Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0D09603g82080839860.0
YGR196C (FYV8)8172925723e-62
CAGL0G09295g7673735651e-61
Scas_617.47913765591e-60
ACR036C7542824601e-47
Kwal_33.154559142151383e-08
Scas_713.4132698741.2
YKL116C (PRR1)51849694.1
Kwal_27.1186445370669.5
ADR281W19352649.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D09603g
         (808 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D09603g 811234..813696 weakly similar to sp|P46949 Saccharo...  1540   0.0  
YGR196C (FYV8) [2146] chr7 complement(889736..892189) Protein of...   224   3e-62
CAGL0G09295g 887666..889969 similar to sp|P46949 Saccharomyces c...   222   1e-61
Scas_617.4                                                            219   1e-60
ACR036C [1084] [Homologous to ScYGR196C (FYV8) - SH] (423030..42...   181   1e-47
Kwal_33.15455                                                          58   3e-08
Scas_713.4                                                             33   1.2  
YKL116C (PRR1) [3148] chr11 complement(220990..222546) Serine/th...    31   4.1  
Kwal_27.11864                                                          30   9.5  
ADR281W [2022] [Homologous to ScYDL098C (SNU23) - SH] complement...    29   9.8  

>KLLA0D09603g 811234..813696 weakly similar to sp|P46949
           Saccharomyces cerevisiae YGR196c singleton, start by
           similarity
          Length = 820

 Score = 1540 bits (3986), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 766/808 (94%), Positives = 766/808 (94%)

Query: 1   MDDIARQHYQDNAKMSDNITRHKSQRWVSASKANYDGADWDAYSSNSEDEGLTNNIPQLP 60
           MDDIARQHYQDNAKMSDNITRHKSQRWVSASKANYDGADWDAYSSNSEDEGLTNNIPQLP
Sbjct: 1   MDDIARQHYQDNAKMSDNITRHKSQRWVSASKANYDGADWDAYSSNSEDEGLTNNIPQLP 60

Query: 61  QVNIPESNNIAKSSSPDPSIGTCLRSDSLNTSVRSGNKSVNDDLDSLMHQISQEMTAKDE 120
           QVNIPESNNIAKSSSPDPSIGTCLRSDSLNTSVRSGNKSVNDDLDSLMHQISQEMTAKDE
Sbjct: 61  QVNIPESNNIAKSSSPDPSIGTCLRSDSLNTSVRSGNKSVNDDLDSLMHQISQEMTAKDE 120

Query: 121 DVNNTSDPEDEDDAELKVSKTGYFAAYVNDEDTDDRESVKSDIESAKLAESATEINKTDN 180
           DVNNTSDPEDEDDAELKVSKTGYFAAYVNDEDTDDRESVKSDIESAKLAESATEINKTDN
Sbjct: 121 DVNNTSDPEDEDDAELKVSKTGYFAAYVNDEDTDDRESVKSDIESAKLAESATEINKTDN 180

Query: 181 AKXXXXXXXXXXXXXXKRAKVEVEPVQIVNVGEESFKGDDSEAESVKRADVEVEPFKIVS 240
           AK              KRAKVEVEPVQIVNVGEESFKGDDSEAESVKRADVEVEPFKIVS
Sbjct: 181 AKAESVSEVESVAESVKRAKVEVEPVQIVNVGEESFKGDDSEAESVKRADVEVEPFKIVS 240

Query: 241 AEEEPLKGDDTEVELFKNAASEVETSQISVELQDEMIDPTTEIPSRIQGDVAISDDKGSK 300
           AEEEPLKGDDTEVELFKNAASEVETSQISVELQDEMIDPTTEIPSRIQGDVAISDDKGSK
Sbjct: 241 AEEEPLKGDDTEVELFKNAASEVETSQISVELQDEMIDPTTEIPSRIQGDVAISDDKGSK 300

Query: 301 DAVDEDNWSKSDSHPESIGSQDKEEMPPSSINSLPSESQLSIQHSKEGDSNDSDSLLNGY 360
           DAVDEDNWSKSDSHPESIGSQDKEEMPPSSINSLPSESQLSIQHSKEGDSNDSDSLLNGY
Sbjct: 301 DAVDEDNWSKSDSHPESIGSQDKEEMPPSSINSLPSESQLSIQHSKEGDSNDSDSLLNGY 360

Query: 361 GSEPSLMKDNASPVKLRKTSKTDLSYHDGYXXXXXXXXXXRAISEVSLGQYVVHSAESFK 420
           GSEPSLMKDNASPVKLRKTSKTDLSYHDGY          RAISEVSLGQYVVHSAESFK
Sbjct: 361 GSEPSLMKDNASPVKLRKTSKTDLSYHDGYSSESSGEEKERAISEVSLGQYVVHSAESFK 420

Query: 421 FRNPVRNXXXXXXXXXXXXXXXXXXLEVTKSGYFAAMVDEDKEIDDSDRHTLNNNDTDGL 480
           FRNPVRN                  LEVTKSGYFAAMVDEDKEIDDSDRHTLNNNDTDGL
Sbjct: 421 FRNPVRNSVLDSSDDDIDYTDEDGDLEVTKSGYFAAMVDEDKEIDDSDRHTLNNNDTDGL 480

Query: 481 TADSDVNSITESVTKRLSQSSITQSDVPDQNSENDVGGYSDSSEDEEDGPQKLAFSTRES 540
           TADSDVNSITESVTKRLSQSSITQSDVPDQNSENDVGGYSDSSEDEEDGPQKLAFSTRES
Sbjct: 481 TADSDVNSITESVTKRLSQSSITQSDVPDQNSENDVGGYSDSSEDEEDGPQKLAFSTRES 540

Query: 541 INLGKWKPDTDAFRSGFVTETIDINNPPEGYTVNEDGEIVEVNKNTTSNIQRNSSVASDG 600
           INLGKWKPDTDAFRSGFVTETIDINNPPEGYTVNEDGEIVEVNKNTTSNIQRNSSVASDG
Sbjct: 541 INLGKWKPDTDAFRSGFVTETIDINNPPEGYTVNEDGEIVEVNKNTTSNIQRNSSVASDG 600

Query: 601 ESQFNAFPHDVASDDDDLKTIADTKTIYDNQTIYNVPALIANNASAPALPTNIQITNEST 660
           ESQFNAFPHDVASDDDDLKTIADTKTIYDNQTIYNVPALIANNASAPALPTNIQITNEST
Sbjct: 601 ESQFNAFPHDVASDDDDLKTIADTKTIYDNQTIYNVPALIANNASAPALPTNIQITNEST 660

Query: 661 DYVSSNDTIFKHVNGEAPKGESKLKEAFSSEGDEIPSVVHQSTVPNLDLVKLLSSNELHS 720
           DYVSSNDTIFKHVNGEAPKGESKLKEAFSSEGDEIPSVVHQSTVPNLDLVKLLSSNELHS
Sbjct: 661 DYVSSNDTIFKHVNGEAPKGESKLKEAFSSEGDEIPSVVHQSTVPNLDLVKLLSSNELHS 720

Query: 721 QKLKKLNNYKEQLKEYDSGLQSWIQYALKSSTTSDKDFIFKDYKVNKHVQDAYAQADILS 780
           QKLKKLNNYKEQLKEYDSGLQSWIQYALKSSTTSDKDFIFKDYKVNKHVQDAYAQADILS
Sbjct: 721 QKLKKLNNYKEQLKEYDSGLQSWIQYALKSSTTSDKDFIFKDYKVNKHVQDAYAQADILS 780

Query: 781 KKNSVANTVNQNVTHLKKKMFSSSMREK 808
           KKNSVANTVNQNVTHLKKKMFSSSMREK
Sbjct: 781 KKNSVANTVNQNVTHLKKKMFSSSMREK 808

>YGR196C (FYV8) [2146] chr7 complement(889736..892189) Protein of
           unknown function [2454 bp, 817 aa]
          Length = 817

 Score =  224 bits (572), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 128/292 (43%), Positives = 187/292 (64%), Gaps = 27/292 (9%)

Query: 536 STRESINLGKWKPDTDAFRSGFVTETIDINNPPEGYTVNEDGEIVEVNKNTTSNIQ-RNS 594
           S ++S ++  WKPD++A RSGFV +T +   PP GY ++ +G++V++   T ++++ R  
Sbjct: 523 SVKDSTDVDSWKPDSEALRSGFVQDTANKKAPP-GYVIDSNGKLVDL---TPASMKPRVV 578

Query: 595 SVASDGESQFNAFPHDVASDDDDLKTIADTKTIYDNQTIYNVPALIANNASAPALPTNIQ 654
           S  S+ ES ++AFP     +DDDL+TI DTKTIYDN TIYNVP LI N ++ P LP + Q
Sbjct: 579 STYSEMESTWDAFPS--KGEDDDLETIRDTKTIYDNNTIYNVPGLIGNQSNLPPLPMDAQ 636

Query: 655 IT------NESTDYVSSNDTI---------FKHVNGEAPKGESKLKEAFSSEGDEIPSVV 699
                   N +TD  +SN+T          FK  N    +GE  +        +E+  + 
Sbjct: 637 EQLNAGNDNSTTDNDNSNNTANDLAARSASFKSENRTVSQGE--MTSVHEPSTEEMAKLG 694

Query: 700 HQSTVPNLDLVKLLSSNELHSQKLKKLNNYKEQLKEYDSGLQSWIQYALKSSTTSDKDFI 759
            Q+ +P LD+ KLL+S   H+ K+++L NYK +L EYD+G+Q+WI Y LKSS+  DKDFI
Sbjct: 695 QQNNLPKLDMNKLLNSKTSHAGKIEQLRNYKRELDEYDTGIQTWINYTLKSSSNKDKDFI 754

Query: 760 FKDYKVNKHVQDAYAQADILSKKNSVANT---VNQNVTHLKKKMFSSSMREK 808
            ++YK + HV++AYA AD LSKK++V NT   VNQNVTHL++K+F  SM+ K
Sbjct: 755 AEEYKQHSHVREAYANADDLSKKHTVINTVASVNQNVTHLRRKVFQHSMKPK 806

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 52/176 (29%), Positives = 77/176 (43%), Gaps = 67/176 (38%)

Query: 16  SDNITRHKSQRWVSASKANYDGADWDA---YSSNSED--------EGLTNNIPQLPQVNI 64
           ++ + R KS RWVSAS+A+YDGA WD+   Y  +SED        +   +N+P LP++N 
Sbjct: 3   TEQVGRKKSYRWVSASQASYDGAGWDSSDEYDYSSEDGTKGSEIHKQKISNLPSLPKLNY 62

Query: 65  PE----------------SNNIAKS--SSPDPSIG------------------------- 81
            +                 NN++KS  S  D  +G                         
Sbjct: 63  TDVNGEHDENTGENKDSNDNNVSKSDISPSDKEVGYLSDGVPKLMASRESVELQAKKSSE 122

Query: 82  ----------TCLRSDSLNTSVRSGNKSVNDDLDSLMHQISQEMTAKDEDVNNTSD 127
                       L+S S N      N++VN+DLD+L+ QIS+EMT    ++  TSD
Sbjct: 123 HSKSDYLSSTASLKSPSENKKSPHTNRAVNEDLDNLIEQISREMTP---EIRQTSD 175

>CAGL0G09295g 887666..889969 similar to sp|P46949 Saccharomyces
           cerevisiae YGR196c, start by similarity
          Length = 767

 Score =  222 bits (565), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 151/373 (40%), Positives = 212/373 (56%), Gaps = 47/373 (12%)

Query: 446 LEVTKSGYFAAMVDE---DKEIDDSDRHTLNN-NDTDGLTADSDVNSITESVTKRLSQSS 501
           + V KSGYF  +V E   DK++DD    +LNN   T   + +  V S TE          
Sbjct: 421 VHVHKSGYFKKLVAEELGDKKLDDG--KSLNNVASTQTASTEDKVASDTE---------- 468

Query: 502 ITQSDVPDQNSENDVGGYSDSSEDEEDGPQKLAFSTRESINLGKWKPDTDAFRSGFVTET 561
               DV +  ++ND     D+  D          S R S+   +W+PDTDA R GF+ +T
Sbjct: 469 ----DVQESKADND-----DTKNDAH------VSSNRSSVTSEEWRPDTDALRDGFMQKT 513

Query: 562 IDINNPPEGYTVNEDGEIVEVNKNTTSNIQRNSSVASDGESQFNAFPHDVASDDDDLKTI 621
            D  NPP G+  +E GE+V++     S   R  S  S+ ES +NAFP   + D DDL+TI
Sbjct: 514 GD--NPPPGFVRDEKGELVDLTP--ASMKPRVVSTYSEIESTWNAFP---SEDADDLETI 566

Query: 622 ADTKTIYDNQTIYNVPALIANNASAPALPTNIQITNES--TDYVSSNDTI-FKHVNGEAP 678
            DTKT+YDN T+YNVP ++ NN + P LP +  +  +S  +D V S D      V  +  
Sbjct: 567 RDTKTLYDNSTLYNVPGIMTNNDALPPLPEDASLYRDSNQSDAVGSQDRARAASVTRKVS 626

Query: 679 KGESKLKEAFSSEGDEIPSVVHQSTVPNLDLVKLLSSNELHSQKLKKLNNYKEQLKEYDS 738
           K    + +  S E   I  +  Q+T+P  DL K++SSN  H+ KL+ L +Y+  L  +DS
Sbjct: 627 KEGVNIAQPTSQE---INKLSEQNTMPTRDLNKIISSNSTHAIKLENLRDYRNTLDNFDS 683

Query: 739 GLQSWIQYALKSSTTSDKDFIFKDYKVNKHVQDAYAQADILSKKNSVANT---VNQNVTH 795
           GLQ+WI Y LKSS+ +D+DFIF++YK N HV++AYA AD LS+KN+V NT   VNQNV H
Sbjct: 684 GLQTWIAYTLKSSSKTDRDFIFQEYKSNSHVREAYANADDLSRKNTVINTVTNVNQNVNH 743

Query: 796 LKKKMFSSSMREK 808
           L+KK+   S++ K
Sbjct: 744 LRKKVLQHSLKPK 756

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 33/53 (62%), Gaps = 9/53 (16%)

Query: 19 ITRHKSQRWVSASKANYDGADWDAYSSNSEDE--------GLTNNIPQLPQVN 63
          + R KS RWVSAS+A YDGA WD+ SS SE E         L  ++P LP++N
Sbjct: 6  VERKKSYRWVSASQATYDGAGWDS-SSESETETRSQPKLGKLDESLPSLPKLN 57

>Scas_617.4
          Length = 791

 Score =  219 bits (559), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 142/376 (37%), Positives = 233/376 (61%), Gaps = 19/376 (5%)

Query: 446 LEVTKSGYFAAMVDEDKEIDDSDRHT----LNNNDTDGLTADSDVNSITESV-TKRLSQS 500
            +V++SGYF  +++ED+    +D+ +    L+  + +    + D+ SI  S+ + ++ ++
Sbjct: 407 FKVSESGYFEKLLEEDEMNPSTDQESHHEELDKEENNSEGTEDDILSIPASIESDKVEEN 466

Query: 501 SITQSDVPDQNSENDVGGYSDSSEDEEDGPQKLAF--STRESINLGKWKPDTDAFRSGFV 558
               +   D+ SE +    S++S+  +D    +    S+R+SINLG WKPDTDA RSGFV
Sbjct: 467 PEGINKEADETSEKEKDRESENSKSGDDQETTITEGDSSRDSINLGSWKPDTDAIRSGFV 526

Query: 559 TETIDINNPPEGYTVNEDGEIVEVNKNTTSNIQ-RNSSVASDGESQFNAFPHDV-ASDDD 616
            +T +   PP G+  +E+G++V++   T S+++ R  S  S+ ES + AFP +    +++
Sbjct: 527 QDT-NKRAPP-GFVYDENGKLVDL---TPSSMKPRVVSTYSEMESTWAAFPSNGNPENNE 581

Query: 617 DLKTIADTKTIYDNQTIYNVPALIANNASAPALPTNIQITNESTDYVSSNDTIFKHVNGE 676
           DL+TI DTKT+YDN TI+NVP ++ NN + P LP N+ I   S   V+   T    V+ +
Sbjct: 582 DLETIKDTKTLYDNNTIFNVPGIMTNNENLPPLPKNVNIEQGSLP-VARTLTAGSEVDKK 640

Query: 677 APKG-ESKLKEAFSSEGDEIPSVVHQSTVPNLDLVKLLSSNELHSQKLKKLNNYKEQLKE 735
           + K   S+       +  E+  +  Q  +P LDL +L+SS   H  K+++L  Y + L +
Sbjct: 641 SIKSIHSEGPSVHKPDSYEMAKLSDQDPLPELDLNELISSKASHLSKIEQLQAYSQSLAD 700

Query: 736 YDSGLQSWIQYALKSSTTSDKDFIFKDYKVNKHVQDAYAQADILSKKNSVANT---VNQN 792
           YDSG+Q+WI Y LKSS+ +D+D++F +YK N+HV++AYA A+ LS+KN+V NT   VNQN
Sbjct: 701 YDSGIQTWINYTLKSSSKADRDYLFDEYKKNEHVREAYANAEDLSRKNTVINTVASVNQN 760

Query: 793 VTHLKKKMFSSSMREK 808
           V+HL+KK+FS SM+ +
Sbjct: 761 VSHLRKKVFSHSMKPR 776

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 66/143 (46%), Gaps = 38/143 (26%)

Query: 16  SDNITRHKSQRWVSASKANYDGADWDAYSSNSEDEGLTN--------NIPQLPQVNI--- 64
           S+N+ R KS RW SAS+A YDGADW++ S + ED  ++N         +P LP++N    
Sbjct: 3   SENVGRKKSHRWASASQATYDGADWNS-SDSDEDHAISNEEAQPNVTKLPSLPKLNYTSN 61

Query: 65  -----------PESN----NIAKSSSPDPSIGTCLRSD-----------SLNTSVRSGNK 98
                       E N    N  +   P   I T   +D              T   S  +
Sbjct: 62  EEEEEGKLTDNAEENGKLPNSEEEERPTLHITTEDETDRSSSNNESKSSLNRTRRNSPMR 121

Query: 99  SVNDDLDSLMHQISQEMTAKDED 121
            VN DLD+LM QIS+EMT K E+
Sbjct: 122 GVNTDLDNLMLQISKEMTPKLEN 144

>ACR036C [1084] [Homologous to ScYGR196C (FYV8) - SH]
           (423030..425294) [2265 bp, 754 aa]
          Length = 754

 Score =  181 bits (460), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 112/282 (39%), Positives = 166/282 (58%), Gaps = 23/282 (8%)

Query: 538 RESINLGKWKPDTDAFRSGFVTETIDINNPPEGYTVNEDGEIVEVNKNTTSNIQRNSSVA 597
           ++S++LG W PDT+  R  F+T+   ++   +G   ++D E       T  + Q      
Sbjct: 467 QQSVHLGAWNPDTEGKRGAFLTQASPMSTN-KGMCGSQDEE------TTGDDQQLAEPCN 519

Query: 598 SDGESQFNAFPHDVASDDDDLKTIADTKTIYDNQTIYNVPALIANNASAPALPTNIQ--- 654
            D +S +  FP     + +DL+++AD KTIYDNQT+YNVP +I ++ S P LP+++    
Sbjct: 520 DDSDSVWEGFPS--VGEYEDLQSVADIKTIYDNQTLYNVPGIITSSTSVPPLPSSMSELT 577

Query: 655 ------ITNESTDYVS-SNDTIFKHVNGE--APKGESKLKEAFSSEGDEIPSVVHQSTVP 705
                 I +EST      +D++ + V G+  APK  S  KE F    +     +  S VP
Sbjct: 578 SRQDTSILSESTSGSGLDSDSLMRVVEGQRHAPK-PSMFKENFGQTPEVQVEHLVNSPVP 636

Query: 706 NLDLVKLLSSNELHSQKLKKLNNYKEQLKEYDSGLQSWIQYALKSSTTSDKDFIFKDYKV 765
           +LD+  L+   + HS K  KLN++ E L  Y SG Q+WI+YALKS T S  +  F +Y +
Sbjct: 637 SLDICALIEGPQSHSFKRDKLNSHIEDLNAYSSGAQTWIKYALKS-TQSSSNITFDEYVI 695

Query: 766 NKHVQDAYAQADILSKKNSVANTVNQNVTHLKKKMFSSSMRE 807
           +KHVQDAYAQA+ +SKK+SV N VNQNV+ L+KK+FS SM+E
Sbjct: 696 SKHVQDAYAQAEEVSKKHSVTNAVNQNVSQLRKKVFSHSMKE 737

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 60/140 (42%), Gaps = 39/140 (27%)

Query: 15  MSDNITRHKSQRWVSASKANYDGADWDAYSSNSEDEG-------LTNNIPQLPQVNIPES 67
           M D + R KSQRWVS SK NYDGADWD+  S  E E            +P+LP++N+   
Sbjct: 1   MPDKVNRRKSQRWVSVSKGNYDGADWDSDYSGEELESSPTRQHETICKLPELPKLNL--G 58

Query: 68  NNIAKSSSPDPSIGTCLRSDSLNTSVRSGNKS---------------------------- 99
            +  +   P    G   R  +   +  SG  +                            
Sbjct: 59  GSTEERGRPGSGDGLAPRGAAEEEAASSGRGAATPAHEVQTPRSGAAAQKFSLTSSSRSV 118

Query: 100 --VNDDLDSLMHQISQEMTA 117
             +N +LD+LM +IS+EMTA
Sbjct: 119 SSMNKELDTLMDEISKEMTA 138

>Kwal_33.15455
          Length = 914

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 64/215 (29%), Positives = 93/215 (43%), Gaps = 65/215 (30%)

Query: 15  MSDNITRHKSQRWVSASKANYDGADWDA------YSSNSEDEGLT----------NNIPQ 58
           MS N+ R KSQRWVS SK  YDG +WD+      Y +   DEG +          + +P 
Sbjct: 1   MSVNMERKKSQRWVSVSKGTYDGKEWDSSEEDEPYGAWENDEGQSRKSPERNGTVSKLPP 60

Query: 59  LPQVNIPE----SNNIAKS-SSPDPSIGTCLRSDSLNT-SVR-----SGNKSVN------ 101
           LP ++  +    SN + ++ +  D + G+ L S S    S R     SG   VN      
Sbjct: 61  LPMLSYGKDSRRSNEVERTETGADEASGSQLDSTSTGAGSPRLYQSSSGAARVNSQSSTG 120

Query: 102 -----------DDLDSLMHQISQEMTA----------KDEDVNNTSDPED---------- 130
                      ++LD LM Q+SQE+T            D+ +N+     D          
Sbjct: 121 RITRGPSQYKSENLDHLMTQLSQELTPVSISESRFSFNDDGLNSPRGSADRYRDSNGFSY 180

Query: 131 -EDDAELKVSKTGYFAAYVNDEDTDDRESVKSDIE 164
            E + E +VSKTGYF+  +   D  D+ S  S+ E
Sbjct: 181 SESEEEPQVSKTGYFSNMMQSPDGADQSSEHSESE 215

>Scas_713.4
          Length = 1326

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 42/98 (42%), Gaps = 18/98 (18%)

Query: 527 EDGPQKLAFSTRESINLGKWKPDTDAFRSGF-----VTETIDINNPPEGYT---VNEDGE 578
           ED  Q++  S    +  GKW  D D           +TE + ++NP E  +   V++DG 
Sbjct: 866 EDHLQEIKESAENPLTTGKWWKDADKPWQCLATCIELTEALKLDNPEEFISHQPVHQDG- 924

Query: 579 IVEVNKNTTSNIQRNSSVASD--GESQFNAFPHDVASD 614
                  T + +Q  +++  D  G  Q N  PHD   D
Sbjct: 925 -------TCNGLQHYAALGGDVEGAEQVNLIPHDRPQD 955

>YKL116C (PRR1) [3148] chr11 complement(220990..222546)
           Serine/threonine protein kinase potentially involved in
           pheromone response, has similarity to S. pombe Nim1p
           [1557 bp, 518 aa]
          Length = 518

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 26/49 (53%)

Query: 275 EMIDPTTEIPSRIQGDVAISDDKGSKDAVDEDNWSKSDSHPESIGSQDK 323
           E+I P    P R+     ++++    D+VD DN++K    PES  S +K
Sbjct: 124 ELIAPANLSPQRVVSLPTVTEEALVNDSVDSDNYTKEPYFPESSSSTEK 172

>Kwal_27.11864
          Length = 453

 Score = 30.0 bits (66), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 17/70 (24%), Positives = 33/70 (47%)

Query: 299 SKDAVDEDNWSKSDSHPESIGSQDKEEMPPSSINSLPSESQLSIQHSKEGDSNDSDSLLN 358
           +K   D +NW+ SD+  +   S   + +       + +   L     KEG+S  ++ +L+
Sbjct: 334 TKGPYDFNNWADSDTALQMAASMPDDGVLFEGYGEMATYRTLMAHFYKEGESPSAEMVLD 393

Query: 359 GYGSEPSLMK 368
           G G   +L+K
Sbjct: 394 GVGGGCTLVK 403

>ADR281W [2022] [Homologous to ScYDL098C (SNU23) - SH]
           complement(1182238..1182819) [582 bp, 193 aa]
          Length = 193

 Score = 29.3 bits (64), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 24/52 (46%)

Query: 102 DDLDSLMHQISQEMTAKDEDVNNTSDPEDEDDAELKVSKTGYFAAYVNDEDT 153
           D L+ ++HQI  E    +  V +T D E  D  EL        AA+V D  T
Sbjct: 104 DHLNHIIHQIKFEQVFGESLVADTRDNEHLDAGELAGEYKAQIAAFVRDNST 155

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.303    0.122    0.328 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 27,978,742
Number of extensions: 1360037
Number of successful extensions: 7934
Number of sequences better than 10.0: 434
Number of HSP's gapped: 7519
Number of HSP's successfully gapped: 649
Length of query: 808
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 698
Effective length of database: 12,788,129
Effective search space: 8926114042
Effective search space used: 8926114042
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 17 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.8 bits)
S2: 66 (30.0 bits)