Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0D09647g40239619140.0
ACR034W39739610791e-146
YJR013W40338010321e-139
Kwal_33.1544939637610291e-138
Scas_647.64233939871e-131
CAGL0B03905g4313859431e-125
CAGL0H00220g40879780.13
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D09647g
         (396 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D09647g complement(814829..816037) some similarities with s...   741   0.0  
ACR034W [1082] [Homologous to ScYJR013W - SH] complement(420791....   420   e-146
YJR013W (YJR013W) [2916] chr10 (460296..461507) Protein with mod...   402   e-139
Kwal_33.15449                                                         400   e-138
Scas_647.6                                                            384   e-131
CAGL0B03905g 385192..386487 similar to sp|P47088 Saccharomyces c...   367   e-125
CAGL0H00220g complement(13625..14851) similar to sp|P41733 Sacch...    35   0.13 

>KLLA0D09647g complement(814829..816037) some similarities with
           sp|P47088 Saccharomyces cerevisiae YJR013w singleton,
           hypothetical start
          Length = 402

 Score =  741 bits (1914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/396 (93%), Positives = 370/396 (93%)

Query: 1   MHRKVIXXXXXXXXXRIGFFSYGIFQDSHFDVKYTDIDYFVFHDAAGYVNNGQSPYLRDT 60
           MHRKVI         RIGFFSYGIFQDSHFDVKYTDIDYFVFHDAAGYVNNGQSPYLRDT
Sbjct: 1   MHRKVILLLTVSLLLRIGFFSYGIFQDSHFDVKYTDIDYFVFHDAAGYVNNGQSPYLRDT 60

Query: 61  XXXXXXXXXXXXXXXXXKWIHMGKVFFVLFDLITGVMIIKLLQGSCQLTKQLILASIWLL 120
                            KWIHMGKVFFVLFDLITGVMIIKLLQGSCQLTKQLILASIWLL
Sbjct: 61  YRYTPLLSFLLLPNYYLKWIHMGKVFFVLFDLITGVMIIKLLQGSCQLTKQLILASIWLL 120

Query: 121 NPIVITISTRGNAESVLCFLIICALYFLKRDRLLISGLFYGLSIHFKIYPIIYALPIGIY 180
           NPIVITISTRGNAESVLCFLIICALYFLKRDRLLISGLFYGLSIHFKIYPIIYALPIGIY
Sbjct: 121 NPIVITISTRGNAESVLCFLIICALYFLKRDRLLISGLFYGLSIHFKIYPIIYALPIGIY 180

Query: 181 LLLSSHNRNCIWRLFMIGISTLIGITAPTYFMYKLYGSEFIEHSYMYHLTRTDHRHNFSI 240
           LLLSSHNRNCIWRLFMIGISTLIGITAPTYFMYKLYGSEFIEHSYMYHLTRTDHRHNFSI
Sbjct: 181 LLLSSHNRNCIWRLFMIGISTLIGITAPTYFMYKLYGSEFIEHSYMYHLTRTDHRHNFSI 240

Query: 241 WNLVLLLESAGIHLSQSIELSKLAFVPQLTLCAVLPYLLWKSQTFENLMNVLFVQTYAFV 300
           WNLVLLLESAGIHLSQSIELSKLAFVPQLTLCAVLPYLLWKSQTFENLMNVLFVQTYAFV
Sbjct: 241 WNLVLLLESAGIHLSQSIELSKLAFVPQLTLCAVLPYLLWKSQTFENLMNVLFVQTYAFV 300

Query: 301 TFNKVCTSQYFIWYLVLSPFYFANTTITWRKGVVCIFLWILSQAVWLSQAYLLEFKGQNV 360
           TFNKVCTSQYFIWYLVLSPFYFANTTITWRKGVVCIFLWILSQAVWLSQAYLLEFKGQNV
Sbjct: 301 TFNKVCTSQYFIWYLVLSPFYFANTTITWRKGVVCIFLWILSQAVWLSQAYLLEFKGQNV 360

Query: 361 FFPNLFFGNIVFFLINVYLLGVFITDIKSRTSFQDN 396
           FFPNLFFGNIVFFLINVYLLGVFITDIKSRTSFQDN
Sbjct: 361 FFPNLFFGNIVFFLINVYLLGVFITDIKSRTSFQDN 396

>ACR034W [1082] [Homologous to ScYJR013W - SH]
           complement(420791..421984) [1194 bp, 397 aa]
          Length = 397

 Score =  420 bits (1079), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 211/396 (53%), Positives = 279/396 (70%), Gaps = 4/396 (1%)

Query: 1   MHRKVIXXXXXXXXXRIGFFSYGIFQDSHFDVKYTDIDYFVFHDAAGYVNNGQSPYLRDT 60
           M R+           R+GFFSYGI+QD+HF VKYTDIDY VFHDAA YV  G SPYLRDT
Sbjct: 1   MKREECLLVLAGLLARVGFFSYGIYQDAHFAVKYTDIDYHVFHDAARYVAQGNSPYLRDT 60

Query: 61  XXXXXXXXXXXXXXXXXKWIHMGKVFFVLFDLITGVMIIKLLQGSCQLTKQLILASIWLL 120
                            +W+H GK  FVLFDL+ GVM++ LL G C   ++LILAS+WLL
Sbjct: 61  YRYTPLLSWMLVPNHWLQWVHFGKFIFVLFDLLAGVMVMNLL-GKCGRRRKLILASLWLL 119

Query: 121 NPIVITISTRGNAESVLCFLIICALYFLKRDRLLISGLFYGLSIHFKIYPIIYALPIGIY 180
           NP+VIT+STRGNAESV+ FLI+  L  L+  +  +SG  YG++IHFKIYPIIYALPI IY
Sbjct: 120 NPVVITVSTRGNAESVMAFLIMWFLVHLRNRQFALSGFVYGVAIHFKIYPIIYALPISIY 179

Query: 181 LLLSSHNRNCIWRLFMIGISTLIGITAPTYFMYKLYGSEFIEHSYMYHLTRTDHRHNFSI 240
           +  S  +R  + RL  +GI+TL  +      MY +YG EF+EH+Y+YH TRTDHRHNFS+
Sbjct: 180 IRSSEGSRWFL-RLLTMGIATLATLVGCGIGMYYIYGWEFLEHAYIYHFTRTDHRHNFSL 238

Query: 241 WNLVLLLESAGIHLSQSIELSKLAFVPQLTLCAVLPYLLWKSQTFENLMNVLFVQTYAFV 300
           WN++L L+S+G+ +  +I  ++ AF+PQL +CA + Y+LW++ TF+N+  VLF+QT+AFV
Sbjct: 239 WNMLLYLDSSGV-VPTTINWAEFAFLPQLFICAAVTYVLWEAPTFQNMQCVLFLQTFAFV 297

Query: 301 TFNKVCTSQYFIWYLVLSPFYFANTTITWRKGVVCIFLWILSQAVWLSQAYLLEFKGQNV 360
           T+NKVCTSQYFIWYL+  P +  +TT++  KG+  IFLW+ +QA WL   YLLEF+G+N+
Sbjct: 298 TYNKVCTSQYFIWYLLFLPSFLLDTTLSGAKGIFLIFLWVGTQAWWLYNGYLLEFEGKNM 357

Query: 361 FFPNLFFGNIVFFLINVYLLGVFITDIKSRTSFQDN 396
           F+P LF   + FFL NVYLL  FI D + R ++Q N
Sbjct: 358 FYPRLFSACVTFFLANVYLLAQFILDCRRR-NYQTN 392

>YJR013W (YJR013W) [2916] chr10 (460296..461507) Protein with
           moderate similarity to mannosyltransferase I
           (glycosylphosphatidylinositol mannosyltransferase I, rat
           Pigm), which transfers the first mannose to
           glycosylphosphatidylinositol (GPI) during the
           biosynthesis of GPI membrane anchors [1212 bp, 403 aa]
          Length = 403

 Score =  402 bits (1032), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 210/380 (55%), Positives = 274/380 (72%), Gaps = 4/380 (1%)

Query: 16  RIGFFSYGIFQDSHFDVKYTDIDYFVFHDAAGYVNNGQSPYLRDTXXXXXXXXXXXXXXX 75
           R+GFF +GI+QD++F V+YTDIDYFVFHDAA YV  G+SPY RDT               
Sbjct: 16  RVGFFLFGIYQDANFKVRYTDIDYFVFHDAAKYVYEGKSPYARDTYRYTPLLSWLLVPNH 75

Query: 76  XXKWIHMGKVFFVLFDLITGVMIIKLLQGSCQLTKQLILASIWLLNPIVITISTRGNAES 135
              W H+GKV FV+FDL+TG++I+KLL  +    + LIL SIWLLNP+VITISTRGNAES
Sbjct: 76  YFGWFHLGKVIFVIFDLVTGLIIMKLLNQAISRKRALILESIWLLNPMVITISTRGNAES 135

Query: 136 VLCFLIICALYFLKRDRLLISGLFYGLSIHFKIYPIIYALPIGIYLLLSSHN---RNCIW 192
           VLC LI+  L+FL++ R  ++G+ YGLSIHFKIYPIIY +PI I++  +  N   R  + 
Sbjct: 136 VLCCLIMFTLFFLQKSRYTLAGILYGLSIHFKIYPIIYCIPIAIFIYYNKRNQGPRTQLT 195

Query: 193 RLFMIGISTLIGITAPTYFMYKLYGSEFIEHSYMYHLTRTDHRHNFSIWNLVLLLESAGI 252
            L  IG+STL  +    + MYK+YG EF++ +Y+YHL RTDHRHNFS+WN++L L+SA  
Sbjct: 196 SLLNIGLSTLTTLLGCGWAMYKIYGYEFLDQAYLYHLYRTDHRHNFSVWNMLLYLDSANK 255

Query: 253 HLSQSIELSKLAFVPQLTLCAVLPYLLWKSQTFENLMNVLFVQTYAFVTFNKVCTSQYFI 312
              +S  LS+ AFVPQL L  V   L W + TF+NL+ VLFVQT+AFVT+NKVCTSQYF+
Sbjct: 256 ENGES-NLSRYAFVPQLLLVLVTGCLEWWNPTFDNLLRVLFVQTFAFVTYNKVCTSQYFV 314

Query: 313 WYLVLSPFYFANTTITWRKGVVCIFLWILSQAVWLSQAYLLEFKGQNVFFPNLFFGNIVF 372
           WYL+  PFY + T I W+KG++   LW+ +Q +WLSQ Y LEF+G+NVF+P LF  +++F
Sbjct: 315 WYLIFLPFYLSRTHIGWKKGLLMATLWVGTQGIWLSQGYYLEFEGKNVFYPGLFIASVLF 374

Query: 373 FLINVYLLGVFITDIKSRTS 392
           F+ NV+LLG FITDIK  T 
Sbjct: 375 FVTNVWLLGQFITDIKIPTQ 394

>Kwal_33.15449
          Length = 396

 Score =  400 bits (1029), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 201/376 (53%), Positives = 270/376 (71%), Gaps = 6/376 (1%)

Query: 16  RIGFFSYGIFQDSHFDVKYTDIDYFVFHDAAGYVNNGQSPYLRDTXXXXXXXXXXXXXXX 75
           R+GFF YG++QD HFDVKYTDIDYFVF+DAA +V NG SPYLRDT               
Sbjct: 18  RVGFFLYGMYQDQHFDVKYTDIDYFVFNDAARFVFNGMSPYLRDTYRYTPLLSWLLVPNH 77

Query: 76  XXKWIHMGKVFFVLFDLITGVMIIKLLQGSCQLTKQLILASIWLLNPIVITISTRGNAES 135
              WIH GK+ FV+ DL+TGVMI+ LL+   +  ++LILAS+WLLN +VITISTRGNAES
Sbjct: 78  YLNWIHFGKMVFVVMDLLTGVMILALLEIPNK-RRRLILASLWLLNIMVITISTRGNAES 136

Query: 136 VLCFLIICALYFLKRDRLLISGLFYGLSIHFKIYPIIYALPIGIYLLLSSHNRNCIWRLF 195
           V+CFL++ +LYFL+    +++G   GL+IHFKIYPIIY LPI +Y+      ++ +  + 
Sbjct: 137 VICFLVLLSLYFLRFGNYVLAGAVLGLAIHFKIYPIIYTLPIAVYIYF--QKKDGLVSVV 194

Query: 196 MIGISTLIGITAPTYFMYKLYGSEFIEHSYMYHLTRTDHRHNFSIWNLVLLLESAGIHLS 255
            IG+S +  +T  +Y MY  YG+E++EH+Y+YH+ RTDHRHNFS+++++L  ESA   L 
Sbjct: 195 KIGLSVIAALTFSSYLMYHKYGTEYLEHAYLYHVLRTDHRHNFSVFHMLLYFESA---LP 251

Query: 256 QSIELSKLAFVPQLTLCAVLPYLLWKSQTFENLMNVLFVQTYAFVTFNKVCTSQYFIWYL 315
                +KLAF+PQ  +   +  L ++S +F NL++VLF+QTYAFVT+NKVCTSQYFIWYL
Sbjct: 252 AESYWAKLAFLPQAMITLGVVPLCFRSSSFNNLLSVLFIQTYAFVTYNKVCTSQYFIWYL 311

Query: 316 VLSPFYFANTTITWRKGVVCIFLWILSQAVWLSQAYLLEFKGQNVFFPNLFFGNIVFFLI 375
           +  PF+ A+TTIT R+G+    LWI +QA WL   YLLEFKGQNVF+P LF  ++ FFL 
Sbjct: 312 IFLPFFLAHTTITARRGIAMGALWIATQAFWLLFGYLLEFKGQNVFYPGLFLASLSFFLS 371

Query: 376 NVYLLGVFITDIKSRT 391
           NV+++G FI DI  R+
Sbjct: 372 NVWIIGQFINDINKRS 387

>Scas_647.6
          Length = 423

 Score =  384 bits (987), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 203/393 (51%), Positives = 268/393 (68%), Gaps = 21/393 (5%)

Query: 16  RIGFFSYGIFQDSHFDVKYTDIDYFVFHDAAGYVN------------NGQSPYLRDTXXX 63
           R+ F+ +GI+QD+HF V+YTDIDYFVFHDAAGYV             NG SPY RDT   
Sbjct: 18  RVVFYLFGIYQDAHFKVRYTDIDYFVFHDAAGYVYEKLINLNSNFPVNG-SPYQRDTYRY 76

Query: 64  XXXXXXXXXXXXXXKWIHMGKVFFVLFDLITGVMIIKLLQG---SCQLTKQLILASIWLL 120
                            H+GK  F++FDL TG++I+K+L+         K  +L+SIWLL
Sbjct: 77  TPLLSWLLVPDHYFDLFHLGKFLFMIFDLFTGIVIMKMLKNISPKISSLKLGLLSSIWLL 136

Query: 121 NPIVITISTRGNAESVLCFLIICALYFLKRDRLLISGLFYGLSIHFKIYPIIYALPIGIY 180
           NP+VITISTRGNAES+LCFL++ +LYFL++ R  ++G+ YGLSIHFKIYPIIY L I IY
Sbjct: 137 NPMVITISTRGNAESILCFLVMLSLYFLQKRRYWLAGIIYGLSIHFKIYPIIYCLAISIY 196

Query: 181 LLLSSHNRNCI----WRLFMIGISTLIGITAPTYFMYKLYGSEFIEHSYMYHLTRTDHRH 236
           L+ +SHN   +      L ++G +TL  I      MY +YG EF++ +Y YHL RTDHRH
Sbjct: 197 LVCASHNNATVSSKLKNLIIVGATTLFTIVGLGTLMYSIYGFEFLDQAYFYHLYRTDHRH 256

Query: 237 NFSIWNLVLLLESAGIHLSQSIELSKLAFVPQLTLCAVLPYLLWKSQTFENLMNVLFVQT 296
           NFS+WN++L  +SA    S S+ LSK +F PQ+ +  VL YL +   TF NL+NVLF+QT
Sbjct: 257 NFSLWNILLYFDSASDPNSVSL-LSKFSFAPQMLITIVLTYLEYLQPTFANLLNVLFLQT 315

Query: 297 YAFVTFNKVCTSQYFIWYLVLSPFYFANTTITWRKGVVCIFLWILSQAVWLSQAYLLEFK 356
           +AFVT+NKVCTSQYF+WYL+  PF   NTTI+ ++GV  + +W+ +QA+WLSQ Y LEF+
Sbjct: 316 FAFVTYNKVCTSQYFVWYLIFLPFSLINTTISMKRGVAMLLVWVGTQALWLSQGYYLEFE 375

Query: 357 GQNVFFPNLFFGNIVFFLINVYLLGVFITDIKS 389
           G+NVF+P +FFG + FF  NV+ LG FI DI S
Sbjct: 376 GRNVFYPGIFFGAVAFFAGNVWTLGQFIDDITS 408

>CAGL0B03905g 385192..386487 similar to sp|P47088 Saccharomyces
           cerevisiae YJR013w, hypothetical start
          Length = 431

 Score =  367 bits (943), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 199/385 (51%), Positives = 267/385 (69%), Gaps = 20/385 (5%)

Query: 16  RIGFFSYGIFQDSHFDVKYTDIDYFVFHDAAGYVNNGQSPYLRDTXXXXXXXXXXXXXXX 75
           RI FF +G++QD HF VKYTDIDY VF+DAA +V + +SPY RDT               
Sbjct: 17  RIAFFLFGVYQDEHFTVKYTDIDYQVFNDAAWFVAHRKSPYNRDTYRYTPLLSWLLLPNH 76

Query: 76  XXKWIHMGKVFFVLFDLITGVMIIKLLQ--------GSCQLTKQLILASIWLLNPIVITI 127
              W H GK+ FVL DL TGV+I+++L+        G+ ++T   I+A+IWLLNP+VITI
Sbjct: 77  MIPWFHFGKLIFVLCDLATGVLILQMLKKLKSKYRYGTDRMT---IMAAIWLLNPMVITI 133

Query: 128 STRGNAESVLCFLIICALYFLKRDRLLISGLFYGLSIHFKIYPIIYALPIGIYLLLSSHN 187
           STRGNAESVLCFLI+  LY    ++ L+ GL +GLSIHFKIYPIIYALPI IY+  + +N
Sbjct: 134 STRGNAESVLCFLILSFLYCFLCEQYLLGGLLFGLSIHFKIYPIIYALPIAIYVAAAHYN 193

Query: 188 R-----NCIWRLFMIGISTLIGITAPTYFMYKLYGSEFIEHSYMYHLTRTDHRHNFSIWN 242
           +        ++LF++G STLI +   T FMY LYG +FI+ +Y+YH+ RTDHRHNFS+WN
Sbjct: 194 KTQSVFKSSFKLFLVGFSTLIVLILLTVFMYMLYGDKFIDQTYLYHIYRTDHRHNFSVWN 253

Query: 243 LVLLLESAGIHLSQSIELSKLAFVPQLTLC-AVLPYLLWKSQTFENLMNVLFVQTYAFVT 301
           ++L   SA   L ++ ELSK  F+PQ+ +  A+    L +  +F  L NVLF++T+AFVT
Sbjct: 254 MLLYFNSA---LPKTSELSKFVFLPQMIIVLAISLTQLRRPSSFPLLCNVLFLETFAFVT 310

Query: 302 FNKVCTSQYFIWYLVLSPFYFANTTITWRKGVVCIFLWILSQAVWLSQAYLLEFKGQNVF 361
           FNKVCTSQYFIWYL+  PF   NT I+ R+G+V + +W+ +QA+WL Q YLLEF+GQNVF
Sbjct: 311 FNKVCTSQYFIWYLIFLPFVLYNTRISMRRGIVMLVVWVATQALWLRQGYLLEFEGQNVF 370

Query: 362 FPNLFFGNIVFFLINVYLLGVFITD 386
           +P LF  ++ FF+ N ++LG FI D
Sbjct: 371 YPGLFCASVGFFVSNAWILGQFIED 395

>CAGL0H00220g complement(13625..14851) similar to sp|P41733
           Saccharomyces cerevisiae YLR459w CDC91 cell division
           control protein, hypothetical start
          Length = 408

 Score = 34.7 bits (78), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 4/79 (5%)

Query: 98  IIKLLQGSCQLTKQLILASIWLLNPIVITISTRGNAESVLCFLIICALYFLKRDRLLISG 157
           I++LLQ        +++  I+ LNP+++  +  G+      F I  ALYF  + R   S 
Sbjct: 109 ILQLLQKK----DHILIGIIYALNPLLVLSNISGSTVIFTHFAISSALYFSSKGRYTTST 164

Query: 158 LFYGLSIHFKIYPIIYALP 176
            F  L+    IY I+  +P
Sbjct: 165 FFMALASSLSIYSILLVIP 183

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.333    0.146    0.468 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,865,678
Number of extensions: 476801
Number of successful extensions: 1310
Number of sequences better than 10.0: 15
Number of HSP's gapped: 1310
Number of HSP's successfully gapped: 15
Length of query: 396
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 292
Effective length of database: 12,995,837
Effective search space: 3794784404
Effective search space used: 3794784404
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (22.0 bits)
S2: 63 (28.9 bits)