Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0D07238g28327914550.0
Kwal_26.86942882754755e-58
ACR114C2341914097e-49
YOR228C3022314079e-48
Scas_640.203022733563e-40
CAGL0J04004g2882313267e-36
Scas_692.3628229690.72
AGL313C538123681.4
AEL166C80685627.3
Scas_711.2948776619.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D07238g
         (279 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D07238g complement(618435..619286) weakly similar to sgd|S0...   565   0.0  
Kwal_26.8694                                                          187   5e-58
ACR114C [1161] [Homologous to ScYOR228C - SH] (553753..554457) [...   162   7e-49
YOR228C (YOR228C) [5019] chr15 complement(766869..767777) Protei...   161   9e-48
Scas_640.20                                                           141   3e-40
CAGL0J04004g 375642..376508 similar to tr|Q12106 Saccharomyces c...   130   7e-36
Scas_692.36                                                            31   0.72 
AGL313C [3999] [Homologous to NOHBY] (115002..116618) [1617 bp, ...    31   1.4  
AEL166C [2340] [Homologous to ScYJL062W (LAS21) - SH] (322853..3...    28   7.3  
Scas_711.29                                                            28   9.6  

>KLLA0D07238g complement(618435..619286) weakly similar to
           sgd|S0005754 Saccharomyces cerevisiae YOR228c, start by
           similarity
          Length = 283

 Score =  565 bits (1455), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/279 (100%), Positives = 279/279 (100%)

Query: 1   MTAAKLTPLKPIPTKHIDPDLAKTPEDASVNLVLNIKKWLRWTQKWSLFPLVTYFPLHGI 60
           MTAAKLTPLKPIPTKHIDPDLAKTPEDASVNLVLNIKKWLRWTQKWSLFPLVTYFPLHGI
Sbjct: 1   MTAAKLTPLKPIPTKHIDPDLAKTPEDASVNLVLNIKKWLRWTQKWSLFPLVTYFPLHGI 60

Query: 61  NALIIPALEPSSFPNDALMMVRELTSGLGSKLIWTGISIHILSGFALRIMRKLPTSSKTH 120
           NALIIPALEPSSFPNDALMMVRELTSGLGSKLIWTGISIHILSGFALRIMRKLPTSSKTH
Sbjct: 61  NALIIPALEPSSFPNDALMMVRELTSGLGSKLIWTGISIHILSGFALRIMRKLPTSSKTH 120

Query: 121 NAESLLDTQSLAQSRIGLVGGLSGYFIGIKRNLQYNPQELTGWLLTPVLFFHGALMKWLP 180
           NAESLLDTQSLAQSRIGLVGGLSGYFIGIKRNLQYNPQELTGWLLTPVLFFHGALMKWLP
Sbjct: 121 NAESLLDTQSLAQSRIGLVGGLSGYFIGIKRNLQYNPQELTGWLLTPVLFFHGALMKWLP 180

Query: 181 NTAKVDIDFDFVKWLLDKDRGALVRIGLGYGPLVALIGLGSYHIIAGTVQYMHVRSLKTR 240
           NTAKVDIDFDFVKWLLDKDRGALVRIGLGYGPLVALIGLGSYHIIAGTVQYMHVRSLKTR
Sbjct: 181 NTAKVDIDFDFVKWLLDKDRGALVRIGLGYGPLVALIGLGSYHIIAGTVQYMHVRSLKTR 240

Query: 241 KRIMNFILLLICTGYIGISRLGSEIVFGMDKYYRPILRT 279
           KRIMNFILLLICTGYIGISRLGSEIVFGMDKYYRPILRT
Sbjct: 241 KRIMNFILLLICTGYIGISRLGSEIVFGMDKYYRPILRT 279

>Kwal_26.8694
          Length = 288

 Score =  187 bits (475), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 108/275 (39%), Positives = 157/275 (57%), Gaps = 9/275 (3%)

Query: 5   KLTPLKPIPTKHIDPDLAKTPEDASVNLVLN---IKKWLRWTQKWSLFPLVTYFPLHGIN 61
           +L  + P P ++  P L    + + V   LN   ++  LR  QK +++PL  YFPLH +N
Sbjct: 6   ELKEVTPEPIRNYRP-LEGIEKPSGVLSFLNARFVRLSLRRIQKHAVWPLAVYFPLHALN 64

Query: 62  ALIIPALEPSSFPNDALMMVRELTSGLGSKLIWTGISIHILSGFALRIMRKLPTSSK-TH 120
            L++PA+   S PND LMM+RE+  G  S+L+   I+ H+ SGFALRI       +K   
Sbjct: 65  TLVVPAISTESAPNDILMMIREVLPGFTSRLLTWSITAHVASGFALRIWSLASRWTKLKK 124

Query: 121 NAESLLDTQSL--AQSRIGLVGGLSGYFIGIKRNLQYNPQELTGWLLTPVLFFHGALMKW 178
              S+   Q    +Q +IGL+GGLSGYFIG+ + L YNPQ ++G++L P++++H  LMK 
Sbjct: 125 RGRSIPQDQKERESQRQIGLIGGLSGYFIGVSKQLAYNPQVVSGYILLPIIWYHARLMKK 184

Query: 179 LPNTAKVDIDFDFVKWLLDKDRGALVRIGLGYGPLVALIGLGSYHIIAGTVQYMHVRSLK 238
           +P    +DIDFDFVKW+L  D   +   G G  PL  LI   SYHI+AG   Y  +R L 
Sbjct: 185 IPTAEDIDIDFDFVKWVLQNDSVWIKWFG-GIIPLSILIWTASYHIVAGFCTYAKIRRLD 243

Query: 239 TRKRIMNFILLLICTGYIGISRLGSEI-VFGMDKY 272
            RK +   +  L  TG+  + RL   + VF   ++
Sbjct: 244 VRKAMSTLVFSLTATGFFSLWRLSKSLPVFESSQW 278

>ACR114C [1161] [Homologous to ScYOR228C - SH] (553753..554457) [705
           bp, 234 aa]
          Length = 234

 Score =  162 bits (409), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 84/191 (43%), Positives = 117/191 (61%), Gaps = 3/191 (1%)

Query: 54  YFPLHGINALIIPALEPSSFPNDALMMVRELTSGLGSK-LIWTGISIHILSGFALRIMRK 112
           Y PLH  N L +P +EP+  PND L MVREL      + L+WT + +H+ +G ALR M  
Sbjct: 5   YMPLHLTNTLFVPLIEPTYAPNDVLRMVRELLPAATDQVLVWT-VGVHVAAGVALRAMSW 63

Query: 113 LPTSSKTHNAESLLDTQSLAQSRIGLVGGLSGYFIGIKRNLQYNPQELTGWLLTPVLFFH 172
               ++             +  RIGL+GGLSGYF+G+ + +++NP  ++G+LL P+L +H
Sbjct: 64  YRRWTRRGRRYVTRVESDTSPRRIGLIGGLSGYFLGLNKTVRHNPHAVSGYLLVPLLAYH 123

Query: 173 GALMKWLPNTAKVDIDFDFVKWLLDKDRG-ALVRIGLGYGPLVALIGLGSYHIIAGTVQY 231
            ALMKWLP  A VD+DFDFV+WLL    G A  R GLG  PL  L+ +G+YH+  G VQ 
Sbjct: 124 AALMKWLPARAGVDVDFDFVQWLLYGGTGSAWTRWGLGIMPLAGLVSVGAYHMFTGLVQL 183

Query: 232 MHVRSLKTRKR 242
           +  RSL  R++
Sbjct: 184 LRWRSLALRRK 194

>YOR228C (YOR228C) [5019] chr15 complement(766869..767777) Protein
           of unknown function, has low similarity to
           uncharacterized C. albicans Orf6.5264p [909 bp, 302 aa]
          Length = 302

 Score =  161 bits (407), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 87/231 (37%), Positives = 132/231 (57%), Gaps = 2/231 (0%)

Query: 35  NIKKWLRWTQKWSLFPLVTYFPLHGINALIIPALEPSSFPNDALMMVRELTSGLGSKLIW 94
           + +++L   QK S+ P+  YFPLH  N LI PA+ P S P+D LMMVRE+   + +KL+ 
Sbjct: 49  SCRRFLWNCQKISVLPMALYFPLHAANTLITPAVSPDSAPDDVLMMVREILPSITTKLLV 108

Query: 95  TGISIHILSGFALRIMRKLPTSSKT-HNAESLLDTQSLAQSRIGLVGGLSGYFIGIKRNL 153
            GI++H+ +G  LRI+       +  H    +   Q L+Q  IGL GG+SGY  G+ +  
Sbjct: 109 AGITLHVSAGVLLRIVNNWNKPRRNRHRHLKISAEQDLSQDSIGLTGGISGYLFGLYKTF 168

Query: 154 QYNPQELTGWLLTPVLFFHGALMKWLPNTAKVDIDFDFVKWLLDKDRGALVRIGLGYGPL 213
           +  PQ ++G++L PVL +H  +MKW+PN+   ++DF  +K LL         +G G  PL
Sbjct: 169 RIPPQVISGYILVPVLIYHLLIMKWVPNSISTEVDFASIKQLLSSKNRWWKWLG-GLVPL 227

Query: 214 VALIGLGSYHIIAGTVQYMHVRSLKTRKRIMNFILLLICTGYIGISRLGSE 264
             L+  G YHI +G  +Y  VR + +RK+    I LL   G++ + RL  E
Sbjct: 228 AILLESGVYHIGSGLCRYFGVRKMTSRKKWSTAINLLTLVGFVSLIRLMKE 278

>Scas_640.20
          Length = 302

 Score =  141 bits (356), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 91/273 (33%), Positives = 149/273 (54%), Gaps = 22/273 (8%)

Query: 25  PEDASVNLVLNIKKWLRWTQKWSLFPLVTYFPLHGINALIIPALEPSSFPNDALMMVREL 84
           PE  +V    N+ K L+  QK+S++P++ YFP+H IN   IP ++P+  P   L ++RE 
Sbjct: 28  PESKNVFSNRNLIKALKGFQKYSVWPMLLYFPVHSINTFGIPLIQPNKLPGRVLTIIREK 87

Query: 85  TSGLGSKLIWTGISIHILSGFALRI-------MRKLPTSSKT-------HNAESLLDTQS 130
           +    S+++   + IHI SG  LR+        R++    ++       H+A  LL ++ 
Sbjct: 88  SPLFLSRILIGSLVIHIASGVLLRVSHWLYHFQRRMGEGEESEADHHLNHDASQLLVSED 147

Query: 131 LAQSRIGLVGGLSGYFIGIKRNLQYNPQELTGWLLTPVLFFHGALMKW-LPNTAKVDIDF 189
           ++Q  IGL GG+ GYF+G ++  +++P  ++G+LLTP L +H  +M+W L N       F
Sbjct: 148 ISQGSIGLTGGIVGYFLGWRKKFKHSPLIVSGYLLTPFLLYHVIIMRWGLVNPE--SKGF 205

Query: 190 DFVKWLLDKDRGALVRIGLGYGPLVALIGLGSYHIIAGTVQYMHVRSLKTRKRIMNFILL 249
            FV WLL  +    +R+  G  PL  LI  G+YHI AG  +Y+ ++ +  RK+    I L
Sbjct: 206 TFVDWLLT-NSDWWIRVVGGIIPLSVLIVSGTYHIGAGICKYLKIKDVNKRKKWAGGITL 264

Query: 250 LICTGYIGISRLG----SEIVFGMDKYYRPILR 278
           L  TG I I RL     S I   +++++  I +
Sbjct: 265 LSITGLISIFRLSMIEHSGIPLKLEEHFTKIFK 297

>CAGL0J04004g 375642..376508 similar to tr|Q12106 Saccharomyces
           cerevisiae YOR228c, hypothetical start
          Length = 288

 Score =  130 bits (326), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 79/231 (34%), Positives = 117/231 (50%), Gaps = 7/231 (3%)

Query: 44  QKWSLFPLVTYFPLHGINALIIPALEPSSFPNDALMMVRELTSGLGSKLIWTGISIHILS 103
           Q+ S+ P+  YFP+H +N +I P + P + P+  L  V +      SK++   +  HI S
Sbjct: 45  QRLSIVPMALYFPVHAVNTMITPLVNPETAPDSFLTAVHKWVPQAASKILIASLLTHIAS 104

Query: 104 GFALR---IMRKLPTSSKTHNAESLLDTQSLAQSRIGLVGGLSGYFIGIKRNLQYNPQEL 160
           G  LR   + +      K H       T S  Q  IGL GG+SGY  GI +    +P  +
Sbjct: 105 GVLLRGWKLYKSHVLKEKYHLHHQHKHTTS--QDDIGLTGGISGYLFGIYKQFTLSPLSM 162

Query: 161 TGWLLTPVLFFHGALMKWLPNT-AKVDIDFDFVKWLLDKDRGALVRIGLGYGPLVALIGL 219
           +G++LTP++ +H  +MKW+P +  +    FDFVK LL       +R   G  PL ALI  
Sbjct: 163 SGYVLTPLVLYHLLIMKWVPESLGEPATGFDFVKQLLRASEW-WIRWFAGIIPLSALISA 221

Query: 220 GSYHIIAGTVQYMHVRSLKTRKRIMNFILLLICTGYIGISRLGSEIVFGMD 270
            SYHI+AG  + + V+ +K RK     I  L   G++ I RL +   F  D
Sbjct: 222 ASYHIVAGACRLLDVKDMKKRKNASRIISGLSIAGFLSILRLSNAKSFSSD 272

>Scas_692.36
          Length = 282

 Score = 31.2 bits (69), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 21/29 (72%)

Query: 55 FPLHGINALIIPALEPSSFPNDALMMVRE 83
          F  HG +A+ IP +E ++ PN+AL +++E
Sbjct: 39 FLSHGYDAVFIPLIEHTNIPNEALTLLKE 67

>AGL313C [3999] [Homologous to NOHBY] (115002..116618) [1617 bp, 538
           aa]
          Length = 538

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 50/123 (40%), Gaps = 15/123 (12%)

Query: 53  TYFPLHGINALIIPA-LEPS-----SFPNDALMMVRELTSGLGSKLIWTGISIHILSGFA 106
           T+ P H  ++L++   L P        P  A+  VRE   G GS+L+W  IS    +   
Sbjct: 228 THIPGHVRDSLVVDQWLAPRVGDLLRTPRGAIFRVREAAEGSGSQLVWEVISEEEAAALV 287

Query: 107 LRIMRKLPTSSKTHNAESLLDTQSLAQSRIGLVGGLSGYFIGIKRNLQYNPQELTGWLLT 166
              +R    S  + N+ + L T  LA+S       LS     + +     PQ  T    T
Sbjct: 288 PHTLRLEKPSWVSSNSSTALST--LARS-------LSAVVPTVSQAGNKMPQLATSAPST 338

Query: 167 PVL 169
           PV 
Sbjct: 339 PVF 341

>AEL166C [2340] [Homologous to ScYJL062W (LAS21) - SH]
           (322853..325273) [2421 bp, 806 aa]
          Length = 806

 Score = 28.5 bits (62), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 18/85 (21%), Positives = 35/85 (41%), Gaps = 3/85 (3%)

Query: 182 TAKVDIDFDFVKWLLDKDRGALVRIGLGYGPLVALIGLGSYHIIAGTVQYMHVRSLKTRK 241
            A+ + D D +   +   +  L R    Y   +  +G+G   I+     Y ++ S +  +
Sbjct: 364 AARGNDDIDSMLAEMKDVQATLARTATNYNYAMLFLGVGMLSIVTAATAYCYISSARLNE 423

Query: 242 RIMNFILLLICTGYIGISRLGSEIV 266
                +L++  T  +G S  GS  V
Sbjct: 424 AS---VLMIAVTALLGSSVFGSSFV 445

>Scas_711.29
          Length = 487

 Score = 28.1 bits (61), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 34/76 (44%), Gaps = 13/76 (17%)

Query: 138 LVGGLSGYFIGIKRNLQYNPQE----------LTGWLLTPVLFFHGALMKWLPNTAKVDI 187
           ++G L  YF+   +NL+Y              +T  LL PVL F   L +W+P       
Sbjct: 206 IIGLLRLYFV---KNLEYQEHVTEYGVHWNFFITLALLPPVLVFIDPLTEWIPRCCIAIS 262

Query: 188 DFDFVKWLLDKDRGAL 203
              F +W+L K+  AL
Sbjct: 263 ISIFYEWVLLKNDDAL 278

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.325    0.142    0.439 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,108,810
Number of extensions: 374392
Number of successful extensions: 1083
Number of sequences better than 10.0: 12
Number of HSP's gapped: 1090
Number of HSP's successfully gapped: 12
Length of query: 279
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 179
Effective length of database: 13,134,309
Effective search space: 2351041311
Effective search space used: 2351041311
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 61 (28.1 bits)