Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0D09669g1351335723e-77
Sklu_2075.21131191666e-16
Kwal_33.154481131001405e-12
Scas_647.5116110874e-04
ACR033C9553700.053
YJR012C20785720.066
KLLA0F02706g95685660.51
CAGL0J04972g33975585.1
ACR128C82751586.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D09669g
         (133 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D09669g 816343..816750 no similarity, hypothetical start         224   3e-77
Sklu_2075.2 YJR012C, Contig c2075 940-1281                             69   6e-16
Kwal_33.15448                                                          59   5e-12
Scas_647.5                                                             38   4e-04
ACR033C [1081] [Homologous to ScYJR012C - SH] (420391..420678) [...    32   0.053
YJR012C (YJR012C) [2915] chr10 complement(459709..460332) Protei...    32   0.066
KLLA0F02706g 245783..248653 gi|14348673|gb|AAK61336.1|AF332582_1...    30   0.51 
CAGL0J04972g 472984..474003 some similarities with tr|Q12100 Sac...    27   5.1  
ACR128C [1175] [Homologous to ScYPL147W (PXA1) - SH] (573251..57...    27   6.2  

>KLLA0D09669g 816343..816750 no similarity, hypothetical start
          Length = 135

 Score =  224 bits (572), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 114/133 (85%), Positives = 114/133 (85%)

Query: 1   MENKEEATELSYDELMXXXXXXXXXXXXXXXXXXXLDQSLATEHHLKPRLKPWEQAKDVP 60
           MENKEEATELSYDELM                   LDQSLATEHHLKPRLKPWEQAKDVP
Sbjct: 1   MENKEEATELSYDELMDIIVNNKPVPNVVDVPDIILDQSLATEHHLKPRLKPWEQAKDVP 60

Query: 61  VMGGLVRQKEETKGLAENVELVKKSNSLEKLTNYYALEVEFQKQLKGYESSTGLKGRGRS 120
           VMGGLVRQKEETKGLAENVELVKKSNSLEKLTNYYALEVEFQKQLKGYESSTGLKGRGRS
Sbjct: 61  VMGGLVRQKEETKGLAENVELVKKSNSLEKLTNYYALEVEFQKQLKGYESSTGLKGRGRS 120

Query: 121 SAALSDQSSNHTD 133
           SAALSDQSSNHTD
Sbjct: 121 SAALSDQSSNHTD 133

>Sklu_2075.2 YJR012C, Contig c2075 940-1281
          Length = 113

 Score = 68.6 bits (166), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 61/119 (51%), Gaps = 13/119 (10%)

Query: 9   ELSYDELMXXXXXXXXXXXXXXXXXXXLDQSLATEHHLKPRLKPWEQAKDVPVMGGLVRQ 68
           +LSY+EL+                   LD S+ TE  LKPRLKPWE+       G  V +
Sbjct: 4   QLSYEELVDHIVNNKPVPNVVSVPNITLDSSMRTESLLKPRLKPWERK----AQGATVEE 59

Query: 69  KEE----TKGLAENVELVKKSNSLEKLTNYYALEVEFQKQLKGYESSTGLKGRGRSSAA 123
            +E     K + E+VE V K+ S E L+ YYA+E EF+KQL+ +     + G G+ + A
Sbjct: 60  PQELIQKAKEITEHVESVNKTQSFESLSRYYAIEAEFEKQLQHF-----MDGSGKDATA 113

>Kwal_33.15448
          Length = 113

 Score = 58.5 bits (140), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 51/100 (51%), Gaps = 2/100 (2%)

Query: 9   ELSYDELMXXXXXXXXXXXXXXXXXXXLDQSLATEHHLKPRLKPWEQAKDVPVMGGLVRQ 68
           +L+Y+EL+                    D SL T+  L+PR KPWEQ K+V V   +   
Sbjct: 5   QLTYEELVDHIINDKPVPNILAVPNITQDPSLITKSSLRPRAKPWEQKKEVTVT--IEGA 62

Query: 69  KEETKGLAENVELVKKSNSLEKLTNYYALEVEFQKQLKGY 108
            +E + +      V  S+S E L+ YYA+E EF++Q++ Y
Sbjct: 63  SDEAQAIDREAGAVSHSHSTESLSTYYAMETEFEQQMQSY 102

>Scas_647.5
          Length = 116

 Score = 38.1 bits (87), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 47/110 (42%), Gaps = 22/110 (20%)

Query: 9   ELSYDELMXXXXXXXXXXXXXXXXXXXLDQSLATEHHLKPRLKPWEQAKDVPVMG----- 63
           ELSYD+L+                   LD  L ++  L  R+KPWEQ   V V G     
Sbjct: 4   ELSYDDLVEHIVLNKPIPNVVQVPDTVLDSKLGSQPRLTQRIKPWEQ---VEVAGEETPT 60

Query: 64  ----GLVRQKEETKGLAENVELVKKSNSLEKLTNYYALEVEFQKQLKGYE 109
               GLV        L+ N +L K  ++L KL   YALE ++   L+  E
Sbjct: 61  NDNFGLV-------NLSTNSDLSKDMDNLSKL---YALEADYIATLQKKE 100

>ACR033C [1081] [Homologous to ScYJR012C - SH] (420391..420678)
          [288 bp, 95 aa]
          Length = 95

 Score = 31.6 bits (70), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 23/53 (43%)

Query: 2  ENKEEATELSYDELMXXXXXXXXXXXXXXXXXXXLDQSLATEHHLKPRLKPWE 54
          E  +E  ELSYD+L+                    D+S  +E  L PR KPWE
Sbjct: 9  EQPDEPQELSYDQLVDIIVNGKPVPNLVEVADQVHDESQCSESKLCPRKKPWE 61

>YJR012C (YJR012C) [2915] chr10 complement(459709..460332) Protein
           of unknown function [624 bp, 207 aa]
          Length = 207

 Score = 32.3 bits (72), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 35/85 (41%), Gaps = 8/85 (9%)

Query: 9   ELSYDELMXXXXXXXXXXXXXXXXXXXLDQSLATEHHLKPRLKPWEQAKDVPVMGGLVRQ 68
           ELSY+EL+                   LD+ LA+   L+PR +PWE        G L  Q
Sbjct: 81  ELSYEELLDHILNNKPIPNIVEVPNVTLDEGLASTPSLRPRPRPWE--------GQLQHQ 132

Query: 69  KEETKGLAENVELVKKSNSLEKLTN 93
             +      N+ L     SLE +T+
Sbjct: 133 SHQGSLDKPNISLDIDQESLEGMTS 157

>KLLA0F02706g 245783..248653 gi|14348673|gb|AAK61336.1|AF332582_1
           Kluyveromyces lactis mismatch repair protein Msh2p,
           start by similarity
          Length = 956

 Score = 30.0 bits (66), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 42/85 (49%), Gaps = 24/85 (28%)

Query: 45  HLKPRLKPWEQAKDVPVMGGLVRQKEETKGLAENVELVKK---------SNSLEKL---- 91
           +L+  LK ++ A+ VPV+  L++QK E     + + LVK+         +N LEKL    
Sbjct: 405 NLEDVLKIYQFAQMVPVISDLLKQKTEEVDSNDLMILVKEVLLDPMLENANPLEKLKELV 464

Query: 92  -----------TNYYALEVEFQKQL 105
                      TN + ++VEF +QL
Sbjct: 465 ETTVDLEAYEETNEFMIKVEFNEQL 489

>CAGL0J04972g 472984..474003 some similarities with tr|Q12100
           Saccharomyces cerevisiae YDL025c, hypothetical start
          Length = 339

 Score = 26.9 bits (58), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 36/75 (48%), Gaps = 11/75 (14%)

Query: 47  KPRLKPWEQAKDVPVMGGLVRQKEETKGLAENVE----------LVKKSNSLEKLTNYYA 96
           KPR  PWE A+    +  +  ++ +T  +  N+E          L    +SL++LT   A
Sbjct: 250 KPRY-PWESARFSNSIYKIYSEEADTSVVLTNLEDDEDLKELILLFLHIDSLKRLTMKKA 308

Query: 97  LEVEFQKQLKGYESS 111
           LE +F   +KG + S
Sbjct: 309 LESKFLASIKGVKHS 323

>ACR128C [1175] [Homologous to ScYPL147W (PXA1) - SH]
           (573251..575734) [2484 bp, 827 aa]
          Length = 827

 Score = 26.9 bits (58), Expect = 6.2,   Method: Composition-based stats.
 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 1/51 (1%)

Query: 60  PVMGGLVRQKEETKGLAENVELVKKSNSLEKLTNYYALEVEFQKQLKGYES 110
           P +G LV ++   +G   N  L   +N+ E++  Y   EVE  K +K YE+
Sbjct: 346 PPLGKLVSKRSSAEGAYYNYHLNMINNN-EEIAFYQGTEVERTKVIKIYEN 395

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.304    0.123    0.328 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,465,885
Number of extensions: 112628
Number of successful extensions: 296
Number of sequences better than 10.0: 20
Number of HSP's gapped: 293
Number of HSP's successfully gapped: 20
Length of query: 133
Length of database: 16,596,109
Length adjustment: 90
Effective length of query: 43
Effective length of database: 13,480,489
Effective search space: 579661027
Effective search space used: 579661027
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 55 (25.8 bits)