Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0D09625g24524112780.0
Sklu_1267.227324010831e-151
Kwal_33.1545324524010741e-150
ACR035W24624110421e-145
Scas_647.724624010381e-144
CAGL0G09317g24624010231e-142
YGR195W (SKI6)24624010151e-141
Scas_716.302281371254e-08
Sklu_1989.12231341211e-07
KLLA0D14993g2251491211e-07
CAGL0G03113g2331381131e-06
YGR095C (RRP46)2231621112e-06
KLLA0F18304g2361401042e-05
Scas_621.172391291024e-05
Sklu_1879.1238144962e-04
AFR109W237139962e-04
Kwal_23.3969224139900.001
YIL067C678118740.21
ACR193C72981720.31
CAGL0E03223g248151700.46
AGL162C70474671.3
YGR158C (MTR3)250129624.5
ADL067C639100618.3
Sklu_2423.9107687609.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D09625g
         (241 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D09625g complement(813773..814510) highly similar to sp|P46...   496   0.0  
Sklu_1267.2 YGR195W, Contig c1267 529-1350                            421   e-151
Kwal_33.15453                                                         418   e-150
ACR035W [1083] [Homologous to ScYGR195W (SKI6) - SH] complement(...   405   e-145
Scas_647.7                                                            404   e-144
CAGL0G09317g complement(890158..890898) highly similar to sp|P46...   398   e-142
YGR195W (SKI6) [2145] chr7 (888885..889625) Component of the exo...   395   e-141
Scas_716.30                                                            53   4e-08
Sklu_1989.1 YGR095C, Contig c1989 348-1019                             51   1e-07
KLLA0D14993g complement(1266752..1267429) similar to sp|P53256 S...    51   1e-07
CAGL0G03113g complement(289747..290448) similar to sp|P53256 Sac...    48   1e-06
YGR095C (RRP46) [2055] chr7 complement(675673..676344) Protein c...    47   2e-06
KLLA0F18304g complement(1689187..1689897) similar to sp|P48240 S...    45   2e-05
Scas_621.17                                                            44   4e-05
Sklu_1879.1 YGR158C, Contig c1879 329-1045 reverse complement          42   2e-04
AFR109W [3301] [Homologous to ScYGR158C (MTR3) - SH] complement(...    42   2e-04
Kwal_23.3969                                                           39   0.001
YIL067C (YIL067C) [2604] chr9 complement(235721..237757) Protein...    33   0.21 
ACR193C [1240] [Homologous to ScYPR031W - SH] (687668..689857) [...    32   0.31 
CAGL0E03223g complement(297800..298546) similar to sp|P48240 Sac...    32   0.46 
AGL162C [4150] [Homologous to ScYDR164C (SEC1) - SH] (392348..39...    30   1.3  
YGR158C (MTR3) [2112] chr7 complement(805272..806024) Protein in...    28   4.5  
ADL067C [1674] [Homologous to ScYER064C - SH; ScYIL056W - SH] (5...    28   8.3  
Sklu_2423.9 YDL073W, Contig c2423 16021-19251                          28   9.6  

>KLLA0D09625g complement(813773..814510) highly similar to sp|P46948
           Saccharomyces cerevisiae YGR195w SKI6 3 -5
           exoribonuclease required for 3 end formation of 5.8S
           rRNA singleton, start by similarity
          Length = 245

 Score =  496 bits (1278), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 241/241 (100%), Positives = 241/241 (100%)

Query: 1   MSRFEIYSPEGLRVDGRRWNELRSFNCSINTHPNAADGSSYLEQGNNKIITLVAGPQEPS 60
           MSRFEIYSPEGLRVDGRRWNELRSFNCSINTHPNAADGSSYLEQGNNKIITLVAGPQEPS
Sbjct: 1   MSRFEIYSPEGLRVDGRRWNELRSFNCSINTHPNAADGSSYLEQGNNKIITLVAGPQEPS 60

Query: 61  SRSQVNTKQATLSVTINLTKFAKMERSKSSHKNERRTLEWQASLVRTFEKNLMLHLYPRT 120
           SRSQVNTKQATLSVTINLTKFAKMERSKSSHKNERRTLEWQASLVRTFEKNLMLHLYPRT
Sbjct: 61  SRSQVNTKQATLSVTINLTKFAKMERSKSSHKNERRTLEWQASLVRTFEKNLMLHLYPRT 120

Query: 121 SIDVQVHALQLDGGILGAMLNGITLALIDAGIAMYDFVSGVSVGLYDTTPLLDLNSLEEN 180
           SIDVQVHALQLDGGILGAMLNGITLALIDAGIAMYDFVSGVSVGLYDTTPLLDLNSLEEN
Sbjct: 121 SIDVQVHALQLDGGILGAMLNGITLALIDAGIAMYDFVSGVSVGLYDTTPLLDLNSLEEN 180

Query: 181 AMSSVTIGTIGKSEKLSLLMVEDKVPLDRLESVMAIGIAGTHRIRDLMDKELRKHGKTRV 240
           AMSSVTIGTIGKSEKLSLLMVEDKVPLDRLESVMAIGIAGTHRIRDLMDKELRKHGKTRV
Sbjct: 181 AMSSVTIGTIGKSEKLSLLMVEDKVPLDRLESVMAIGIAGTHRIRDLMDKELRKHGKTRV 240

Query: 241 E 241
           E
Sbjct: 241 E 241

>Sklu_1267.2 YGR195W, Contig c1267 529-1350
          Length = 273

 Score =  421 bits (1083), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 195/240 (81%), Positives = 220/240 (91%)

Query: 1   MSRFEIYSPEGLRVDGRRWNELRSFNCSINTHPNAADGSSYLEQGNNKIITLVAGPQEPS 60
           MSR EIYSPEGLR+DGRRWNELR F+CSINTHPNAADGSSYLEQGNNKIITLV GPQEP+
Sbjct: 28  MSRLEIYSPEGLRLDGRRWNELRRFDCSINTHPNAADGSSYLEQGNNKIITLVNGPQEPA 87

Query: 61  SRSQVNTKQATLSVTINLTKFAKMERSKSSHKNERRTLEWQASLVRTFEKNLMLHLYPRT 120
            RSQ N   AT++VT+N+TKF+KMERSKSSHKNERR LE Q SLVRTFEKN+ML LYPRT
Sbjct: 88  LRSQTNPSHATMNVTVNITKFSKMERSKSSHKNERRVLEMQTSLVRTFEKNVMLQLYPRT 147

Query: 121 SIDVQVHALQLDGGILGAMLNGITLALIDAGIAMYDFVSGVSVGLYDTTPLLDLNSLEEN 180
            ID+Q+H LQ DGGI+GA++NGITLALIDAGIAMYD++SGVS+GLYDTTPLLDLNSLEEN
Sbjct: 148 LIDIQIHVLQQDGGIMGALINGITLALIDAGIAMYDYISGVSIGLYDTTPLLDLNSLEEN 207

Query: 181 AMSSVTIGTIGKSEKLSLLMVEDKVPLDRLESVMAIGIAGTHRIRDLMDKELRKHGKTRV 240
           AMSS+T+G +GKSEKLSLL+VEDKVPLDR ESV+AIGIAG H IRDLMDKELR+HG+ R+
Sbjct: 208 AMSSITLGVVGKSEKLSLLLVEDKVPLDRFESVLAIGIAGAHIIRDLMDKELRRHGEKRL 267

>Kwal_33.15453
          Length = 245

 Score =  418 bits (1074), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 190/240 (79%), Positives = 221/240 (92%)

Query: 1   MSRFEIYSPEGLRVDGRRWNELRSFNCSINTHPNAADGSSYLEQGNNKIITLVAGPQEPS 60
           MSR EIYSPEGLRVDGRRWNELR   C+INTH NA+DGSSYLEQGNNKIITLV GPQEP 
Sbjct: 1   MSRLEIYSPEGLRVDGRRWNELRRLECAINTHANASDGSSYLEQGNNKIITLVNGPQEPK 60

Query: 61  SRSQVNTKQATLSVTINLTKFAKMERSKSSHKNERRTLEWQASLVRTFEKNLMLHLYPRT 120
            RSQ+N  QATLSV +N+T+F+K+ERSKSSHKNERR LE Q +LVRTFEKN+MLHLYPRT
Sbjct: 61  LRSQMNVNQATLSVAVNITRFSKIERSKSSHKNERRVLEMQTALVRTFEKNVMLHLYPRT 120

Query: 121 SIDVQVHALQLDGGILGAMLNGITLALIDAGIAMYDFVSGVSVGLYDTTPLLDLNSLEEN 180
            ID+Q+H LQ DGG++G+++NGITLALIDAGIAMYD++SGVS+GLYDTTPLLDLNS+EEN
Sbjct: 121 QIDIQIHVLQQDGGLMGSLINGITLALIDAGIAMYDYISGVSIGLYDTTPLLDLNSVEEN 180

Query: 181 AMSSVTIGTIGKSEKLSLLMVEDKVPLDRLESVMAIGIAGTHRIRDLMDKELRKHGKTRV 240
           AMSSVT+G +GKSEKLSLL+VEDK+PLDRLESV+AIGIAG+HRIR+LMD+ELRKHG+ R+
Sbjct: 181 AMSSVTLGVVGKSEKLSLLLVEDKIPLDRLESVLAIGIAGSHRIRELMDQELRKHGEKRL 240

>ACR035W [1083] [Homologous to ScYGR195W (SKI6) - SH]
           complement(422233..422973) [741 bp, 246 aa]
          Length = 246

 Score =  405 bits (1042), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 187/241 (77%), Positives = 215/241 (89%)

Query: 1   MSRFEIYSPEGLRVDGRRWNELRSFNCSINTHPNAADGSSYLEQGNNKIITLVAGPQEPS 60
           M + EIYSPEGLR+DGRRWNELR F CSINTHP AADGSSYLEQGNNK+ITLV GP EP+
Sbjct: 1   MFKTEIYSPEGLRLDGRRWNELRRFECSINTHPTAADGSSYLEQGNNKLITLVTGPHEPA 60

Query: 61  SRSQVNTKQATLSVTINLTKFAKMERSKSSHKNERRTLEWQASLVRTFEKNLMLHLYPRT 120
            RSQVN  +ATL+VT+N+TKFA  ERSK+ HKNERR LE Q +LVRTFEKN+ML LYPRT
Sbjct: 61  LRSQVNPSKATLTVTVNMTKFAAAERSKTGHKNERRILEMQTALVRTFEKNVMLQLYPRT 120

Query: 121 SIDVQVHALQLDGGILGAMLNGITLALIDAGIAMYDFVSGVSVGLYDTTPLLDLNSLEEN 180
           +IDVQVH LQ DGG+LG+M+NGITLALIDAGIAMY+++SG+SVGLYDTTPLLDLN LEE 
Sbjct: 121 AIDVQVHVLQNDGGVLGSMINGITLALIDAGIAMYEYISGISVGLYDTTPLLDLNRLEEQ 180

Query: 181 AMSSVTIGTIGKSEKLSLLMVEDKVPLDRLESVMAIGIAGTHRIRDLMDKELRKHGKTRV 240
           AMS  T+G +GKSEKLSLL+VEDKVPLDRLESVM++GIAGTHR+RD+MDK LR+HGK R+
Sbjct: 181 AMSCFTLGVVGKSEKLSLLLVEDKVPLDRLESVMSLGIAGTHRVRDMMDKVLRQHGKIRL 240

Query: 241 E 241
           E
Sbjct: 241 E 241

>Scas_647.7
          Length = 246

 Score =  404 bits (1038), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 181/240 (75%), Positives = 221/240 (92%)

Query: 1   MSRFEIYSPEGLRVDGRRWNELRSFNCSINTHPNAADGSSYLEQGNNKIITLVAGPQEPS 60
           MSR EIYSPEGLR+DGRRWNELR F CSINTH +A+DGSSYLEQGNNK+ITLV GP+EP+
Sbjct: 1   MSRLEIYSPEGLRLDGRRWNELRRFECSINTHSHASDGSSYLEQGNNKVITLVKGPKEPT 60

Query: 61  SRSQVNTKQATLSVTINLTKFAKMERSKSSHKNERRTLEWQASLVRTFEKNLMLHLYPRT 120
            RSQ++T++A L +++N+T+F+K ERSKSSHKNERR LE Q +L+RTFEKN+ML++YPRT
Sbjct: 61  LRSQMDTEKAILKISVNITQFSKFERSKSSHKNERRVLEMQTALIRTFEKNVMLNIYPRT 120

Query: 121 SIDVQVHALQLDGGILGAMLNGITLALIDAGIAMYDFVSGVSVGLYDTTPLLDLNSLEEN 180
            ID++VH LQ DGGI+G+++NGITLALIDAGIAMYD++SGVS+GLYDTTPLLD+NSLEEN
Sbjct: 121 LIDIEVHVLQQDGGIMGSLINGITLALIDAGIAMYDYISGVSIGLYDTTPLLDVNSLEEN 180

Query: 181 AMSSVTIGTIGKSEKLSLLMVEDKVPLDRLESVMAIGIAGTHRIRDLMDKELRKHGKTRV 240
           AMSSVT+G +GKSEKLSLL+VEDK+PLDRLE+V+AIGIAG HR+RDLMD+ELRKH + RV
Sbjct: 181 AMSSVTLGVVGKSEKLSLLLVEDKIPLDRLETVLAIGIAGAHRVRDLMDEELRKHAEKRV 240

>CAGL0G09317g complement(890158..890898) highly similar to sp|P46948
           Saccharomyces cerevisiae YGR195w SKI6 3-5
           exoribonuclease required for 3 end formation of 5.8S
           rRNA, start by similarity
          Length = 246

 Score =  398 bits (1023), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 179/240 (74%), Positives = 217/240 (90%)

Query: 1   MSRFEIYSPEGLRVDGRRWNELRSFNCSINTHPNAADGSSYLEQGNNKIITLVAGPQEPS 60
           MSR EIYSPEGLR+DGRRWNELR F  +INTHP+AADGSSYLEQGNNK+ITLV GP+EP+
Sbjct: 1   MSRVEIYSPEGLRLDGRRWNELRRFESAINTHPHAADGSSYLEQGNNKVITLVKGPKEPT 60

Query: 61  SRSQVNTKQATLSVTINLTKFAKMERSKSSHKNERRTLEWQASLVRTFEKNLMLHLYPRT 120
            +SQ++ ++A L VT+N+TKF+K ERSKSSHKNERR LE Q +LVRTFEKN+MLH+YPRT
Sbjct: 61  LKSQMDIQKAILKVTVNITKFSKFERSKSSHKNERRVLEMQTALVRTFEKNVMLHVYPRT 120

Query: 121 SIDVQVHALQLDGGILGAMLNGITLALIDAGIAMYDFVSGVSVGLYDTTPLLDLNSLEEN 180
            ID+++H LQ DGGI+G +LNGI+LALIDAGIAMYD+VSG+SVGLYDTTPLLD+NSLEEN
Sbjct: 121 LIDIEIHVLQQDGGIMGTLLNGISLALIDAGIAMYDYVSGISVGLYDTTPLLDINSLEEN 180

Query: 181 AMSSVTIGTIGKSEKLSLLMVEDKVPLDRLESVMAIGIAGTHRIRDLMDKELRKHGKTRV 240
           AMS+VT+G +GKSEKLSLL +EDK+PLDR+E+V+AIGIAG HRIRDLM++E+R H + RV
Sbjct: 181 AMSAVTLGVVGKSEKLSLLQIEDKIPLDRIENVLAIGIAGAHRIRDLMEQEIRAHAEKRV 240

>YGR195W (SKI6) [2145] chr7 (888885..889625) Component of the
           exosome 3'-5' exoribonuclease complex involved in 3'
           processing of ribosomal 5.8S rRNA, of snoRNAs and of U4
           snRNA, and in degradation of poly(A)- mRNAs, confers
           antiviral activity by repressing replication of
           double-stranded RNA viruses [741 bp, 246 aa]
          Length = 246

 Score =  395 bits (1015), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 179/240 (74%), Positives = 218/240 (90%)

Query: 1   MSRFEIYSPEGLRVDGRRWNELRSFNCSINTHPNAADGSSYLEQGNNKIITLVAGPQEPS 60
           MSR EIYSPEGLR+DGRRWNELR F  SINTHP+AADGSSY+EQGNNKIITLV GP+EP 
Sbjct: 1   MSRLEIYSPEGLRLDGRRWNELRRFESSINTHPHAADGSSYMEQGNNKIITLVKGPKEPR 60

Query: 61  SRSQVNTKQATLSVTINLTKFAKMERSKSSHKNERRTLEWQASLVRTFEKNLMLHLYPRT 120
            +SQ++T +A L+V++N+TKF+K ERSKSSHKNERR LE Q SLVR FEKN+ML++YPRT
Sbjct: 61  LKSQMDTSKALLNVSVNITKFSKFERSKSSHKNERRVLEIQTSLVRMFEKNVMLNIYPRT 120

Query: 121 SIDVQVHALQLDGGILGAMLNGITLALIDAGIAMYDFVSGVSVGLYDTTPLLDLNSLEEN 180
            ID+++H L+ DGGI+G+++NGITLALIDAGI+M+D++SG+SVGLYDTTPLLD NSLEEN
Sbjct: 121 VIDIEIHVLEQDGGIMGSLINGITLALIDAGISMFDYISGISVGLYDTTPLLDTNSLEEN 180

Query: 181 AMSSVTIGTIGKSEKLSLLMVEDKVPLDRLESVMAIGIAGTHRIRDLMDKELRKHGKTRV 240
           AMS+VT+G +GKSEKLSLL+VEDK+PLDRLE+V+AIGIAG HR+RDLMD+ELRKH + RV
Sbjct: 181 AMSTVTLGVVGKSEKLSLLLVEDKIPLDRLENVLAIGIAGAHRVRDLMDEELRKHAQKRV 240

>Scas_716.30
          Length = 228

 Score = 52.8 bits (125), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 59/137 (43%), Gaps = 18/137 (13%)

Query: 36  ADGSSYLEQGNNKIITLVAGPQEPSSRSQVNTKQATLSVTINLTKFAKMERSKSSHKNER 95
            DGSS +E    KII  V GP EP SR ++ T Q  L + I         R  +   N R
Sbjct: 13  VDGSSLIESKQTKIICSVTGPIEPKSRQELPT-QLALEIII---------RPAAGVPNTR 62

Query: 96  RTLEWQASLVRTFEKNLMLHLYPR--TSIDVQV-----HALQLDGGILGAMLNGITLALI 148
             L  +  L       +  +LYPR    I +Q+       L+     L   +N   +ALI
Sbjct: 63  EKL-MEDKLRAVITPIITRYLYPRQLCQITLQILNSGESELEFAQRELATCINATLIALI 121

Query: 149 DAGIAMYDFVSGVSVGL 165
           DAGIA+    + V + L
Sbjct: 122 DAGIALNSMCACVPIAL 138

>Sklu_1989.1 YGR095C, Contig c1989 348-1019
          Length = 223

 Score = 51.2 bits (121), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/134 (32%), Positives = 58/134 (43%), Gaps = 19/134 (14%)

Query: 34  NAADGSSYLEQGNNKIITLVAGPQEPSSRSQVNTKQATLSVTINLTKFAKMERSKSSHKN 93
           +  DGSS +E    K+I  V GP EP +R ++ T Q  L + +  +K     R K     
Sbjct: 10  DQVDGSSQVECSATKVICSVTGPVEPKARQELPT-QLALEIVVRPSKGVPNTREKLMEDK 68

Query: 94  ERRTLEWQASLVRTFEKNLMLHLYPRTSIDVQVHAL-------QLDGGILGAMLNGITLA 146
            R  L     LVR        +LYPR    +    L       Q     LG  +N   LA
Sbjct: 69  IRGVLT--PVLVR--------YLYPRQLCQLTFQVLESGESEEQYTVKELGCCINAAYLA 118

Query: 147 LIDAGIAMY-DFVS 159
           L+DAGIA+   FVS
Sbjct: 119 LVDAGIALKSSFVS 132

>KLLA0D14993g complement(1266752..1267429) similar to sp|P53256
           Saccharomyces cerevisiae YGR095c RRP46 involved in rRNA
           processing singleton, hypothetical start
          Length = 225

 Score = 51.2 bits (121), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 63/149 (42%), Gaps = 17/149 (11%)

Query: 36  ADGSSYLEQGNNKIITLVAGPQEPSSRSQVNTKQATLSVTINLTKFAKMERSKSSHKNER 95
            DGSS +     K+I  V+GP EP SR ++ T Q  L + +   +  +  R K      R
Sbjct: 11  VDGSSVVSNSGTKVICSVSGPMEPKSRQELPT-QLALEIIVKPAEGVQSTREKLMEDQIR 69

Query: 96  RTLEWQASLVRTFEKNLMLHLYPRTSIDVQVHALQL----DGGI--LGAMLNGITLALID 149
             L             L  +L+PR  + + +  L+     D  +  +   +N   LAL+D
Sbjct: 70  SVL----------TPVLARYLHPRQFVQICLQVLEAGESRDYTVKEVSVCVNAAVLALVD 119

Query: 150 AGIAMYDFVSGVSVGLYDTTPLLDLNSLE 178
           AG+ +    SG  +G+      L +N  E
Sbjct: 120 AGVPLLSMCSGTCIGITTEGKQLVVNPTE 148

>CAGL0G03113g complement(289747..290448) similar to sp|P53256
           Saccharomyces cerevisiae YGR095c RRP46 involved in rRNA
           processing, hypothetical start
          Length = 233

 Score = 48.1 bits (113), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 58/138 (42%), Gaps = 18/138 (13%)

Query: 37  DGSSYLEQGNNKIITLVAGPQEPSSRSQVNTKQATLSVTINLTKFAKMERSKSSHKNERR 96
           DGS+ L   +  ++  V GP EP +R ++ T+ A L V +   K     R K      R 
Sbjct: 16  DGSAKLLMNSTNVLCAVTGPVEPKARQELPTEMA-LEVIVRPAKGVPTPREKYLEDKIRA 74

Query: 97  TLEWQASLVRTFEKNLMLHLYPRTSIDVQVHALQL-------DGGILGAMLNGITLALID 149
                      F   +  H YPR    +    ++        +   L A +N   LAL++
Sbjct: 75  I----------FTPLITRHKYPRQLCQITCQIMEAGENEQLHNQKELSACVNSALLALVN 124

Query: 150 AGIAMYDFVSGVSVGLYD 167
           AG+A+ D  + V++ + D
Sbjct: 125 AGVALNDLAAAVTIAVID 142

>YGR095C (RRP46) [2055] chr7 complement(675673..676344) Protein
           component of the exosome 3'-5' exoribonuclease complex
           involved in 3'end processing of multiple small RNA
           species [672 bp, 223 aa]
          Length = 223

 Score = 47.4 bits (111), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 63/162 (38%), Gaps = 18/162 (11%)

Query: 37  DGSSYLEQGNNKIITLVAGPQEPSSRSQVNTKQATLSVTINLTKFAKMERSKSSHKNERR 96
           DGSS     + K+I  V GP EP +R ++ T Q  L + +   K     R K      R 
Sbjct: 14  DGSSEFVSQDTKVICSVTGPIEPKARQELPT-QLALEIIVRPAKGVATTREKVLEDKLRA 72

Query: 97  TLEWQASLVRTFEKNLMLHLYPRTSIDVQVHAL-------QLDGGILGAMLNGITLALID 149
            L             +  H YPR    +    L       +     L   +N   LAL+D
Sbjct: 73  VL----------TPLITRHCYPRQLCQITCQILESGEDEAEFSLRELSCCINAAFLALVD 122

Query: 150 AGIAMYDFVSGVSVGLYDTTPLLDLNSLEENAMSSVTIGTIG 191
           AGIA+    + + + +   T  + ++   E    S+++ T+ 
Sbjct: 123 AGIALNSMCASIPIAIIKDTSDIIVDPTAEQLKISLSVHTLA 164

>KLLA0F18304g complement(1689187..1689897) similar to sp|P48240
           Saccharomyces cerevisiae YGR158c MTR3 involved in mRNA
           transport singleton, start by similarity
          Length = 236

 Score = 44.7 bits (104), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 61/140 (43%), Gaps = 26/140 (18%)

Query: 36  ADGSSYLEQGNNK-----IITLVAGPQEPSSRSQVNTKQATLSVTINLTKFAKMERSKSS 90
           A+GSSYLE  +       +++ V GP     R    + Q+  SV+I   K   +E     
Sbjct: 55  ANGSSYLEYMDGTSDQVLVMSSVFGP-----RPLRGSFQSKASVSIQF-KEVTLE----- 103

Query: 91  HKNERRTLEWQASLVRTFEKNLMLHLYPRTSIDVQVHALQLDG----------GILGAML 140
           H N     E    L   F   + +  YP++ ID+ +  +Q              IL   +
Sbjct: 104 HLNTGEIKEICTFLTNVFNAVINVEKYPKSGIDIFIDLIQHSNSNPTEEANIVNILPTCI 163

Query: 141 NGITLALIDAGIAMYDFVSG 160
           N IT+AL+DAGI + D VS 
Sbjct: 164 NSITMALVDAGIEIIDLVSA 183

>Scas_621.17
          Length = 239

 Score = 43.9 bits (102), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 65/129 (50%), Gaps = 15/129 (11%)

Query: 36  ADGSSYLEQGNNKIITLVAGPQEPSSRSQVNTKQATLSVTINLTKFAKMERSKSSHKNER 95
            +GS+ +E     ++T V GP+  S R    T Q T+++ +   K   +E  +++   E 
Sbjct: 56  CNGSTLIESSKFSLLTSVYGPK--SIRGSF-TSQGTITIQL---KNGVVENYQTTELKEV 109

Query: 96  RTLEWQASLVRTFEKNLMLHLYPRTSIDVQVHALQLDGG----ILGAMLNGITLALIDAG 151
            +  W   LV  F   + L  YP++ ID+ V+ +    G    ++  ++ GI LAL+D G
Sbjct: 110 SS--W---LVGIFNSVVNLENYPKSGIDIFVNLIIDKQGDISKLIPFLIMGICLALVDGG 164

Query: 152 IAMYDFVSG 160
           I + D V+G
Sbjct: 165 IEIIDIVTG 173

>Sklu_1879.1 YGR158C, Contig c1879 329-1045 reverse complement
          Length = 238

 Score = 41.6 bits (96), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 66/144 (45%), Gaps = 33/144 (22%)

Query: 36  ADGSSYLE-------QGNNKIITLVAGPQEPSSRSQVNTKQATLSVT---INLTKFAKME 85
           ++GSSYLE       Q +  +IT V GP+ P   S   T +A+L++    + L KF   E
Sbjct: 51  SNGSSYLEVTDENKTQYHALLITSVYGPR-PIRGSF--TSRASLTIQFKEVTLEKFTTGE 107

Query: 86  RSKSSHKNERRTLEWQASLVRTFEKNLMLHLYPRTSIDVQVHALQLD---------GGIL 136
             +  +            L   F   + L  YP++ ID+ ++ +Q             ++
Sbjct: 108 IKEVCN-----------FLTNIFNAVVNLERYPKSGIDIFLNLIQHSSTDNQETDIASVI 156

Query: 137 GAMLNGITLALIDAGIAMYDFVSG 160
              +NGITLAL +AGI + D VS 
Sbjct: 157 PTCINGITLALTNAGIEILDMVSA 180

>AFR109W [3301] [Homologous to ScYGR158C (MTR3) - SH]
           complement(632965..633678) [714 bp, 237 aa]
          Length = 237

 Score = 41.6 bits (96), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 63/139 (45%), Gaps = 25/139 (17%)

Query: 36  ADGSSYLE----QGNNKIITLVAGPQEPSSRSQVNTKQATLSVTINLTKFAKMERSKSSH 91
           A+GSSYLE      N  ++T   GP+ P   S   T +A +SV     K   +ER  S  
Sbjct: 54  ANGSSYLEVKAETHNTLLVTTAYGPR-PIRGSF--TSRAAISVHF---KEVTLERWDSGE 107

Query: 92  KNERRTLEWQASLVRTFEKNLMLHLYPRTSIDVQVHALQLD----------GGILGAMLN 141
             E         L   F   + +  YP++ ID+ ++ +Q              +L   ++
Sbjct: 108 VTEMCNF-----LNTVFSAAINVERYPKSGIDIFLNLIQHSNVRDDKTLNLAEVLPDCIS 162

Query: 142 GITLALIDAGIAMYDFVSG 160
           GITLAL+DAGI + D V+ 
Sbjct: 163 GITLALMDAGIELKDVVAA 181

>Kwal_23.3969
          Length = 224

 Score = 39.3 bits (90), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 57/139 (41%), Gaps = 18/139 (12%)

Query: 34  NAADGSSYLEQGNNKIITLVAGPQEPSSRSQVNTKQATLSVTINLTKFAKMERSKSSHKN 93
           +  DGS  ++ G   ++  V GP EP +R ++ + Q  L + +   K     R K     
Sbjct: 10  DQVDGSCKIQCGETSVLCSVTGPIEPKARQELPS-QLALEIVVRPCKGVPNTREK----- 63

Query: 94  ERRTLEWQASLVRTFEKNLMLHLYPRTSIDVQVHALQ-------LDGGILGAMLNGITLA 146
               LE Q   V T    L  +LYPR    +    L+            L + +N   LA
Sbjct: 64  ---LLEDQIRGVLT--PILARYLYPRQLCQICFQILESGEPDESYSVKELNSCINAAYLA 118

Query: 147 LIDAGIAMYDFVSGVSVGL 165
           LID+GI +    + V + +
Sbjct: 119 LIDSGIGLQSSFASVCLSV 137

>YIL067C (YIL067C) [2604] chr9 complement(235721..237757) Protein of
           unknown function, has moderate similarity to
           uncharacterized C. albicans Orf6.4852p [2037 bp, 678 aa]
          Length = 678

 Score = 33.1 bits (74), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 53/118 (44%), Gaps = 18/118 (15%)

Query: 111 NLMLHLYPRTSIDVQVHALQLDGGILGAMLNGITLALIDAGIAMYDFVSGV--------- 161
           NL +H Y   SI V   A +   G    +  GI + LI +G+A +DF S V         
Sbjct: 496 NLRIHHYILGSILVPGCATR---GSSAYLFQGILVGLILSGVARWDFASIVETDTALLRG 552

Query: 162 SVGLYDTTPLLDLNSLEENAMS------SVTIGTIGKSEKLSLLMVEDKVPLDRLESV 213
             G     P+LD N  + +++S         I  IG  +  SLL+ + +V + + E+V
Sbjct: 553 EAGASLKPPILDFNDDQNHSLSWHLNATDPVIDQIGNIDGFSLLLNDVEVYVGKNETV 610

>ACR193C [1240] [Homologous to ScYPR031W - SH] (687668..689857)
           [2190 bp, 729 aa]
          Length = 729

 Score = 32.3 bits (72), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 41/81 (50%), Gaps = 4/81 (4%)

Query: 163 VGLYDTTPLLDLNS---LEENAMSSVTIGTIGKSEKLSLLMVE-DKVPLDRLESVMAIGI 218
           V ++D T    ++S   L+  A + V +  + K ++LS L+V   +    RL++V  I  
Sbjct: 522 VRIFDPTSFNSMDSADILKRVAFADVLLNDLAKLDELSTLLVRRQQAAQARLDAVDIIND 581

Query: 219 AGTHRIRDLMDKELRKHGKTR 239
            G H +R L+ K +  H  T+
Sbjct: 582 LGFHPVRHLVQKNVTTHWSTK 602

>CAGL0E03223g complement(297800..298546) similar to sp|P48240
           Saccharomyces cerevisiae YGR158c MTR3 involved in mRNA
           transport, start by similarity
          Length = 248

 Score = 31.6 bits (70), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 62/151 (41%), Gaps = 37/151 (24%)

Query: 36  ADGSSYLEQGNNKI-------ITLVAGPQEPSSRSQVNTKQATLSVTINLTKFAKMERSK 88
            +GS+ +E  + KI       IT V GP+  S R    T QA+LS+ +   K   +E+ +
Sbjct: 51  CNGSALVEIKDTKITHHQTSLITSVYGPK--SVRGSF-TSQASLSIQL---KNGLLEKYE 104

Query: 89  SSHKNERRTLEWQASLVRTFEKNLMLHLYPRTSIDVQVHALQLDG--------------- 133
           S     R   E    L   F   + L  YP++ ID+ ++                     
Sbjct: 105 S-----RELKEVANFLTSIFNSVINLKRYPKSGIDIFIYITYEKSLENFKEQEPAAPVRK 159

Query: 134 ----GILGAMLNGITLALIDAGIAMYDFVSG 160
                IL   ++ IT+ALIDA I + D  + 
Sbjct: 160 SNIYKILPHCISSITMALIDADIEIIDLAAA 190

>AGL162C [4150] [Homologous to ScYDR164C (SEC1) - SH]
           (392348..394431,394501..394531) [2115 bp, 704 aa]
          Length = 704

 Score = 30.4 bits (67), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 34/74 (45%), Gaps = 11/74 (14%)

Query: 19  WNELRSFNCSINTHPNAADGSSYLEQGNNKIITLVAGPQEPSSRSQVNTKQATLSVTINL 78
           W EL+        H + AD S YL   N+KI  ++A       RS+V T    LSV  +L
Sbjct: 302 WLELK--------HQHIADASEYL---NSKINEMIAKNPLLVDRSKVKTTTDLLSVVAHL 350

Query: 79  TKFAKMERSKSSHK 92
             F +  R  + HK
Sbjct: 351 KDFDEERRRITVHK 364

>YGR158C (MTR3) [2112] chr7 complement(805272..806024) Protein
           involved in mRNA transport, component of the exosome
           complex responsible for 3'-5' degradation of mRNA and
           for 3'-end processing of multiple small RNA species [753
           bp, 250 aa]
          Length = 250

 Score = 28.5 bits (62), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 56/129 (43%), Gaps = 33/129 (25%)

Query: 49  IITLVAGPQEPSSRSQVNTKQATLSVTINLTKFAKMERSKSSHKNERRTLEWQASLVRTF 108
           +IT V GP+  S R    T Q T+S+ +   K   +E+  +   NE +  E  + L+  F
Sbjct: 73  LITAVYGPR--SIRGSF-TSQGTISIQL---KNGLLEKYNT---NELK--EVSSFLMGIF 121

Query: 109 EKNLMLHLYPRTSIDVQVHALQLD---------------------GGILGAMLNGITLAL 147
              + L  YP++ ID+ V+ L  D                       ++   +  ITLAL
Sbjct: 122 NSVVNLSRYPKSGIDIFVY-LTYDKDLTNNPQDDDSQSKMMSSQISSLIPHCITSITLAL 180

Query: 148 IDAGIAMYD 156
            DAGI + D
Sbjct: 181 ADAGIELVD 189

>ADL067C [1674] [Homologous to ScYER064C - SH; ScYIL056W - SH]
           (560735..562654) [1920 bp, 639 aa]
          Length = 639

 Score = 28.1 bits (61), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 46/100 (46%), Gaps = 3/100 (3%)

Query: 112 LMLHLY-PRTSIDVQVHALQLDGGILGAMLNGITLALIDAGIAMYDFVSGVSVGLYDTTP 170
           ++LH+   +T +++    L+L+  +   ML G T         M  F S + V   +   
Sbjct: 280 ILLHIQRSKTCMEIATEELRLENCVNLCML-GDTCIKAAVSFVMERFFSSLPVTSTEYI- 337

Query: 171 LLDLNSLEENAMSSVTIGTIGKSEKLSLLMVEDKVPLDRL 210
              + SLE++A+  +     G    + +L VE+KV L +L
Sbjct: 338 TQKVTSLEQSALICMKFFAPGTKSNMQILSVENKVTLFQL 377

>Sklu_2423.9 YDL073W, Contig c2423 16021-19251
          Length = 1076

 Score = 27.7 bits (60), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 16/87 (18%), Positives = 41/87 (47%), Gaps = 1/87 (1%)

Query: 47  NKIITLVAGPQEPSSRSQVNTKQATLSVTINLTKFAKMERSKSSHKNERRTLEWQASLVR 106
           NK IT+++    P S    + K  +  + +NL  + +     ++ KN     +W  +L+ 
Sbjct: 15  NKFITIISNGNGPQSNPHASAKTVSNFLRLNLLSYLRQHNYTANQKNRDVLTQWWITLLN 74

Query: 107 TFEKNLMLH-LYPRTSIDVQVHALQLD 132
               +L +    P++++++   ++ L+
Sbjct: 75  YLNSDLQVSGDQPQSTLNIDTISVSLE 101

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.132    0.366 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,139,177
Number of extensions: 273859
Number of successful extensions: 861
Number of sequences better than 10.0: 29
Number of HSP's gapped: 850
Number of HSP's successfully gapped: 29
Length of query: 241
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 142
Effective length of database: 13,168,927
Effective search space: 1869987634
Effective search space used: 1869987634
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 60 (27.7 bits)