353
            GQ C+A SR+Y+ +   + FL          K      +  +  D    +GPVI +  +
Sbjct: 347 QGQKCSAASRLYLPQSKADAFLADLAGTLAAIKPANTSASSINGGDLHAFMGPVIHEQSF 406

Query: 354 DRIQSYVEHGKASEKLGFKEFAEY-PSKGYFIPPTIFSDVPNSSKLSQEEIFGPVGVVAS 412
           D++ + +E  +   +L      ++  S+GYF+ PT+             E FGP+  V  
Sbjct: 407 DKLAAAIERARTDPELEILYGGDHSKSQGYFVGPTVVRTSNPRHDFMTAEFFGPILTVYE 466

Query: 413 F--STYEEAIKLANDSS-YGLASCVFSENARTTAQFARDIR--AGTVWINSSNDEEISVP 467
           +  + +++   L + +S YGL   VF+ +    A   R ++  AG  +IN      +   
Sbjct: 467 YPDAQFDQVCDLIDSTSAYGLTGAVFARDRDAIAAADRRLKYAAGNFYINDKATGAVVAQ 526

Query: 468 --FGGFKMSGIGRELGRNGVDS 487
             FGG +MSG   + G   V S
Sbjct: 527 QWFGGARMSGTNDKAGSPNVLS 548

>CAGL0K03509g complement(326043..327626) similar to sp|Q04458
           Saccharomyces cerevisiae YMR110c aldehyde-dehydrogenase
           like protein, hypothetical start
          Length = 527

 Score =  130 bits (326), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 116/441 (26%), Positives = 195/441 (44%), Gaps = 37/441 (8%)

Query: 58  DVNSAVTAARDAFENNWSKTSGE---------QRGILLSKLF-DLIERDKLLLAAIETLD 107
           ++++ ++ +R+ F+ N  + + +         QR   L KL+  + + ++ +L A+E  D
Sbjct: 12  EIDAKISISRNYFQQNRKELANQKNVRSADNKQRQFWLKKLYWSVKDHEEQILEALEK-D 70

Query: 108 SGKPYHSNSLADLEQILQLTRYYAGGADKFTGGEYIPLNQDKYAY----TMKVPYGVVAQ 163
             +    +   +  ++L    +   G  K+   + +  N   + +      K+  G V  
Sbjct: 71  FHRSRQESISLEYVKLLGDILHLIEGIPKWNKPKKVRDNSAPFMFGNINIEKISRGNVLV 130

Query: 164 IVPWNYPLAMASWKIQSCLAAGNTIVIKPAENTSLSLLYFAQLVKEAGFPPGVLNILPGY 223
           I P+N+P+ +A   +   L+AGNT+++KP+E T    L    +VK    P GVL I+ G 
Sbjct: 131 ISPFNFPVLLALAPVACALSAGNTVILKPSEMTPHCALVLEDIVKSCQLPEGVLQIVQG- 189

Query: 224 GSVTGTAMASHTDIDKIAFTGSTAVGQKVMSLAAQSNLKAVTLECGGKSPCLI---FADA 280
           G    T + +   +D I +TGS  VG  +++ AA  NL    LE GGKSP  I       
Sbjct: 190 GVEQTTKLINSESLDMIFYTGSPRVGS-IVAQAAAKNLVPCVLELGGKSPTFITGSLQKK 248

Query: 281 NLDEAIPWVAGGIFYNSGQNCTANSRIYVHEDIYEEFLTKFEEYAKSNWKFGAKFDP-FD 339
           NL+ A+  +  G F N+GQ C +   + VHE IY++ +       K + K   +  P  +
Sbjct: 249 NLETALKRIFFGAFGNAGQICVSPDYLLVHESIYDDVV-------KESGKVMKELYPDLN 301

Query: 340 KDCTLGPVISKVQYDRIQSYVEHGKASEKLGFKEFAEYPSKGYFIPPTIFSDVPNSSKLS 399
           +      +I K  YD+    ++  K  +        +  S    IPPTI  D      L 
Sbjct: 302 EHTEYTHMIHKASYDKTLEKLQKTKGRKVSAADVKIDNTSGKLMIPPTIVFDSDWDDALM 361

Query: 400 QEEIFGPVGVVASFSTYEEAI-KLANDSSYGLASCVFSENARTTAQFARDIRAGTVWINS 458
           +EE F PV  V  ++  +  I K+ +     L   +FSE  +        +R+G   I  
Sbjct: 362 EEENFAPVLPVIKYTDIDATIDKILSKHDTPLVQYIFSEKQKEIDHILARLRSGDCII-- 419

Query: 459 SNDEEISV-----PFGGFKMS 474
             D  I V     PFGG   S
Sbjct: 420 -CDTTIHVGIKDAPFGGIGQS 439

>Kwal_26.7595
          Length = 524

 Score =  122 bits (305), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 100/330 (30%), Positives = 155/330 (46%), Gaps = 18/330 (5%)

Query: 159 GVVAQIVPWNYPLAMASWKIQSCLAAGNTIVIKPAENTSLSLLYFAQLVKEAGFPPGVLN 218
           G V  I P+NYP+ ++   I   +A GN++V KP+E    + +   Q++K++      ++
Sbjct: 124 GAVLVISPFNYPVLLSLDPIAGAIAGGNSVVWKPSELVPATSIILEQILKDS-LGSDWIS 182

Query: 219 ILPGYGSVTGTAMASHTDIDKIAFTGSTAVGQKVMSLAAQSNLKAVTLECGGKSPCLI-- 276
           ++ G    T T +  +   DKI +TGSTAVG  +++L A  NL   TLE GGKSP  I  
Sbjct: 183 VVQGAIPET-TKLIKNAQFDKIFYTGSTAVGS-IVALEAGKNLVPYTLELGGKSPVFITE 240

Query: 277 -FADANLDEAIPWVAGGIFYNSGQNCTANSRIYVHEDIYEEFLTKFEEYAKSNWKFGAKF 335
            F+ + +  A+  V  G F NSGQ C A+  + VH    E       E     W      
Sbjct: 241 HFSKSKIRAALSRVYFGAFSNSGQTCVASDYVLVHSSQEELVKQLTREILDEFWP----- 295

Query: 336 DPFDKDCTLGPVISKVQYDRIQSYVEHGKASEKLGFKEFAEYPSKGYFIPPTIFSDVPNS 395
              D++     +I +  Y+     +E+    + L        P +   IPPT+  DV   
Sbjct: 296 -QLDENTEYTSMIHERAYNNTVKKLENTNGIKILP-SNVGSLPERC--IPPTVVFDVDWD 351

Query: 396 SKLSQEEIFGPVGVVASFSTYEEAI-KLANDSSYGLASCVFSENARTTAQFARDIRAGTV 454
             L +EE F PV    ++S  + AI K+    +Y LA  +FS+N R   Q    I++G  
Sbjct: 352 DALMKEENFAPVLPFVTYSNLDSAISKVVELHNYPLALYIFSDNRREIDQIMFQIKSGGC 411

Query: 455 WINSS--NDEEISVPFGGFKMSGIGRELGR 482
            I  +  +   +  PFGG + SG G   G+
Sbjct: 412 VIGDTVIHVAAMDAPFGGIRSSGSGNYHGK 441

>Scas_717.74
          Length = 522

 Score =  121 bits (304), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 92/325 (28%), Positives = 153/325 (47%), Gaps = 23/325 (7%)

Query: 155 KVPYGVVAQIVPWNYPLAMASWKIQSCLAAGNTIVIKPAENTSLSLLYFAQLVKEAGFPP 214
           K+  G V  I P+N+P+ +A   +   + AGN++++KP+E T+ + L   ++++EAGFP 
Sbjct: 121 KIARGNVLVISPFNFPVLLALVPVAHAIGAGNSVILKPSERTAHTALVMQRIIEEAGFPD 180

Query: 215 GVLNILPGYGSVTGTAMASHTDIDKIAFTGSTAVGQKVMSLAAQSNLKAVTLECGGKSPC 274
           G++ ++ G    T   + S  D+D I +TGS  VG  +   AA+ NL    LE GGKSP 
Sbjct: 181 GLVQVVQGAIDETQRLITS-KDLDMIFYTGSPTVGSIIAQEAAK-NLTPCVLELGGKSPT 238

Query: 275 LI---FADANLDEAIPWVAGGIFYNSGQNCTANSRIYVHEDIYEEFLTKFEEYAKSNWKF 331
            I   F D NL  A+  +  G F NSGQ C +   + VHE  Y +     +E        
Sbjct: 239 FITENFNDKNLKTALKRIFFGAFGNSGQICVSPDYLLVHESKYNKVAALAKEV------L 292

Query: 332 GAKFDPFDKDCTLGPVISKVQYDRIQSYVEHGKASEKLGFKEFAEYPSKGYFIPPTIFSD 391
              F   +       +IS+  Y+     +E   + EK  F+  ++       +PPT+  +
Sbjct: 293 IEMFPEVNDSTEFTHLISETAYNTTLKKLE-ATSGEK--FQAKSDLSDTNICVPPTLIFN 349

Query: 392 VPNSSKLSQEEIFGPVGVVASFSTYEEAI-KLANDSSYGLASCVFSENARTTAQFARDIR 450
                   Q+E F P+  V  +S  ++ + K+    +  L   +FS++    +     ++
Sbjct: 350 CQWEDSTMQQENFAPILPVLKYSNLDDTLDKIIATHNNPLVQYIFSDSNEEISHILLRLK 409

Query: 451 AGTVWINSSNDEEISV-----PFGG 470
           +G   I   ND  + V     PFGG
Sbjct: 410 SGDCVI---NDTILHVGIQDAPFGG 431

>Kwal_23.5714
          Length = 576

 Score =  121 bits (304), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 131/494 (26%), Positives = 214/494 (43%), Gaps = 35/494 (7%)

Query: 22  LFINNEFVKSSDGKK--IESINPSTEESIVS-FFAASEKDVNSAVTAARDAFENNWSKTS 78
           + IN + +  ++G +   E  NP+    +++    AS+KDV  A+ A++DA +  W K  
Sbjct: 62  VVINGKRIYHNEGGRHYFEQTNPAKHSQVLANVTQASKKDVLDAIQASKDA-KAKWYKMP 120

Query: 79  GEQRGILLSKLFDLIE-RDKLLLAAIETLDSGKPYHS---NSLADLEQILQLTRYYAGGA 134
              R  +  K  DLI  + +  + A   L  GK  +    + + +L    +    YA   
Sbjct: 121 FYDRAAVFLKAADLISTKYRYDMLAATMLGQGKNVYQAEIDCITELADFFRFNVKYASEL 180

Query: 135 DKFTGGEYIPLNQDKYAYTMKVPYGVVAQIVPWNYPLAMASWKIQSCLAAGNTIVIKPAE 194
                 E  P   +K  Y  +   G V  + P+N+  A++   I +    GNT+V KP++
Sbjct: 181 YNQQPCESSPGVWNKAEY--RPLEGFVYAVTPFNF-TAISGNLIGAPALMGNTVVWKPSQ 237

Query: 195 NTSLSLLYFAQLVKEAGFPPGVLNILPGYGSVTGTAMASHTDIDKIAFTGSTAVGQKVMS 254
              LS      +++EAG P GV+N +PG       A+ +  +   + FTGSTAV +++  
Sbjct: 238 AACLSNYLLLTVLEEAGLPHGVVNFIPGNPVEVTDAVLADKEFAALHFTGSTAVFKQLYG 297

Query: 255 LAAQ-------SNLKAVTLECGGKSPCLIFADANLDEAIPWVAGGIFYNSGQNCTANSRI 307
              Q        +   +  E GGK+  L+   A++  A+     G F   GQ C+A SR+
Sbjct: 298 KIQQGVVNDLYRDYPRIVGETGGKNFHLVHPSASIPHAVLSTLRGAFEYQGQKCSAASRL 357

Query: 308 YVHEDIYEEFLTK----FEEYAKSNWKFGAKFDPFDKDCTLGPVISKVQYDRIQSYVEHG 363
           Y+      EFL       +E    N    +K +  D    +GPVI +  ++++ + +E  
Sbjct: 358 YLPASRSAEFLEDLAGTLKEVRTVNTS-ASKLNGGDLHGFMGPVIHQQSFEKLANALEEA 416

Query: 364 KASEKLGFKEFAEY-PSKGYFIPPTIFSDVPNSSKLSQEEIFGPVGVV-----ASFSTYE 417
           K   +L      E   S G+FI PT+        K    E FGP+  V     A F+   
Sbjct: 417 KNDPELEIICGGECDKSNGWFIEPTVVKTTNPLHKFMSTEFFGPLLTVCEYPDAEFTQVC 476

Query: 418 EAIKLANDSSYGLASCVFSENARTTAQFARDIR--AGTVWINSSNDEEI--SVPFGGFKM 473
           E I     +SYGL   VF+ +    A     ++  AG  +IN      +     FGG +M
Sbjct: 477 ETID--KTTSYGLTGAVFARDRDAIAIADEKLKYSAGNFYINDKCTGAVVGQQWFGGARM 534

Query: 474 SGIGRELGRNGVDS 487
           SG   + G   + S
Sbjct: 535 SGTDDKAGSGNILS 548

>Scas_690.41
          Length = 581

 Score =  117 bits (293), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 119/485 (24%), Positives = 209/485 (43%), Gaps = 27/485 (5%)

Query: 22  LFINNE--FVKSSDGKKIESINPSTEESIVS-FFAASEKDVNSAVTAARDAFENNWSKTS 78
           L IN E  +  +S+       NP+  + +++    A+E DV  A+ AA++A ++ W +  
Sbjct: 69  LVINGERIYYNNSNRSVFAQSNPACHKQVLANVTQATELDVKDAIQAAKEA-KSKWYQLP 127

Query: 79  GEQRGILLSKLFDLIE-RDKLLLAAIETLDSGKPYHSNSLADLEQILQLTRYYAGGADKF 137
              R  +  K  DLI  + +  + A   L  GK  +   +  + ++    R+    A   
Sbjct: 128 FYDRAAVFLKAADLISTKYRYDMLAATMLGQGKNVYQAEIDCITELSDFFRFNVKYAHDL 187

Query: 138 TGGEYIPLNQDKYAYTMKVPY-GVVAQIVPWNYPLAMASWKIQSCLAAGNTIVIKPAENT 196
              + +   Q  +      P  G +  + P+N+  A+A+  I +    GNT++ KP+++ 
Sbjct: 188 YNLQPVQSAQGVWNKAEYRPLEGFIYAVSPFNF-TAIAANLIGAPALMGNTVIWKPSQSA 246

Query: 197 SLSLLYFAQLVKEAGFPPGVLNILPGYGSVTGTAMASHTDIDKIAFTGSTAVGQKVMSLA 256
           +LS      +++EAG P GV+N +PG   +    + +  +   + FTGST V +++    
Sbjct: 247 ALSNYLLLTVLEEAGLPKGVINFVPGDPILVTDQLLASKEFGGLHFTGSTQVFKQLYGKI 306

Query: 257 AQ-------SNLKAVTLECGGKSPCLIFADANLDEAIPWVAGGIFYNSGQNCTANSRIYV 309
                     +   +  E GGK+  LI   AN+  A+     G F   GQ C+A SR+Y+
Sbjct: 307 QTGVVNGLYRDYPRIVGETGGKNFHLIHKSANIPNAVFSTIRGAFEFQGQKCSATSRLYI 366

Query: 310 HEDIYEEFLTKF-----EEYAKSNWKFGAKFDPFDKDCTLGPVISKVQYDRIQSYVEHGK 364
            +   EEF         ++         +     D    +GPVI +  Y+++   +E  K
Sbjct: 367 PQSKSEEFFRDLIGTLQQQKVTPVNTAASPISGGDLHGFMGPVIHEQSYNKLIKVIEEAK 426

Query: 365 ASEKLGFKEFAEY-PSKGYFIPPTIFSDVPNSSKLSQEEIFGPVGVVASF--STYEEAIK 421
              +L      +Y   +G+F+ PTI        K    E FGP+  V  +  + + E   
Sbjct: 427 TDPELEIIYGGQYDKGEGWFVGPTIIKCKDPKHKFMTTEFFGPILSVYEYPDNKFSETCD 486

Query: 422 LANDSS-YGLASCVFSEN--ARTTAQFARDIRAGTVWINSSNDEEISVP--FGGFKMSGI 476
           L + +S YGL   VF+++  A   A        G  +IN      +     FGG +MSG 
Sbjct: 487 LIDQTSMYGLTGSVFAKDREAINLADEKLKFSCGNFYINDKCTGAVVAQQWFGGARMSGT 546

Query: 477 GRELG 481
             + G
Sbjct: 547 DDKSG 551

>YHR037W (PUT2) [2324] chr8 (181969..183696)
           Delta-1-pyrroline-5-carboxylate dehydrogenase (P5C
           dehydrogenase), carries out the second step in proline
           degradation, allows proline to be used as a nitrogen
           source [1728 bp, 575 aa]
          Length = 575

 Score =  117 bits (293), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 127/490 (25%), Positives = 216/490 (44%), Gaps = 38/490 (7%)

Query: 22  LFINNEFVKSSDGKKI-ESINPSTEESIVS-FFAASEKDVNSAVTAARDAFENNWSKTSG 79
           L IN E +  ++ + +    NP+  + +++    A+EKDV +AV AA+DA + +W     
Sbjct: 63  LVINGERIYDNNERALFPQTNPANHQQVLANVTQATEKDVMNAVKAAKDA-KKDWYNLPF 121

Query: 80  EQRGILLSKLFDLIE-RDKLLLAAIETLDSGKPYHSNSLADLEQILQLTRYYAGGADKFT 138
             R  +  K  DLI  + +  + A   L  GK  +   +  + ++    RYY   A    
Sbjct: 122 YDRSAIFLKAADLISTKYRYDMLAATMLGQGKNVYQAEIDCITELSDFFRYYVKYASDLY 181

Query: 139 GGEYIPLNQDKYAYTMKVPY-GVVAQIVPWNYPLAMASWKIQSCLAAGNTIVIKPAENTS 197
             + +      +      P  G V  + P+N+  A+A+  I +    GNT+V KP++  +
Sbjct: 182 AQQPVESADGTWNKAEYRPLEGFVYAVSPFNF-TAIAANLIGAPALMGNTVVWKPSQTAA 240

Query: 198 LSLLYFAQLVKEAGFPPGVLNILPGYGSVTGTAMASHTDIDKIAFTGSTAVGQ----KVM 253
           LS      +++EAG P GV+N +PG        + +  D   + FTGST V +    K+ 
Sbjct: 241 LSNYLLMTVLEEAGLPKGVINFIPGDPVQVTDQVLADKDFGALHFTGSTNVFKSLYGKIQ 300

Query: 254 SLAAQSNLK---AVTLECGGKSPCLIFADANLDEAIPWVAGGIFYNSGQNCTANSRIYVH 310
           S   +   +    +  E GGK+  L+   AN+  A+     G F   GQ C+A SR+Y+ 
Sbjct: 301 SGVVEGKYRDYPRIIGETGGKNFHLVHPSANISHAVLSTIRGTFEFQGQKCSAASRLYLP 360

Query: 311 EDIYEEFLTKFEEYAKSNWKFGAKFDPFDKDCT----------LGPVISKVQYDRIQSYV 360
           E   EEFL+      +S         P +   +          +GPVI +  +D++   +
Sbjct: 361 ESKSEEFLSDMFGILQSQ-----NVVPMNTSASPISGGNLRGFMGPVIHEQSFDKLVKVI 415

Query: 361 EHGKASEKLGFKEFAEY-PSKGYFIPPTIFSDVPNSSKLSQEEIFGPVGVVASF--STYE 417
           E  K   +L      +Y  S+G+F+ PT+             E FGP+  V  +  + + 
Sbjct: 416 EDAKKDPELEILYGGQYDKSQGWFVGPTVIKAKRPDHPYMSTEFFGPILTVYEYPDTEFN 475

Query: 418 EAIKLA-NDSSYGLASCVFSENARTTAQFARD---IRAGTVWINSSNDEEISVP--FGGF 471
           E   +  N S Y L   +F+++ R   ++A +     AG  +IN      +     FGG 
Sbjct: 476 EICDIIDNTSQYALTGAIFAKD-RKAIEYADEKLKFSAGNFYINDKCTGAVVSQQWFGGA 534

Query: 472 KMSGIGRELG 481
           +MSG   + G
Sbjct: 535 RMSGTDDKAG 544

>KLLA0B12540g 1094239..1095804 similar to sp|Q04458 Saccharomyces
           cerevisiae YMR110c, start by similarity
          Length = 521

 Score =  109 bits (272), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 101/342 (29%), Positives = 149/342 (43%), Gaps = 28/342 (8%)

Query: 151 AYTMKVPYGVVAQIVPWNYPLAMASWKIQSCLAAGNTIVIKPAENTSLSLLYFAQLVKEA 210
            +  K+  G V  I P+N+P+ +A   +   +A GN++V KP+E T        ++  EA
Sbjct: 117 TFVEKIALGTVLVISPFNFPILLALDPLAGAIAGGNSVVFKPSELTPACAEVMEEICNEA 176

Query: 211 GFPPGVLNILPGYGSVTGTAMASHTDIDKIAFTGSTAVGQKVMSLAAQSNLKAVTLECGG 270
            F  G +  + G G+   +A+      DKI +TGST VG  +   AA+S L    LE GG
Sbjct: 177 -FEKGQVETVQG-GAEETSALVESGKFDKIFYTGSTTVGTIIAEKAAKS-LTPCVLELGG 233

Query: 271 KSPCLI---FADANLDEAIPWVAGGIFYNSGQNCTANSRIYVHEDIYEEFLTKFEEYAKS 327
           KSP  I      +  + AI  +      N+GQ C A   +   + IY+EF+        S
Sbjct: 234 KSPVFISPNLPKSQWETAIRRIYYSSMGNAGQICVAADYVLCPDSIYDEFV-------DS 286

Query: 328 NWKFGAKFDP-FDKDCTLGPVISKVQYDRIQSYVEHGKASEKLGFKEFAEYPSK--GYFI 384
             K   +F P    D     +I +  Y+RIQ+ +E  K     G K  A++        I
Sbjct: 287 CKKVLNEFYPSVTSDTEYTHMIHERAYNRIQTVIETTK-----GQKTVAQHSDNLPPLCI 341

Query: 385 PPTIFSDVPNSSKLSQEEIFGPVGVVASFSTYEEAI-KLANDSSYGLASCVFSENARTTA 443
           PPTI SDV         E FGP+  +  ++  +E I  L       L   +F+ +     
Sbjct: 342 PPTIISDVSWDDPSMTGENFGPILPIMRYTDLDETIDTLIKRFDTPLVQYIFTNSKDEID 401

Query: 444 QFARDIRAGTVWINSS----NDEEISVPFGGFKMSGIGRELG 481
                IR+G   +N +      EE   PFGG   SG G   G
Sbjct: 402 HILTRIRSGACVVNDTLLHVGIEE--APFGGIGTSGYGNYHG 441

>YMR110C (YMR110C) [4067] chr13 complement(490393..491991) Protein
           with similarity to aldehyde dehydrogenases [1599 bp, 532
           aa]
          Length = 532

 Score =  102 bits (255), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 128/482 (26%), Positives = 206/482 (42%), Gaps = 77/482 (15%)

Query: 31  SSDGKKIESINPSTEESIVSFFAASEKDVNSAVTAARDAF---------ENNWSKTSGEQ 81
           S+DG KI +  P ++             ++  V  +R+ F         ENN  K   E 
Sbjct: 2   SNDGSKILNYTPVSK-------------IDEIVEISRNFFFEKQLKLSHENNPRKKDLEF 48

Query: 82  RGILLSKLFDLI-ERDKLLLAAIETLDSGKPYHSNSLAD--------LEQILQLT----- 127
           R + L KL+  + + ++ L+ A+      K +H N +          +  IL L      
Sbjct: 49  RQLQLKKLYYAVKDHEEELIDAMY-----KDFHRNKIESVLNETTKLMNDILHLIEILPK 103

Query: 128 ----RYYAGGADKFTGGEYIPLNQDKYAYTMKVPYGVVAQIVPWNYPLAMASWKIQSCLA 183
               R  +  +  F  G+ I           K+  G V  I P+N+PL +A   + + LA
Sbjct: 104 LIKPRRVSDSSPPFMFGKTI---------VEKISRGSVLIIAPFNFPLLLAFAPLAAALA 154

Query: 184 AGNTIVIKPAENTSLSLLYFAQLVKEAGFPPGVLNILPGYGSVTGTAMASHTDIDKIAFT 243
           AGNTIV+KP+E T  + +    L+  AGFP G++ ++ G    T T +      D I +T
Sbjct: 155 AGNTIVLKPSELTPHTAVVMENLLTTAGFPDGLIQVVQGAIDET-TRLLDCGKFDLIFYT 213

Query: 244 GSTAVGQKVMSLAAQSNLKAVTLECGGKSPCLI---FADANLDEAIPWVAGGIFYNSGQN 300
           GS  VG  V   AA+S L    LE GGKSP  I   F  +N+  A+  +  G F NSGQ 
Sbjct: 214 GSPRVGSIVAEKAAKS-LTPCVLELGGKSPTFITENFKASNIKIALKRIFFGAFGNSGQI 272

Query: 301 CTANSRIYVHEDIYEEFLTKFEEYAKSNWKFGAKFDP-FDKDCTLGPVISKVQYDRIQSY 359
           C +   + VH+ IY + + + E           +F P FD+      +I +  Y +  + 
Sbjct: 273 CVSPDYLLVHKSIYPKVIKECESVLN-------EFYPSFDEQTDFTRMIHEPAYKKAVAS 325

Query: 360 VEHGKASEKLGFKEFAEYPSKGY-FIPPTIFSDVPNSSKLSQEEIFGPVGVVASFSTYEE 418
           +     S+ +  K      ++    +PPTI  ++     L ++E F PV  +  +   +E
Sbjct: 326 INSTNGSKIVPSKISINSDTEDLCLVPPTIVYNIGWDDPLMKQENFAPVLPIIEYEDLDE 385

Query: 419 AI-KLANDSSYGLASCVFSENARTTAQFARDIRAGTVWINSSNDEEISV-----PFGGFK 472
            I K+  +    L   +FS++     +    +R+G   +    D  I V     PFGG  
Sbjct: 386 TINKIIEEHDTPLVQYIFSDSQTEINRILTRLRSGDCVV---GDTVIHVGITDAPFGGIG 442

Query: 473 MS 474
            S
Sbjct: 443 TS 444

>Kwal_55.22012
          Length = 789

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 6/58 (10%)

Query: 15  TYEQPLGLFINNEFVKSSDGKKIESINPSTEESIV-----SFFAA-SEKDVNSAVTAA 66
           + E P G+F  N  V++ DG  + S NPS  E  V     SFF + SE+ +++A  A+
Sbjct: 316 SVETPQGIFFGNNKVENDDGPNMPSSNPSQMEQYVAPDRFSFFCSDSEETIHAADIAS 373

>KLLA0B08327g 742205..746809 similar to sp|P22082 Saccharomyces
           cerevisiae YOR290c SNF2 component of SWI/SNF global
           transcription activator complex, hypothetical start
          Length = 1534

 Score = 30.0 bits (66), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 42/86 (48%), Gaps = 11/86 (12%)

Query: 350 KVQYDRIQSYVEHGKASEKLGFKEFAEYPSKG------YFIPPTIFSDVPNSSKLSQEEI 403
           K Q++ I+ Y++   AS  +    F+ YP +G        +PP  ++D+ N   LS    
Sbjct: 346 KKQHEDIEKYID--VASPHIMVDCFS-YPEQGGIPGSTPLVPPISYTDLLNQQNLSITPS 402

Query: 404 FGPVGV--VASFSTYEEAIKLANDSS 427
             PVG+   ++  TY+  I L  D+S
Sbjct: 403 LLPVGLDPRSAMETYQTLIALDLDTS 428

>Kwal_55.21835
          Length = 319

 Score = 29.3 bits (64), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 30/72 (41%)

Query: 227 TGTAMASHTDIDKIAFTGSTAVGQKVMSLAAQSNLKAVTLECGGKSPCLIFADANLDEAI 286
           T  A+  H     ++ +      Q++ +L A SNL A          C+   +    EA+
Sbjct: 164 TLIAIVIHKIPAVLSLSSVMVTRQQLPTLEAVSNLLAFAASTPAAYLCISILNLKKSEAL 223

Query: 287 PWVAGGIFYNSG 298
            WV+G I   SG
Sbjct: 224 EWVSGNILLMSG 235

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.133    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,511,142
Number of extensions: 724123
Number of successful extensions: 2162
Number of sequences better than 10.0: 67
Number of HSP's gapped: 2000
Number of HSP's successfully gapped: 67
Length of query: 493
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 387
Effective length of database: 12,926,601
Effective search space: 5002594587
Effective search space used: 5002594587
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)