Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0D07216g1278125955420.0
Kwal_26.8687108899024080.0
ACR113W1102100422870.0
YPL137C1276103620940.0
Scas_640.211199107520600.0
Scas_700.38123993419450.0
YOR227W124698319310.0
CAGL0M02607g1204100919100.0
CAGL0J04026g119899018550.0
Scas_690.3314235216853e-73
KLLA0E11847g12645306649e-71
Kwal_23.548811127456619e-71
CAGL0J00803g13145366532e-69
YJL042W (MHP1)13985486401e-67
ACR059W12165335248e-54
AER397C1428135780.61
Kwal_27.1251495852760.93
YLR176C (RFX1)81142760.97
Scas_651.860769714.0
AAL104C585108689.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D07216g
         (1259 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D07216g 614450..618286 weakly similar to sgd|S0006058 Sacch...  2139   0.0  
Kwal_26.8687                                                          932   0.0  
ACR113W [1160] [Homologous to ScYOR227W - SH; ScYPL137C - SH] co...   885   0.0  
YPL137C (YPL137C) [5309] chr16 complement(292816..296646) Protei...   811   0.0  
Scas_640.21                                                           798   0.0  
Scas_700.38                                                           753   0.0  
YOR227W (YOR227W) [5018] chr15 (762825..766565) Protein of unkno...   748   0.0  
CAGL0M02607g complement(298560..302174) similar to tr|Q03016 Sac...   740   0.0  
CAGL0J04026g complement(376899..380495) similar to tr|Q12276 Sac...   719   0.0  
Scas_690.33                                                           268   3e-73
KLLA0E11847g complement(1044591..1048385) some similarities with...   260   9e-71
Kwal_23.5488                                                          259   9e-71
CAGL0J00803g complement(83483..87427) similar to sp|P43638 Sacch...   256   2e-69
YJL042W (MHP1) [2870] chr10 (361165..365361) Microtubule-interac...   251   1e-67
ACR059W [1107] [Homologous to ScYJL042W (MHP1) - SH] complement(...   206   8e-54
AER397C [2897] [Homologous to ScYBL079W (NUP170) - SH; ScYER105C...    35   0.61 
Kwal_27.12514                                                          34   0.93 
YLR176C (RFX1) [3580] chr12 complement(507799..510234) Repressor...    34   0.97 
Scas_651.8                                                             32   4.0  
AAL104C [83] [Homologous to ScYPL169C (MEX67) - SH] (159179..160...    31   9.6  

>KLLA0D07216g 614450..618286 weakly similar to sgd|S0006058
            Saccharomyces cerevisiae YPL137c, start by similarity
          Length = 1278

 Score = 2139 bits (5542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1082/1259 (85%), Positives = 1082/1259 (85%)

Query: 1    MPNSLDLDVEVDWLYKGKKKVRANRRLDXXXXXXXXXXXXXXXXXXXXXXXXXXXGVXXX 60
            MPNSLDLDVEVDWLYKGKKKVRANRRLD                           GV   
Sbjct: 1    MPNSLDLDVEVDWLYKGKKKVRANRRLDSSSAPPATPSAPAPASTSVPTPAPGSAGVAEA 60

Query: 61   XXXXXXXXXXXXNSASSEPAQTPTPAAKTRNRXXXXXXXXXXXXXXNSPNTSGRSLKPSS 120
                        NSASSEPAQTPTPAAKTRNR              NSPNTSGRSLKPSS
Sbjct: 61   TPGAGTDGAGPENSASSEPAQTPTPAAKTRNRSSSHSQASLSQTAANSPNTSGRSLKPSS 120

Query: 121  AVLRRSSSLGEKPKKSLFGSLFNRKPLQPLESHTNXXXXXXXXXXXXXXXXXXXXXXXXX 180
            AVLRRSSSLGEKPKKSLFGSLFNRKPLQPLESHTN                         
Sbjct: 121  AVLRRSSSLGEKPKKSLFGSLFNRKPLQPLESHTNVSSTSSSVPAPVTSSSSASGHSAST 180

Query: 181  XXXXXXXXXXXXXXXXXXXXXXXXXXRGIPIPINISQFASHRQQISQFLKEPNSPEVKDM 240
                                      RGIPIPINISQFASHRQQISQFLKEPNSPEVKDM
Sbjct: 181  ASSSSSPTQASTTAAPASSSSSSSSSRGIPIPINISQFASHRQQISQFLKEPNSPEVKDM 240

Query: 241  APIQHDRVVLNKNPNKSKHPLPIKELTEINLKRVTFAVDEFGMDPPQQIPSRKPKLGNVL 300
            APIQHDRVVLNKNPNKSKHPLPIKELTEINLKRVTFAVDEFGMDPPQQIPSRKPKLGNVL
Sbjct: 241  APIQHDRVVLNKNPNKSKHPLPIKELTEINLKRVTFAVDEFGMDPPQQIPSRKPKLGNVL 300

Query: 301  VPNDMISDIPSISQGITTTAQPSSHGNDQHGALPASAYTKDSKEYQLALENHKKCLKESE 360
            VPNDMISDIPSISQGITTTAQPSSHGNDQHGALPASAYTKDSKEYQLALENHKKCLKESE
Sbjct: 301  VPNDMISDIPSISQGITTTAQPSSHGNDQHGALPASAYTKDSKEYQLALENHKKCLKESE 360

Query: 361  KHQQEAHYAAQRIASEVAGFKLKPSTSTDLKPSANGTVPKSGAATDDEANAEAGVVADEK 420
            KHQQEAHYAAQRIASEVAGFKLKPSTSTDLKPSANGTVPKSGAATDDEANAEAGVVADEK
Sbjct: 361  KHQQEAHYAAQRIASEVAGFKLKPSTSTDLKPSANGTVPKSGAATDDEANAEAGVVADEK 420

Query: 421  IKSLEIDKPIHMHEHHFKEXXXXXXXXXXEHGANPSSTSGTQDENGNELMLDVVYTRCCH 480
            IKSLEIDKPIHMHEHHFKE          EHGANPSSTSGTQDENGNELMLDVVYTRCCH
Sbjct: 421  IKSLEIDKPIHMHEHHFKESSGSSNGTGSEHGANPSSTSGTQDENGNELMLDVVYTRCCH 480

Query: 481  LREILPIPSTLRQLKEKKAPLQTLKFLNPRPTLIDILSFSDFIAIVPIHNVVFDNVGLSP 540
            LREILPIPSTLRQLKEKKAPLQTLKFLNPRPTLIDILSFSDFIAIVPIHNVVFDNVGLSP
Sbjct: 481  LREILPIPSTLRQLKEKKAPLQTLKFLNPRPTLIDILSFSDFIAIVPIHNVVFDNVGLSP 540

Query: 541  EMFKIVISSLVKSITLERLSMRNVVFDERGWKLLCKFLMRNKSLTKLDISQTKIRHDLDL 600
            EMFKIVISSLVKSITLERLSMRNVVFDERGWKLLCKFLMRNKSLTKLDISQTKIRHDLDL
Sbjct: 541  EMFKIVISSLVKSITLERLSMRNVVFDERGWKLLCKFLMRNKSLTKLDISQTKIRHDLDL 600

Query: 601  KLHRSQMDWSLFIDVLHKRQGKPLEELLLNGVSFANNLHTFENMINAFSSTKNEFSRKRK 660
            KLHRSQMDWSLFIDVLHKRQGKPLEELLLNGVSFANNLHTFENMINAFSSTKNEFSRKRK
Sbjct: 601  KLHRSQMDWSLFIDVLHKRQGKPLEELLLNGVSFANNLHTFENMINAFSSTKNEFSRKRK 660

Query: 661  LGLAQSQIASSEQLEILFRWMSENDIIGVDLAFNDFENLTKPIIKELSQRSFDSLQYFTL 720
            LGLAQSQIASSEQLEILFRWMSENDIIGVDLAFNDFENLTKPIIKELSQRSFDSLQYFTL
Sbjct: 661  LGLAQSQIASSEQLEILFRWMSENDIIGVDLAFNDFENLTKPIIKELSQRSFDSLQYFTL 720

Query: 721  NSTNIQSVQEAALIIRELSKLPKLYFLDLSGLPSLFPAIFPYLNKYLPRFPSLKRLHFDS 780
            NSTNIQSVQEAALIIRELSKLPKLYFLDLSGLPSLFPAIFPYLNKYLPRFPSLKRLHFDS
Sbjct: 721  NSTNIQSVQEAALIIRELSKLPKLYFLDLSGLPSLFPAIFPYLNKYLPRFPSLKRLHFDS 780

Query: 781  NEWTYKDISLVTQILPKCKELLHVSMMNQPQESWAMSAAVFLYDCIKNSDKLINLDFNYE 840
            NEWTYKDISLVTQILPKCKELLHVSMMNQPQESWAMSAAVFLYDCIKNSDKLINLDFNYE
Sbjct: 781  NEWTYKDISLVTQILPKCKELLHVSMMNQPQESWAMSAAVFLYDCIKNSDKLINLDFNYE 840

Query: 841  NIPEEINSRIAIALVRNAQKSIDSNWXXXXXXXXXXXXXXGELISETAGNILDKLNDSAK 900
            NIPEEINSRIAIALVRNAQKSIDSNW              GELISETAGNILDKLNDSAK
Sbjct: 841  NIPEEINSRIAIALVRNAQKSIDSNWQLDELSSQDDLLFDGELISETAGNILDKLNDSAK 900

Query: 901  LQEDSTKRYLLKRYWEKIHTIHANVQKTIDSMFEQRISKELSLQSKENLLRLIFMENTLG 960
            LQEDSTKRYLLKRYWEKIHTIHANVQKTIDSMFEQRISKELSLQSKENLLRLIFMENTLG
Sbjct: 901  LQEDSTKRYLLKRYWEKIHTIHANVQKTIDSMFEQRISKELSLQSKENLLRLIFMENTLG 960

Query: 961  NILEYLSTNPYIQELNYAXXXXXXXXXXXXERPVLKHVDSERIMYAKPLVDPIDQDIDQE 1020
            NILEYLSTNPYIQELNYA            ERPVLKHVDSERIMYAKPLVDPIDQDIDQE
Sbjct: 961  NILEYLSTNPYIQELNYAKNKDDDNYSSSDERPVLKHVDSERIMYAKPLVDPIDQDIDQE 1020

Query: 1021 LEHEQDSNSAKPHLMATDSGRTIDVTTGRPILTKTSSQRSIFGKKQEEEEGELHKWGFFV 1080
            LEHEQDSNSAKPHLMATDSGRTIDVTTGRPILTKTSSQRSIFGKKQEEEEGELHKWGFFV
Sbjct: 1021 LEHEQDSNSAKPHLMATDSGRTIDVTTGRPILTKTSSQRSIFGKKQEEEEGELHKWGFFV 1080

Query: 1081 QQQRSIYPENTPMSKYXXXXXHKHAQRKEPQLSQIVEKPREQVQTSQKTGQXXXXXXXXX 1140
            QQQRSIYPENTPMSKY     HKHAQRKEPQLSQIVEKPREQVQTSQKTGQ         
Sbjct: 1081 QQQRSIYPENTPMSKYQQQQQHKHAQRKEPQLSQIVEKPREQVQTSQKTGQPAATPTAST 1140

Query: 1141 XXXXXXXXXXXXXXXXXXXXIGKIPSGTELREAIIKAKGINSIEDLIDNVNCQQVKLDNI 1200
                                IGKIPSGTELREAIIKAKGINSIEDLIDNVNCQQVKLDNI
Sbjct: 1141 PPTSSNSIPALSKSAASAKLIGKIPSGTELREAIIKAKGINSIEDLIDNVNCQQVKLDNI 1200

Query: 1201 YGIQVEPPADAKPLVLSPGGRPDGNVSHDERHSAQENGFPSESEDSYVEDETTTEQLNV 1259
            YGIQVEPPADAKPLVLSPGGRPDGNVSHDERHSAQENGFPSESEDSYVEDETTTEQLNV
Sbjct: 1201 YGIQVEPPADAKPLVLSPGGRPDGNVSHDERHSAQENGFPSESEDSYVEDETTTEQLNV 1259

>Kwal_26.8687
          Length = 1088

 Score =  932 bits (2408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/990 (50%), Positives = 655/990 (66%), Gaps = 105/990 (10%)

Query: 225  ISQFLKEPNSPEVKDMAPIQHDRVVLNKNPNKSKHPLPIKELTEINLKRVTFAVDEFGMD 284
            +SQ+LKEP+SPEVKD API  +R +LN+NP++    LPI+ L + +L+RVTFAVD+F  D
Sbjct: 141  VSQYLKEPSSPEVKDPAPIHDERQILNRNPHRQS--LPIQSLAKTSLRRVTFAVDKFSTD 198

Query: 285  PPQQIPSRKPKLGNVLVPNDMISDIPSISQGITTTAQPSSHGNDQHGALPASAYTKDSKE 344
            PPQQIPSRKPK GNVLVP DM+   PSIS GIT T      GN +  A P   + ++SKE
Sbjct: 199  PPQQIPSRKPKRGNVLVPQDMMCPTPSISVGITNT-----QGNIEQSASP---FDENSKE 250

Query: 345  YQLALENHKKCLKESEKHQQEAHYAAQRIASEVAGFKLKPSTSTDLKPSANGTVPKSGAA 404
            Y+LALE H+K L+ESEKHQQEAHYAAQRIA EV  FK +P +    + +A      S + 
Sbjct: 251  YKLALEEHRKALRESEKHQQEAHYAAQRIAHEVLKFKTRPLSGAPHQLTA------SSSN 304

Query: 405  TDDEANAEAG---VVADEKIKSLEIDKPIHMHEHHFKEXXXXXXXXXXEHGANPSSTSGT 461
            T+ E++A +G      DE+ K+LEIDKPIHMHEHHF++                   + +
Sbjct: 305  TNVESSAPSGTTNAAIDERAKNLEIDKPIHMHEHHFQDD------------------TSS 346

Query: 462  QDENGNELMLDVVYTRCCHLREILPIPSTLRQLKEKKAPLQTLKFLNPRPTLIDILSFSD 521
              ENG++L LD +YTRCCHLREILPIPSTL+Q+K K APLQTLKFLNPRPTLID+LSF D
Sbjct: 347  SAENGDKLTLDKIYTRCCHLREILPIPSTLKQVKGKSAPLQTLKFLNPRPTLIDVLSFCD 406

Query: 522  FIAIVPIHNVVFDNVGLSPEMFKIVISSLVKSITLERLSMRNVVFDERGWKLLCKFLMRN 581
            FIAIVPIHNVVFDNV L+ EM K VISSLV S  +E++  RNVVF+   W LLCKFLMR 
Sbjct: 407  FIAIVPIHNVVFDNVSLTSEMLKNVISSLVTSKVIEKVGFRNVVFNSDTWILLCKFLMRT 466

Query: 582  KSLTKLDISQTKIRHDLDLKLHRSQMDWSLFIDVLHKRQGKPLEELLLNGVSFANNLHTF 641
             SL KLDISQTKI+ DL+  L+R+ MDW LFIDVL +R G+PLEELL+NGV    +  +F
Sbjct: 467  SSLLKLDISQTKIKPDLEKNLYRANMDWDLFIDVLQRRSGRPLEELLINGVKI-ESFDSF 525

Query: 642  ENMINAFS--STKNEFSRKRKLGLAQSQIASSEQLEILFRWMSENDIIGVDLAFNDFENL 699
             +++N F+  ST+N     ++LG+AQS++ S++ L+ L  WMS+  I GVD+AFNDF  L
Sbjct: 526  VSLLNTFAAGSTQN----GKRLGIAQSEL-SADHLKFLMSWMSDFKIQGVDMAFNDFSEL 580

Query: 700  TKPIIKELSQRSFDSLQYFTLNSTNIQSVQEAALIIRELSKLPKLYFLDLSGLPSLFPAI 759
             +P++ +LS   F  LQYFTLN+TNI +  +AAL++R LS+LP LYFLDLS LP +FP I
Sbjct: 581  VRPLVGKLSSLPFQHLQYFTLNNTNIPTAYDAALLLRALSRLPNLYFLDLSNLPQVFPEI 640

Query: 760  FPYLNKYLPRFPSLKRLHFDSNEWTYKDISLVTQILPKCKELLHVSMMNQPQESWAMSAA 819
            FPYLNKYLPR  +LKRLH DSNE+T +++ ++T +L KC ELLH+S+MN PQES+     
Sbjct: 641  FPYLNKYLPRMANLKRLHLDSNEFTSREVVMITSVLSKCNELLHLSLMNIPQESFTTGMC 700

Query: 820  VFLYDCIKNSDKLINLDFNYENIPEEINSRIAIALVRNAQKSIDSNWXXXXXXXXXXXXX 879
              LYDC++   KL NLD  Y  IPEEI+SRIAI L+R  Q+    ++             
Sbjct: 701  ANLYDCVRQCSKLTNLDVTYAYIPEEISSRIAICLMRRMQR----DFELDDLTNQDDLLF 756

Query: 880  XGELISETAGNILDKLNDSAKLQEDSTKRYLLKRYWEKIHTIHANVQKTIDSMFEQRISK 939
             G L+SETA N+L+KLN+   L+ D T+RYLLK+YWEK + +H NVQ TID MFE+R + 
Sbjct: 757  DGTLLSETAENVLEKLNNFEDLETDVTRRYLLKKYWEKFNRVHDNVQSTIDQMFEKRSAG 816

Query: 940  ELSLQSKENLLRLIFMENTLGNILEYLSTNPYIQELNYAXXXXXXXXXXXXERPVLKHVD 999
            EL+LQSKENLLRL+F+EN L +IL+ L + P + ++                 P  +   
Sbjct: 817  ELNLQSKENLLRLLFLENNLSHILDVLKSYPQVADV-------------AGIEPNARSAG 863

Query: 1000 SERIMYAKPLVDPIDQDIDQELEHEQDSNSAKPHLMATDSGRTIDVTTGRPILTKTSSQR 1059
            S+ ++          + I  E E   +++  +PHLMATDSGRTIDVTTG P+L KT S  
Sbjct: 864  SDHLL----------KGITSEAE---NNSHVRPHLMATDSGRTIDVTTGTPVLVKTPSHV 910

Query: 1060 SIFGKKQEEEEGELHKWGFFVQQQRSIYPENTPMSKYXXXXXHKHAQRKEPQLSQIVEKP 1119
            S+ GK+QEEEEGE HKWGFFVQQQ SIYP++     +      +  +++    +   E P
Sbjct: 911  SLVGKRQEEEEGEFHKWGFFVQQQNSIYPDH-----HSRNTNDEPPEKRPGSAASSTESP 965

Query: 1120 R--EQVQTSQKTGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIGKIPSGTELREAIIKA 1177
            +  +    SQ   Q                             I KIPSG ELREA+++A
Sbjct: 966  KSSQPSAISQTASQ-----------------------AAAHALISKIPSGAELREAVMRA 1002

Query: 1178 KGINSIEDLIDNVNCQQVKLDNIYGIQVEP 1207
            KGI+SIE+LI+NVN  +V LDNIYG+ + P
Sbjct: 1003 KGIDSIEELIENVNGNRVTLDNIYGVPLHP 1032

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 22/26 (84%)

Query: 1  MPNSLDLDVEVDWLYKGKKKVRANRR 26
          MP SLD+DV+VDWLYKGK+K +  R+
Sbjct: 1  MPKSLDVDVDVDWLYKGKRKAKQPRK 26

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 21/25 (84%)

Query: 120 SAVLRRSSSLGEKPKKSLFGSLFNR 144
           +A  +RSSS+ EKPKKS+FG+LF R
Sbjct: 69  AASPKRSSSVTEKPKKSIFGTLFRR 93

>ACR113W [1160] [Homologous to ScYOR227W - SH; ScYPL137C - SH]
            complement(550378..553686) [3309 bp, 1102 aa]
          Length = 1102

 Score =  885 bits (2287), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/1004 (49%), Positives = 628/1004 (62%), Gaps = 132/1004 (13%)

Query: 208  GIPIPINISQFASHRQQISQFLKEPNSPEVKDMAPIQHDRVVLNKNPNK---SKHPLP-I 263
            GIPI             ++++L EP+SPEV+D API       N  P +      P+P +
Sbjct: 160  GIPI-------GRATDGMARYLNEPSSPEVRDAAPI-------NDRPRRMEPGALPVPSL 205

Query: 264  KELTEINLKRVTFAVDEFGMDPPQQIPSRKPKLGNVLVPNDMISDIPSISQGITTTAQPS 323
            + L+ + L+RV FAVD+F  DPPQQIPSR+P+ GNVL+P++++ ++P+ISQGI+      
Sbjct: 206  QLLSGVQLRRVAFAVDKFSTDPPQQIPSRRPRRGNVLIPDEILGEVPTISQGISNPEGIC 265

Query: 324  SHGNDQHGALPASAYTKDSKEYQLALENHKKCLKESEKHQQEAHYAAQRIASEVAGFKLK 383
                 Q         TKDSKEY++ALEN++K LKES+KHQQEAH AA R A+EVA FK K
Sbjct: 266  GQKESQ--------LTKDSKEYKIALENYRKALKESKKHQQEAHMAALRTANEVAAFKYK 317

Query: 384  PSTSTDLKPSANGTVPKSGAATDDEANAEAGVVADEKIKSLEIDKPIHMHEHHFKEXXXX 443
             S S          VP+  AA DD A            K LEIDKP   +E  F      
Sbjct: 318  QSHSQ------RELVPE--AAVDDRA------------KHLEIDKPTQANETSFD----- 352

Query: 444  XXXXXXEHGANPSSTSGTQDENGNELMLDVVYTRCCHLREILPIPSTLRQLKEKKAPLQT 503
                           +   DE+G EL LD +YTRCCHLREILPIPSTL+Q+K K APL T
Sbjct: 353  ------------GEDTECGDESGKELTLDQIYTRCCHLREILPIPSTLKQVKNKTAPLHT 400

Query: 504  LKFLNPRPTLIDILSFSDFIAIVPIHNVVFDNVGLSPEMFKIVISSLVKSITLERLSMRN 563
            LKFLNP+PTLID+LSF DFIA+VPIHNVVFDNV L+PEMFKI+I+SLV S  LERLS+RN
Sbjct: 401  LKFLNPKPTLIDLLSFCDFIAVVPIHNVVFDNVNLTPEMFKIMITSLVNSTALERLSIRN 460

Query: 564  VVFDERGWKLLCKFLMRNKSLTKLDISQTKIRHDLDLKLHRSQMDWSLFIDVLHKRQGKP 623
            VV D   W  LCKF++ N+SL KLDISQTK+R DL   L+RS M+W LFI+VL +RQ  P
Sbjct: 461  VVTDADCWAALCKFILSNRSLIKLDISQTKVRQDLARTLYRSNMNWPLFIEVLQRRQHAP 520

Query: 624  LEELLLNGVSFANNLHTFENMINAFSSTKNEFSRKRKLGLAQSQIASSEQLEILFRWMSE 683
            LEELLLNG+ F  +L  F  +++AF+      + K++LG+A S     E L++LF W S 
Sbjct: 521  LEELLLNGIQFF-DLSIFNGLLHAFTLRP---ASKKRLGVAHS-FLKEEHLKLLFDWAST 575

Query: 684  NDIIGVDLAFNDFENLTKPIIKELSQRSFDSLQYFTLNSTNIQSVQEAALIIRELSKLPK 743
             ++ G+DLAFN+  +L KP++ +L+  +FD L YFTLNST +    +AAL +R LSKLP 
Sbjct: 576  YNVQGIDLAFNNLTDLVKPMVSKLTTMNFDHLHYFTLNSTAL-GFCDAALCLRALSKLPN 634

Query: 744  LYFLDLSGLPSLFPAIFPYLNKYLPRFPSLKRLHFDSNEWTYKDISLVTQILPKCKELLH 803
            LYFLDLS LP++FP IFP+LNKYLPRFP LKRLH DSN++    ISL++QIL KCKELLH
Sbjct: 635  LYFLDLSSLPAIFPEIFPFLNKYLPRFPFLKRLHLDSNDFMMDHISLLSQILQKCKELLH 694

Query: 804  VSMMNQPQESWAMSAAVFLYDCIKNSDKLINLDFNYENIPEEINSRIAIALVRNAQKSID 863
            +SM+ QP+ S+ MSA   LYD + NS KL NLD +YE IPEEI+SRIA+ L+RNAQKS++
Sbjct: 695  LSMLYQPESSYGMSACAALYDFVANSPKLKNLDVDYEYIPEEISSRIAVCLIRNAQKSLN 754

Query: 864  SNWXXXXXXXXXXXXXXGELISETAGNILDKLNDSA-KLQEDSTKRYLLKRYWEKIHTIH 922
             ++              GELI++TAG IL KL  S+ K  +DS++RYLLK+YW+KI+ +H
Sbjct: 755  EDFELDELTSQDDLLFDGELITKTAGGILSKLGTSSEKSNDDSSRRYLLKKYWQKINRVH 814

Query: 923  ANVQKTIDSMFEQRISKELSLQSKENLLRLIFMENTLGNILEYLSTNPYIQELNYAXXXX 982
             NVQ TID +FE+R   EL+LQ KENLLRL+F+ENTL  ILE L+ +  +  L       
Sbjct: 815  TNVQSTIDDLFEKRSKDELTLQGKENLLRLLFVENTLSKILEILADSQEVASL------- 867

Query: 983  XXXXXXXXERPVLKHVDSERIMYAKPLVDPIDQDIDQELEHEQDSNSA---KPHLMATDS 1039
                      P L+ VDS  ++       P  +  D  L+ +  S S    +PH MATDS
Sbjct: 868  LDDNPEGISAPNLEAVDSSTLLM------PATRLEDGYLDTQGISASTQVDRPHFMATDS 921

Query: 1040 GRTIDVTTGRPILTKTSSQRSIFGKKQEEEEGELHKWGFFVQQQRSIYPENTPMSKYXXX 1099
            GRTIDVTTGRP++ + SSQ SI  KKQEEEEGELHKWG+FV Q+RS  P           
Sbjct: 922  GRTIDVTTGRPVVLRQSSQTSIVCKKQEEEEGELHKWGYFVAQKRSGLP----------- 970

Query: 1100 XXHKHAQRKEPQLSQIVEKPREQVQTSQKTGQXXXXXXXXXXXXXXXXXXXXXXXXXXXX 1159
                        L Q V +   Q Q SQ                                
Sbjct: 971  ------------LPQYVSEHPAQSQPSQADN-----------------------ATDMRV 995

Query: 1160 XIGKIPSGTELREAIIKAKGINSIEDLIDNVNCQQVKLDNIYGI 1203
             I KIPSG EL+ AIIKAKGI S+EDLIDNVN  +V LDNIYGI
Sbjct: 996  IISKIPSGAELKAAIIKAKGIASMEDLIDNVNHNRVHLDNIYGI 1039

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 53/143 (37%), Gaps = 38/143 (26%)

Query: 3   NSLDLDVEVDWLYKGKKKVRANRRLDXXXXXXXXXXXXXXXXXXXXXXXXXXXGVXXXXX 62
           +SLD DV+V WLY+GKK+ +  R+                             G      
Sbjct: 19  SSLDFDVDVAWLYRGKKRGK-QRKAGEDGTRGRASSVSNAELSRQADSGQAGTG------ 71

Query: 63  XXXXXXXXXXNSASSEPAQTPTPAAKTRNRXXXXXXXXXXXXXXNSPNTSGRSLKPSSAV 122
                      SA++EPA  P                            SG         
Sbjct: 72  -SASGSERSAQSAATEPAAVPE-------------------------RQSG-----GIGF 100

Query: 123 LRRSSSLGEKPKKSLFGSLFNRK 145
           L+RS+S+GE+PKKSLFGSLF+R+
Sbjct: 101 LKRSNSVGERPKKSLFGSLFSRR 123

>YPL137C (YPL137C) [5309] chr16 complement(292816..296646) Protein of
            unknown function, has low similarity to a region of S.
            cerevisiae Mhp1p, which is a microtubule-interacting
            protein that functions in stabilization of microtubules
            [3831 bp, 1276 aa]
          Length = 1276

 Score =  811 bits (2094), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/1036 (45%), Positives = 630/1036 (60%), Gaps = 109/1036 (10%)

Query: 261  LPIKELTEINLKRVTFAVDEFGMDPPQQIPSRKPKLGNVLVPNDMISDIPSISQGITTTA 320
            L +K+L+ ++LKRV+FAVD+F  DPPQQ+PSR PK GN+L+P+DMIS++PSIS GI+++ 
Sbjct: 272  LAVKDLSTVSLKRVSFAVDKFESDPPQQLPSRTPKKGNILIPDDMISEVPSISVGISSSN 331

Query: 321  QPSSHGNDQHGALPASAYTKDSKEYQLALENHKKCLKESEKHQQEAHYAAQRIASEVAGF 380
            Q +   N     +    YTK SKEY LALEN K  L+E+ KHQQEAH+AA RIA EVA F
Sbjct: 332  QSAKSTNSN---IKGPLYTKKSKEYILALENQKLALREAAKHQQEAHFAANRIAFEVANF 388

Query: 381  KLKPSTSTDL-KPSANGTVPK-----SGAATDDEANAEAGVVADEKIKSLEIDKPIHMHE 434
            K        L + S+ GT+ K     S    + +   E   +A E +    IDKPIHMHE
Sbjct: 389  KTASDAGGKLTEKSSEGTITKQREEVSPPNVEADRELENNKLA-ENLSKAGIDKPIHMHE 447

Query: 435  HHFKEXXXXXXXXXXEHGANPSSTSGTQDENGNELMLDVVYTRCCHLREILPIPSTLRQL 494
            H+FKE                    G   EN NE+ LDV+YTRCCHLREILPIPSTLRQ+
Sbjct: 448  HYFKEPDQDKYQ------------DGHSIEN-NEVTLDVIYTRCCHLREILPIPSTLRQV 494

Query: 495  KEKKAPLQTLKFLNPRPTLIDILSFSDFIAIVPIHNVVFDNVGLSPEMFKIVISSLVKSI 554
            K+K APLQ LKFLNP+PTLIDILSF DFI I PIH +VFDNV L+ +MF+I+IS+LV S 
Sbjct: 495  KDKTAPLQILKFLNPKPTLIDILSFCDFITIAPIHTIVFDNVALNQDMFRIIISALVNST 554

Query: 555  TLERLSMRNVVFDERGWKLLCKFLMRNKSLTKLDISQTKIRHDLDLKLHRSQMDWSLFID 614
             L++LS+RNV  D+ GWKLLCKFL+ NKSL KLDISQTKI+ DL   L+R  MDW+LF D
Sbjct: 555  VLDKLSLRNVRIDQDGWKLLCKFLLLNKSLNKLDISQTKIKSDLAESLYRHNMDWNLFTD 614

Query: 615  VLHKRQGKPLEELLLNGVSFANNLHT-FENMINAFSSTKNEFSRKRKLGLAQSQIA--SS 671
            VL +R  KP+EELL NG+ F+   ++ F  ++ +F++ KN      +LGLA +  +  S 
Sbjct: 615  VLSQRSHKPIEELLFNGIQFSKIPYSCFARLLTSFATQKNFPESGIRLGLAGATTSNISQ 674

Query: 672  EQLEILFRWMSENDIIGVDLAFNDFENLTKPIIKELSQRSFDSLQYFTLNSTNIQSVQEA 731
            + L+ +F WMS+ ++ GVDLAFND   + KP++ +LS  S+D+L+YF LNSTNI +  + 
Sbjct: 675  DCLKFIFNWMSQYNVQGVDLAFNDLSTMIKPMVGKLSALSYDNLRYFILNSTNISTSYDL 734

Query: 732  ALIIRELSKLPKLYFLDLSGLPSLFPAIFPYLNKYLPRFPSLKRLHFDSNEWTYKDISLV 791
            AL+++ LSKLP L FLDLS L   FP I PY+ KYLPRFP+LKR+H DSN  T K++++V
Sbjct: 735  ALLLKYLSKLPNLIFLDLSNLSQCFPDILPYMYKYLPRFPNLKRIHLDSNNLTLKELAVV 794

Query: 792  TQILPKCKELLHVSMMNQPQESWAM--------------------------------SAA 819
              IL KCK L HVSM NQ  E++ +                                S +
Sbjct: 795  CNILIKCKSLSHVSMTNQNVENFYLMNGTDSPVQQTNTDGDLDSSSTLDVKGQFAKNSFS 854

Query: 820  VFLYDCIKNSDKLINLDFNYENIPEEINSRIAIALVRNAQKSIDSNWXXXXXXXXXXXXX 879
              LY   ++S  LI LDF+Y+ I EEI SRIA+ L+RN ++++DS +             
Sbjct: 855  STLYAFARDSPNLIGLDFDYDLISEEIQSRIALCLMRNMKRTMDSTFQLDELDSQDDLLF 914

Query: 880  XGELISETAGNILDKLN----DSAKLQEDSTKRYLLKRYWEKIHTIHANVQKTIDSMFEQ 935
             G L++ TA ++L+KLN     S K+++D+TKRYLLK+Y EK H +H NVQ TID+MFE+
Sbjct: 915  DGSLVTMTAESVLEKLNLLSDKSTKVKKDTTKRYLLKKYIEKFHILHHNVQHTIDTMFEK 974

Query: 936  RISKELSLQSKENLLRLIFMENTLGNILEYLSTNPYIQELNYAXXXXXXXXXXXXER--- 992
            R S EL LQ KENL+RL+ +E  L NILE  S NP + ++  +            E    
Sbjct: 975  RKSGELPLQEKENLVRLLLLEQNLCNILELFSHNPNLNDVLGSSRDDSKESVDSSEDSKL 1034

Query: 993  PVLKHVDSERIMYAKPLVDPIDQDIDQELEHEQDSNSAKPHLMATDSGRTIDVTTGRPIL 1052
            P LKHV+S    Y  P         +++++ E D  +A+PHLMATDSG+TIDV TG+P++
Sbjct: 1035 PALKHVESG---YHVP---------EEKIQPENDVITARPHLMATDSGKTIDVFTGKPLV 1082

Query: 1053 TK-TSSQRSIFGKKQEEEEGELHKWGFFVQQQRSIYP--ENTPMSKYXXXXXHKHAQRKE 1109
             K TSS  S+  KKQEEEEGELHKWGFFVQQQRS+YP  E+T  + +        A    
Sbjct: 1083 FKHTSSSTSVGCKKQEEEEGELHKWGFFVQQQRSLYPENESTRQTPF--------ASGDT 1134

Query: 1110 PQLSQIVEKPREQVQTSQKTGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIGKIPSGTE 1169
            P  ++   K       S    +                             + KIPSG  
Sbjct: 1135 PINTETAGKSTSSPSVSTSNNETATTSLFSPANPKI---------------LPKIPSGAV 1179

Query: 1170 LREAIIKAKGINSIEDLIDNVNCQQVKLDNIYGIQVEPPADAKPLVLSPGGRPDGNVSHD 1229
            LR AI+KAKGI+SI+DLI NVN   ++L+NIYG  ++  A       +PG   D +  + 
Sbjct: 1180 LRSAIMKAKGIDSIDDLIQNVNSNNIELENIYGESIQNSAS----TFTPGVDSDVSAPNT 1235

Query: 1230 ERHSAQENGFPSESED 1245
            ++ S +    P+ S D
Sbjct: 1236 DKGSVET--LPAVSTD 1249

 Score = 35.0 bits (79), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 22/26 (84%), Gaps = 1/26 (3%)

Query: 118 PSSAVLRRSSSL-GEKPKKSLFGSLF 142
           PS+A L+RS+S  GEK K+S+FGSLF
Sbjct: 179 PSNATLKRSNSTSGEKTKRSIFGSLF 204

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 17/26 (65%)

Query: 1  MPNSLDLDVEVDWLYKGKKKVRANRR 26
          M  + + DV VDWLYKGK + + N +
Sbjct: 1  MITNTEFDVPVDWLYKGKSRRKTNTK 26

>Scas_640.21
          Length = 1199

 Score =  798 bits (2060), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/1075 (44%), Positives = 635/1075 (59%), Gaps = 158/1075 (14%)

Query: 233  NSPEVKDMA--PIQHDRVVLNKNPNKSKHPLPIKELTEINLKRVTFAVDEFGMDPPQQIP 290
            NSP VK +A  P +    + NK+  +      +  ++ I+L+RV F+VD+F  DPPQQ+P
Sbjct: 214  NSPLVKKLALTPEESPITIFNKSSKEDVDDALLNTISNISLRRVKFSVDKFTDDPPQQLP 273

Query: 291  SRKPKLGNVLVPNDMISDIPSISQGITTTAQPSSHG--NDQHGALPASAYTKDSKEYQLA 348
            SRKPKLG+VL+PNDMIS++P IS GITTT   S      +QH       YTKDSKEY++A
Sbjct: 274  SRKPKLGDVLIPNDMISEVPPISVGITTTDNNSGSTLITNQH-----PMYTKDSKEYKIA 328

Query: 349  LENHKKCLKESEKHQQEAHYAAQRIASEV---AGFKLKPSTSTDLKPSANGTVPKSGAAT 405
            LE +KK LKE E+HQ+EA  AA+RIA EV   +  +    TS+  K ++N +   S   +
Sbjct: 329  LERYKKSLKEGERHQEEAQKAAERIAREVYSSSRHRANSLTSSLTKTTSNTS---SNPLS 385

Query: 406  DDEANAEAGVVADEKIKSLEIDKPIHMHEHHFKEXXXXXXXXXXEHGANPSSTSGTQDEN 465
               +N E     D K K+L IDKPIHMH+++F              G + S+       N
Sbjct: 386  KQNSN-ELDTKVDVKAKTLSIDKPIHMHQNNF--------------GDDFST------HN 424

Query: 466  GNELMLDVVYTRCCHLREILPIPSTLRQLKEKKAPLQTLKFLNPRPTLIDILSFSDFIAI 525
             NE+ LDV+YTRCCHLREILPIPSTLRQ+K K APLQTLKFLNPRPTLIDILSF DFI+I
Sbjct: 425  TNEVTLDVIYTRCCHLREILPIPSTLRQVKGKTAPLQTLKFLNPRPTLIDILSFCDFISI 484

Query: 526  VPIHNVVFDNVGLSPEMFKIVISSLVKSITLERLSMRNVVFDERGWKLLCKFLMRNKSLT 585
            +PIH +VFDNV L+ EMF+IV+SS+V S  LE+L +RNV  DE  WK+ CKFL+ NKSL 
Sbjct: 485  IPIHTIVFDNVALTSEMFRIVLSSIVNSNVLEKLGLRNVTIDEEDWKIFCKFLIDNKSLI 544

Query: 586  KLDISQTKIRHDLDLKLHRSQMDWSLFIDVLHKRQGKPLEELLLNGVSFAN-NLHTFENM 644
            KLDISQTKIR +  +  +R  MDWSLF  VL +R+GKPLEELLLNGV F    L  F+++
Sbjct: 545  KLDISQTKIRPESSISCYRENMDWSLFCQVLKRRKGKPLEELLLNGVKFNRIPLGIFQDL 604

Query: 645  INAFSSTKNEFSRKRKLGLAQSQIASSEQLEILFRWMSENDIIGVDLAFNDFENLTKPII 704
            ++ F+  K       +LGLA S I S   L+ILF WMS+  + GVDLAFN+  +L KPII
Sbjct: 605  LHVFA--KMNPKTNVRLGLAVSDI-SLGCLKILFPWMSKYSVEGVDLAFNNLADLLKPII 661

Query: 705  KELSQRSFDSLQYFTLNSTNIQSVQEAALIIRELSKLPKLYFLDLSGLPSLFPAIFPYLN 764
            + LS   F  L+YFTLNSTNI SV + AL+I+ LSKLP L FLDLS LP LFP I P L+
Sbjct: 662  ESLSTLDFKHLKYFTLNSTNISSVDDMALLIKYLSKLPNLQFLDLSNLPQLFPNIIPDLH 721

Query: 765  KYLPRFPSLKRLHFDSNEWTYKDISLVTQILPKCKELLHVSMMNQPQES----------- 813
            KYLP+FPSLKR++F++N+ TY++IS++  IL KCK + HVS+++Q   S           
Sbjct: 722  KYLPQFPSLKRIYFENNDLTYREISMICNILQKCKLISHVSLLSQHPPSTLENENHIDTE 781

Query: 814  ----------------WAMSAAVFLYDCIKNSDKLINLDFNYENIPEEINSRIAIALVRN 857
                            WA      LY   ++S  L++LD +Y+ + EE+ SRIA+ L+RN
Sbjct: 782  LGKDDSNKDLFNRHTLWAT-----LYSLARSSPNLVSLDIDYDELSEEMRSRIALCLMRN 836

Query: 858  AQKSIDSNWXXXXXXXXXXXXXXGELISETAGNILDKLNDSAKLQEDSTKRYLLKRYWEK 917
             Q+++DS++              G LISETA  +L+KLND +K   D T++YLLK+Y EK
Sbjct: 837  MQRTMDSSFELDEALLQDNLLFDGSLISETADTVLNKLNDESKDDIDPTRKYLLKKYLEK 896

Query: 918  IHTIHANVQKTIDSMFEQRISKELSLQSKENLLRLIFMENTLGNILEYLSTNPYIQE--- 974
            +  +H +VQ+TIDSMFE+R S EL L+ KENL+RL+ +E  L NILE  S  P++ +   
Sbjct: 897  LENLHNSVQQTIDSMFEKRKSGELPLEEKENLVRLLLLEKNLSNILEIFSKIPFLSDVFN 956

Query: 975  -------LNYAXXXXXXXXXXXXERPVLKHVDSERIMYAKPLVDPIDQDIDQELEHEQDS 1027
                   +                RP LKH+DS R+++         Q I    E     
Sbjct: 957  STLASSPIQTNQTTAITDDEVPVRRPQLKHLDSARLLH---------QAIVPSSE----- 1002

Query: 1028 NSAKPHLMATDSGRTIDVTTGRPILTKTSSQRSIFGKKQEEEEGELHKWGFFV---QQQR 1084
            N+  PH+MAT++G  ID  TG+P+L K+SS  S+F KKQEEEEGELHKWG FV   QQQ 
Sbjct: 1003 NTGDPHIMATEAGSVIDTYTGKPVLHKSSSNTSLFSKKQEEEEGELHKWGVFVQQKQQQE 1062

Query: 1085 SIYP---ENTPMSKYXXXXXHKHAQRKEPQLSQIVEKPREQVQTSQKTGQXXXXXXXXXX 1141
            +  P    ++ +SK           R  P   Q+ +K                       
Sbjct: 1063 NAVPGSESSSNLSKESISSQASPTHRSSPTSLQLEDK----------------------- 1099

Query: 1142 XXXXXXXXXXXXXXXXXXXIGKIPSGTELREAIIKAKGINSIEDLIDNVNCQQVKLDNIY 1201
                               + KIPSG +LREAII AKGI SI+DLI NVN ++V++++I 
Sbjct: 1100 -------------TATPKILPKIPSGPQLREAIINAKGIASIDDLIQNVNEKRVEVESIN 1146

Query: 1202 GIQVEPPADAKPLVLSPGGRPDGNVSHDERHSAQENGFPSESEDSYVEDETTTEQ 1256
            G  V  P D          + D N+S    +++  N           EDET TE+
Sbjct: 1147 GDFV--PIDC-------NKKNDTNISRQPTNTSSAN-----------EDETVTEK 1181

 Score = 37.7 bits (86), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 21/26 (80%)

Query: 120 SAVLRRSSSLGEKPKKSLFGSLFNRK 145
           S+ L+RS SL EKPKKSL GS+F R+
Sbjct: 154 SSPLKRSVSLSEKPKKSLLGSIFGRR 179

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 16/20 (80%)

Query: 4  SLDLDVEVDWLYKGKKKVRA 23
          S D+DV +DWLYKGK+K R 
Sbjct: 26 SSDIDVPLDWLYKGKRKSRT 45

>Scas_700.38
          Length = 1239

 Score =  753 bits (1945), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/934 (46%), Positives = 574/934 (61%), Gaps = 135/934 (14%)

Query: 225  ISQFLKEPNSPEVK---------------------DMAPIQHDRVVLNKNPNKSKHPLPI 263
            IS+ LKEPNSP+V                                  N+    S+  L I
Sbjct: 199  ISETLKEPNSPDVNMNSQSTIISTPLGDSTASSPQVFQSSSSSSTSSNEKLLHSEEKLAI 258

Query: 264  KELTEINLKRVTFAVDEFGMDPPQQIPSRKPKLGNVLVPNDMISDIPSISQGITTTAQPS 323
            ++L+ I LKRVTFAVD+F  DP QQ+PSR PK GNVLVP+DMIS++PSIS GI+     S
Sbjct: 259  QKLSSIKLKRVTFAVDKFEADPAQQLPSRTPKQGNVLVPDDMISEVPSISMGISANTPQS 318

Query: 324  SHGNDQHGALPASAYTKDSKEYQLALENHKKCLKESEKHQQEAHYAAQRIASEVAGFKLK 383
            +            +++K+SKEY+LALEN +  +KE+EKHQ+EAH+AA+RIA EVA FK  
Sbjct: 319  TK---------TPSFSKNSKEYRLALENQRFAIKEAEKHQKEAHFAAKRIADEVANFK-- 367

Query: 384  PSTSTDLKPSANGTVPKSGAATDDEANAEAGVVADEKIKSLEIDKPIHMHEHHFKEXXXX 443
             +TS++ K S   T+  S  A D E N        EKI +  IDKPIH+HEHHF+     
Sbjct: 368  -ATSSEQKSSIPVTLLPSTTAADSELN--------EKINN--IDKPIHVHEHHFE----- 411

Query: 444  XXXXXXEHGANPSSTSGTQDENGNELMLDVVYTRCCHLREILPIPSTLRQLKEKKAPLQT 503
                              Q+ +  E+ LD+VYTRCCHLREILPIPSTLRQ+K K APLQT
Sbjct: 412  ------------------QEISTGEVTLDIVYTRCCHLREILPIPSTLRQVKGKTAPLQT 453

Query: 504  LKFLNPRPTLIDILSFSDFIAIVPIHNVVFDNVGLSPEMFKIVISSLVKSITLERLSMRN 563
            LKFLNP+PTLIDILSF DFI+IVPI+ ++FDNV L+ EMFKI+ISS+VKS  LE+L +RN
Sbjct: 454  LKFLNPKPTLIDILSFCDFISIVPINTIIFDNVSLTSEMFKIIISSVVKSTVLEKLGLRN 513

Query: 564  VVFDERGWKLLCKFLMRNKSLTKLDISQTKIR---HDLDLKLHRSQMDWSLFIDVLHKRQ 620
            V+ D+  WKLLCKF++ NKS+ KLDISQTKIR   +DL+  ++R  MDW LF +VL  R 
Sbjct: 514  VIIDKENWKLLCKFMLNNKSIVKLDISQTKIRTESNDLE-NIYRHNMDWELFANVLQYRL 572

Query: 621  GKPLEELLLNGVSFAN-NLHTFENMINAFSSTKNEFSRKRKLGLAQSQIASSEQLEILFR 679
            GKPLEE+LLNG+ F N  +H F++++++ SS +N  S   ++GLA S I S + L+ +  
Sbjct: 573  GKPLEEILLNGIKFNNIPVHIFKDLLHSISSQRNATSVGIRVGLATSDI-SLDCLKAVMN 631

Query: 680  WMSENDIIGVDLAFNDFENLTKPIIKELSQRSFDSLQYFTLNSTNIQSVQEAALIIRELS 739
            W+S N++ GVDL+FND     KP++ +LS  +F +L+YFTLN+TNI S  + ALI++ L 
Sbjct: 632  WISANNVQGVDLSFNDLAAFVKPLVGKLSSLTFPNLEYFTLNNTNISSSYDVALILKYLC 691

Query: 740  KLPKLYFLDLSGLPSLFPAIFPYLNKYLPRFPSLKRLHFDSNEWTYKDISLVTQILPKCK 799
            KLP L FLDLS LP ++P + PY+ KYLPRFP LKR+HFD+N  ++K++++V  IL KC 
Sbjct: 692  KLPNLKFLDLSNLPQIYPDVLPYMYKYLPRFPQLKRIHFDNNNLSFKELTVVCNILLKCH 751

Query: 800  ELLHVSMMNQPQESWAMSAA--------------------VFLYDCIKNSDKLINLDFNY 839
             L HVSM++Q Q   A ++                       LY   K+S  L+ LD +Y
Sbjct: 752  SLAHVSMLSQLQSPTAAASDSSTNVVGPESQSQFARNNLWATLYALAKDSPNLVGLDIDY 811

Query: 840  ENIPEEINSRIAIALVRNAQKSIDSNWXXXXXXXXXXXXXXGELISETAGNILDKLN--- 896
            + IPEEI  RIA+ L+RN  +++DS +              G LI+ETA ++L KLN   
Sbjct: 812  DRIPEEIQQRIALCLMRNMNRAMDSTFQLDELASQDDLLFDGTLITETAEDVLTKLNKLN 871

Query: 897  ---DSAKLQEDSTKRYLLKRYWEKIHTIHANVQKTIDSMFEQRISKELSLQSKENLLRLI 953
                ++  ++D TKRYLLK+Y EK+H +H N Q  ID MFE+R S EL+LQ KENLLRL+
Sbjct: 872  ENTSASTDKKDVTKRYLLKKYLEKLHRVHFNTQHKIDCMFEKRNSGELTLQEKENLLRLL 931

Query: 954  FMENTLGNILEYL----------------STNPYIQELNYAXXXXXXXXXXXXERPVLKH 997
             +E  L N++E L                S  P  Q+                   VLKH
Sbjct: 932  LLEKNLSNLMEILGALPQVSSVLGSNKEDSMQPVYQQSQEGSTVTSGTSSESVSSVVLKH 991

Query: 998  VDSERIMYAKPLVDPIDQDIDQELEHEQDSNSAKPHLMATDSGRTIDVTTGRPIL-TKTS 1056
            V+S      +P+V P +                +PHLMATDSGRT+DV TG+P+L  + S
Sbjct: 992  VES-----VEPIVVPPE---------------TRPHLMATDSGRTVDVLTGKPVLFRRGS 1031

Query: 1057 SQRSIFGKKQEEEEGELHKWGFFVQQQRSIYPEN 1090
            S  S+ GKKQ EEEGELHKWG+FVQQQ SIYPEN
Sbjct: 1032 SSTSVVGKKQIEEEGELHKWGYFVQQQCSIYPEN 1065

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 39/47 (82%)

Query: 1161 IGKIPSGTELREAIIKAKGINSIEDLIDNVNCQQVKLDNIYGIQVEP 1207
            + KIPSGTELR+AIIKAKGI+SI+DLI NVN  + +L NIYG  V+P
Sbjct: 1109 VPKIPSGTELRKAIIKAKGIDSIDDLIQNVNQDEDELINIYGKSVQP 1155

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 20/23 (86%)

Query: 123 LRRSSSLGEKPKKSLFGSLFNRK 145
           ++RSSSL EKPKKSL GSLF RK
Sbjct: 147 VKRSSSLNEKPKKSLLGSLFGRK 169

>YOR227W (YOR227W) [5018] chr15 (762825..766565) Protein of unknown
            function, interacts with Glc7p [3741 bp, 1246 aa]
          Length = 1246

 Score =  748 bits (1931), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/983 (44%), Positives = 601/983 (61%), Gaps = 128/983 (13%)

Query: 263  IKELTEINLKRVTFAVDEFGMDPPQQIPSRKPKLGNVLVPNDMISDIPSISQGITTTAQP 322
            +++++++NLKRVT AV EF  DPPQQ+PSRKPK GNVL+P DMIS  P IS GIT ++  
Sbjct: 298  LQKVSKVNLKRVTIAVQEFNSDPPQQLPSRKPKRGNVLIPEDMISAPPLISLGITNSSDQ 357

Query: 323  SSHGNDQHGALPASAYTKDSKEYQLALENHKKCLKESEKHQQEAHYAAQRIASEVAGFKL 382
            SS    Q    P+  Y+KDSKEY+LALEN KK  KE+EKHQ++A+Y A+R+A EVA +K 
Sbjct: 358  SSF---QSNISPS--YSKDSKEYKLALENFKKAAKEAEKHQKDAYYVAERMAQEVANYKA 412

Query: 383  KPSTSTDLKPSANGTVPKSGAATDDEANAEAGVVADEKIKSLEIDKPIHMHEHHFKEXXX 442
            +   ++ L  + N     + +ATD E+++      D +   L IDKPI++  H F+    
Sbjct: 413  RQLKTSPLTGATNSA---ADSATDQESSS-----LDARASKLHIDKPINVGAHPFETH-- 462

Query: 443  XXXXXXXEHGANPSSTSGTQDENGN-----ELMLDVVYTRCCHLREILPIPSTLRQLKEK 497
                               QD+N       E  LDV YTRCCHLREILPIPSTLRQ+K K
Sbjct: 463  -------------------QDDNIKYSSHLEQTLDVAYTRCCHLREILPIPSTLRQVKGK 503

Query: 498  KAPLQTLKFLNPRPTLIDILSFSDFIAIVPIHNVVFDNVGLSPEMFKIVISSLVKSITLE 557
             APLQTLKFLNP+PTL+DILSF DFIAI PIHN++FDNV L+ +MFKIVI SLV S  +E
Sbjct: 504  TAPLQTLKFLNPKPTLVDILSFCDFIAITPIHNIIFDNVSLTHDMFKIVICSLVTSPVVE 563

Query: 558  RLSMRNVVFDERGWKLLCKFLMRNKSLTKLDISQTKIRHDLDLKLHRSQMDWSLFIDVLH 617
            +L +RNVV +E+ WKLLCKFL++NK+L KLDISQTK R DL+   +R QMDW LF +VL 
Sbjct: 564  KLGLRNVVINEQSWKLLCKFLLQNKTLIKLDISQTKARTDLNDSNYRDQMDWELFCEVLR 623

Query: 618  KRQGKPLEELLLNGVSFAN-NLHTFENMINAFSST--KNEFSRKRKLGLAQSQIASSEQL 674
             R+G+PLEELLLNG+ F   +   F+N++  F+    KN      +LG+A  +  S+E  
Sbjct: 624  NREGRPLEELLLNGLRFDKMSFSHFKNILLTFAQMNPKNPI----RLGMANVEF-STECF 678

Query: 675  EILFRWMSENDIIGVDLAFNDFENLTKPIIKELSQRSFDSLQYFTLNSTNIQSVQEAALI 734
            + LF WMSE ++ GVDLA+N+ E+L K +IK+L++  +  L+YFTLNSTNI SV + + I
Sbjct: 679  DFLFNWMSEYNVQGVDLAYNNLESLAKRMIKKLARLPYKHLEYFTLNSTNITSVDDMSYI 738

Query: 735  IRELSKLPKLYFLDLSGLPSLFPAIFPYLNKYLPRFPSLKRLHFDSNEWTYKDISLVTQI 794
            ++ LS+LP + FLDLS LP LFP I     KY P+FP LKR+HFD ++ + K+ +++  I
Sbjct: 739  LKYLSRLPSIKFLDLSNLPQLFPGILTSGYKYFPQFPQLKRIHFDFDDLSIKETTMLVSI 798

Query: 795  LPKCKELLHVSMMNQ---PQESWAMSAA--------------VF--------LYDCIKNS 829
            L KC+ L HVS++ Q   P  S    +               VF        LY  +++S
Sbjct: 799  LAKCETLSHVSLIGQSPMPDASKISDSTDEPDKSKDEKKEQIVFMRNTLWASLYAFVRDS 858

Query: 830  DKLINLDFNYENIPEEINSRIAIALVRNAQKSIDSNWXXXXXXXXXXXXXXGELISETAG 889
              L++LD +Y+ +P+EI SRIA+ L+ N ++ +DS++              G LI+ETA 
Sbjct: 859  HNLVSLDVDYDQVPDEIQSRIALCLMHNMKRIMDSSFKLDELTVQDDLIFDGSLITETAE 918

Query: 890  NILDKLNDSAKLQEDSTKRYLLKRYWEKIHTIHANVQKTIDSMFEQRISKELSLQSKENL 949
             +L +LND + LQ D  K+YLLK+Y+EK+  +H NVQ TIDSMFE+R S EL LQ KENL
Sbjct: 919  EVLKRLNDKSLLQNDVGKKYLLKKYFEKMEKVHHNVQNTIDSMFEKRKSGELPLQEKENL 978

Query: 950  LRLIFMENTLGNILEYLSTNPYIQEL--------NYAXXXXXXXXXXXXE--RPVLKHVD 999
            LRL+ +E  L NIL+  ++ P I ++        ++             +  RP LKH+D
Sbjct: 979  LRLLLLEKNLSNILDIFASMPNIADVVPFSKADNSFPNIGDSTVSANYNDGIRPSLKHLD 1038

Query: 1000 SERIMYAKPLVDPIDQDIDQELEHEQDSNSAKPHLMATDSGRTIDVTTGRPILTKTSSQR 1059
            S+R++               ++   ++ +S +PHLMATDSGR IDVTTG+ +L K+SS  
Sbjct: 1039 SDRLI--------------NDVSIPENDSSIRPHLMATDSGRIIDVTTGKALLFKSSSNT 1084

Query: 1060 SIFGKKQEEEEGELHKWGFFVQQQRSIYPENTPMSKYXXXXXHKHAQRKEPQLSQIVEKP 1119
            S+ GK+QEEEEGELHKWG FVQ Q S +    P S        + +    P  S    K 
Sbjct: 1085 SLAGKRQEEEEGELHKWGVFVQHQSSRHNSGLPSS----ANSSRISGSLTPDSSVAGGKK 1140

Query: 1120 REQVQTSQKTGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIGKIPSGTELREAIIKAKG 1179
             E  +TS    +                             + KIP+G ELR+AIIKAKG
Sbjct: 1141 GESSRTSGTRPK----------------------------ILPKIPTGAELRDAIIKAKG 1172

Query: 1180 INSIEDLIDNVNCQQVKLDNIYG 1202
            I+S++DLI NV  ++V L+++YG
Sbjct: 1173 IDSVDDLIKNVTSEKVGLESLYG 1195

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 11/18 (61%), Positives = 15/18 (83%)

Query: 6  DLDVEVDWLYKGKKKVRA 23
          D+DV +DWLYKGK++ R 
Sbjct: 9  DIDVPLDWLYKGKRRNRT 26

 Score = 32.0 bits (71), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 15/18 (83%)

Query: 129 LGEKPKKSLFGSLFNRKP 146
           L E+ KKSLFGSLF R+P
Sbjct: 162 LNERSKKSLFGSLFGRRP 179

>CAGL0M02607g complement(298560..302174) similar to tr|Q03016
            Saccharomyces cerevisiae YPL137c, hypothetical start
          Length = 1204

 Score =  740 bits (1910), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/1009 (43%), Positives = 600/1009 (59%), Gaps = 132/1009 (13%)

Query: 265  ELTEINLKRVTFAVDEFGMDPPQQIPSRKPKLGNVLVPNDMISDIPSISQGITTTAQPSS 324
            +LT+I+LKRV FAVD+F  DPPQQ+PSR PK GN+++P+DMIS++P+IS GIT+  Q ++
Sbjct: 260  DLTKISLKRVKFAVDKFETDPPQQLPSRTPKPGNIMIPDDMISELPAISVGITSNQQKNN 319

Query: 325  HGNDQHGALPASAYTKDSKEYQLALENHKKCLKESEKHQQEAHYAAQRIASEVAGFKLKP 384
             G           +TKDS EY+ ALE H+  LKE+EKHQQEAH+AA+RIA EV+ F    
Sbjct: 320  LG---------PQFTKDSIEYKRALEIHQIALKEAEKHQQEAHHAARRIAHEVSNF---- 366

Query: 385  STSTDLKPSANGTVPKSGAATDDEANAEAGVVAD--------EKIKSLEIDKPIHMHEHH 436
              S   + SA G +    A +D     +   V D        EK+    ID PIHMHEHH
Sbjct: 367  --SNGKQASAPGFMLNLVAQSDQSKRDQNSAVHDTDINIDLSEKLNKTGIDLPIHMHEHH 424

Query: 437  FKEXXXXXXXXXXEHGANPSSTSGTQDENGNELMLDVVYTRCCHLREILPIPSTLRQLKE 496
            F +               P ST     E   E+ LDVVYTRCCHLREILPIPSTL+Q+ +
Sbjct: 425  FDD---------------PGSTL----EGNQEITLDVVYTRCCHLREILPIPSTLKQVTD 465

Query: 497  KKAPLQTLKFLNPRPTLIDILSFSDFIAIVPIHNVVFDNVGLSPEMFKIVISSLVKSITL 556
            K APLQTLKFLNP+PTLIDILSF DFIAIVPI  +VFDNV LS EMFKIVISS+  S  L
Sbjct: 466  KTAPLQTLKFLNPKPTLIDILSFCDFIAIVPIQTIVFDNVNLSTEMFKIVISSVAYSSVL 525

Query: 557  ERLSMRNVVFDERGWKLLCKFLMRNKSLTKLDISQTKIRHDLDLKLHRSQMDWSLFIDVL 616
            E++S+RNV  ++  W+LLCKFL+ ++SL K+DISQT+I+ +   +L RS MDW LF   L
Sbjct: 526  EKISLRNVTMNKESWQLLCKFLLTSQSLNKIDISQTRIKPETGTELLRSSMDWDLFAKTL 585

Query: 617  HKRQG--KPLEELLLNGVSFAN-NLHTFENMINAFSSTKNEFSRKRKLGLAQS--QIASS 671
             KR    +PLEE+L+NGV+F N  L  F+N +  F++ K+  +   +LGLA +   I S 
Sbjct: 586  AKRAEHLRPLEEILVNGVNFDNIPLEDFQNFLITFATQKH-LTNGIRLGLANATKSICSV 644

Query: 672  EQLEILFRWMSENDIIGVDLAFNDFENLTKPIIKELSQRSFDSLQYFTLNSTNIQSVQEA 731
            +  + L  WMS  ++ GVDL FND  NL KP + +LS  ++ +L YFTLNSTNIQS  + 
Sbjct: 645  QHYKFLLEWMSNYNVQGVDLGFNDLSNLIKPTLGKLSSLTYPNLHYFTLNSTNIQSTNDM 704

Query: 732  ALIIRELSKLPKLYFLDLSGLPSLFPAIFPYLNKYLPRFPSLKRLHFDSNEWTYKDISLV 791
            AL+++ LSKLP L FLDLS LP +FP I PY+ KYLPRFP LKRLH D+   TYK++++V
Sbjct: 705  ALLLKALSKLPNLEFLDLSNLPQVFPDILPYMYKYLPRFPQLKRLHIDNENMTYKEMTVV 764

Query: 792  TQILPKCKELLHVSMMNQ-PQESWAMSA------------AVF--------LYDCIKNSD 830
              +L KC  L+HVSM++Q P  S   SA             VF        LY  +++S 
Sbjct: 765  CNLLAKCTGLIHVSMLSQKPPMSETESAENLSTNGDSNSGTVFAKNNFSATLYAFVRDSP 824

Query: 831  KLINLDFNYENIPEEINSRIAIALVRNAQKSIDSNWXXXXXXXXXXXXXXGELISETAGN 890
             L+ LD +Y +I +E++SR+A+ L+RN ++++DS++              G L++ TA +
Sbjct: 825  NLVGLDIDYSSISDEVSSRLALCLMRNMRRTMDSSFQLDELDSQDELLFDGSLVTMTAKD 884

Query: 891  ILDKLNDSAKLQ----EDSTKRYLLKRYWEKIHTIHANVQKTIDSMFEQRISKELSLQSK 946
            +L++L      Q    +D+TKRYLLK+Y +K+H IH NVQ+TID++FE+R S +L +Q K
Sbjct: 885  VLERLTQLNTKQIIEKKDATKRYLLKKYVQKLHKIHNNVQQTIDNLFEKRKSGDLPMQEK 944

Query: 947  ENLLRLIFMENTLGNILEYLSTNPYIQELNYAXXXXXXXXXXXXERPVLKHVDSERIMYA 1006
            ENL+RLI +E  L +IL+     P + E+               + P L+HV        
Sbjct: 945  ENLVRLILLEKNLVHILDIFDNMPNLSEV--LGENKIASSDSLVDHPNLRHVVE------ 996

Query: 1007 KPLVDPIDQDIDQ-ELE-HEQDSNSAKPHLMATDSGRTIDVTTGRPILTKTSSQRSIFGK 1064
                D ++++ ++ +L+ +E D+   +PHLMAT+SGRTID  TGRP+ ++ SS  S+  K
Sbjct: 997  ---TDNLNENSNERDLQVNENDNLQQRPHLMATESGRTIDTLTGRPVFSRRSSTTSLASK 1053

Query: 1065 KQEEEEGELHKWGFFVQQQRSIYPENTPMSKYXXXXXHKHAQRKEPQLSQIVEKPREQVQ 1124
            KQEEEEG+ HKWGF++QQQ+++YP+                       SQ  E       
Sbjct: 1054 KQEEEEGDFHKWGFYIQQQKALYPDGE---------------------SQYGESSAVSAS 1092

Query: 1125 TSQKTGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIGKIPSGTELREAIIKAKGINSIE 1184
            TSQ T                                 K+PSG ELR AIIKAKG++SIE
Sbjct: 1093 TSQTT--------------------LPSIDSKEKKIFTKLPSGPELRTAIIKAKGVSSIE 1132

Query: 1185 DLIDNVN---CQQVKLDNIYGIQVEPPADAKPLVLSPGGRPDGNVSHDE 1230
            +LI  +N   C    ++++Y I  +   +   +V S     D    H E
Sbjct: 1133 ELIQKINDYHC--CDIESLYNILKQNELEGNGIVTSESDLTDNEREHLE 1179

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/28 (60%), Positives = 20/28 (71%), Gaps = 1/28 (3%)

Query: 118 PSSAVLRRSSSLGEKPKK-SLFGSLFNR 144
           PS   ++RS+S   KPKK SLFGSLF R
Sbjct: 139 PSLVSVKRSASTSSKPKKTSLFGSLFGR 166

 Score = 32.3 bits (72), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 13/21 (61%), Positives = 15/21 (71%)

Query: 6  DLDVEVDWLYKGKKKVRANRR 26
          D+DV VDWLYKG K  +  RR
Sbjct: 5  DVDVPVDWLYKGSKPHKKARR 25

>CAGL0J04026g complement(376899..380495) similar to tr|Q12276
            Saccharomyces cerevisiae YOR227w or tr|Q03016
            Saccharomyces cerevisiae YPL137c, hypothetical start
          Length = 1198

 Score =  719 bits (1855), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/990 (41%), Positives = 576/990 (58%), Gaps = 118/990 (11%)

Query: 263  IKELTEINLKRVTFAVDEFGMDPPQQIPSRKPKLGNVLVPNDMISDIPSISQGITTTAQP 322
            I++L +I+LKRV+FA+D+F  +P QQ+PSRKPK+G+++VP DMIS+ P IS GITTT+  
Sbjct: 225  IEKLNKIDLKRVSFALDKFHHEPAQQLPSRKPKMGDIVVPEDMISEEPKISVGITTTS-- 282

Query: 323  SSHGNDQHGALPASAYTKDSKEYQLALENHKKCLKESEKHQQEAHYAAQRIASEVAGFKL 382
                +++  + P   Y+KDS+EY++ LEN+K+  KESE+ Q EAH  A+RIA+EV G+++
Sbjct: 283  ----DNKASSAPKRKYSKDSQEYKMVLENYKRLQKESERQQLEAHRVAERIANEVTGYRI 338

Query: 383  KPSTSTDLKPSA--NGTVPKSGAATDDEANAEAGVVADEKIKSLEIDKPIHMHEHHFKEX 440
            +  +  +   +A  N  +  S        +++  V  D ++  L IDKPIH HE  F   
Sbjct: 339  RSGSLFEAAHNAVVNKVLSPSSPTEASVIDSDPTVALDSRVAELTIDKPIHAHETFF--- 395

Query: 441  XXXXXXXXXEHGANPSSTSGTQD-----ENGNELMLDVVYTRCCHLREILPIPSTLRQLK 495
                     E     SSTS         ++ +EL LDVVYTRCCHLREILPIPSTLRQ+K
Sbjct: 396  ---------ETEGYDSSTSQVNSNPDLHQHHHELPLDVVYTRCCHLREILPIPSTLRQVK 446

Query: 496  EKKAPLQTLKFLNPRPTLIDILSFSDFIAIVPIHNVVFDNVGLSPEMFKIVISSLVKSIT 555
             K APLQTLKFLNP+PTLIDILSF DFI+I PI  VVFDNV L+ +M +IV+SSL+ S +
Sbjct: 447  GKTAPLQTLKFLNPKPTLIDILSFCDFISITPIQVVVFDNVALNSDMIQIVLSSLINSKS 506

Query: 556  LERLSMRNVVFDERGWKLLCKFLMRNKSLTKLDISQTKIRHDLDLKLHRSQMDWSLFIDV 615
            +E+L +RNVV   + W++LCKFL+ NKS+ +LD+SQTKI+ DL  + +R  M+W LF +V
Sbjct: 507  IEKLGIRNVVLSSKDWEMLCKFLLVNKSIIRLDLSQTKIKPDLPAECYRHNMNWKLFCNV 566

Query: 616  LHKRQGKPLEELLLNGVSFAN-NLHTFENMINAFSSTKNEFSRKRKLGLAQSQIASSEQL 674
            L +R G+PLEELLLNGV F   +   +++++  F+S KN    KR LG+A +   S + +
Sbjct: 567  LRERTGRPLEELLLNGVHFDEMSFDDYQDLLLTFAS-KNSSPNKR-LGMAAASF-SEKCM 623

Query: 675  EILFRWMSENDIIGVDLAFNDFENLTKPIIKELSQRSFDSLQYFTLNSTNIQSVQEAALI 734
              LF  +S+  + GVDL FN+ E     II +LS   +++L+YFTLNS++    Q    +
Sbjct: 624  SFLFDVISQFSVQGVDLGFNELEPYIHIIIDKLSTLPYNNLEYFTLNSSSFSCTQNIGSL 683

Query: 735  IRELSKLPKLYFLDLSGLPSLFPAIFPYLNKYLPRFPSLKRLHFDSNEWTYKDISLVTQI 794
            ++ LS+LP L FLD+S +P +FP++F YL KYLP FPSL+R+HFDSN  TYK   ++ +I
Sbjct: 684  LKYLSRLPNLRFLDMSNIPEMFPSVFAYLYKYLPLFPSLQRIHFDSNCLTYKQCIMLCEI 743

Query: 795  LPKCKELLHVSMMNQ--------------------PQESWAMSAAVFLYDCIKNSDKLIN 834
            L KC +L HVSM N+                     +E  A +    LY   ++   L+ 
Sbjct: 744  LQKCPKLAHVSMKNELTYPEAIKDQEKEDGSDDKSTKEFAARTLGATLYGFCRDRSTLLG 803

Query: 835  LDFNYENIPEEINSRIAIALVRNAQKSIDSNWXXXXXXXXXXXXXXGELISETAGNILDK 894
            LD +Y +I +EI SRIA+ L+ N +K+IDSN+              G++ISE A  IL +
Sbjct: 804  LDVDYGDISDEIQSRIAVTLMINMKKTIDSNFSQDEVTSQDDLLFDGKVISENAEGILHR 863

Query: 895  LNDSAKLQEDSTKRYLLKRYWEKIHTIHANVQKTIDSMFEQRISKELSLQSKENLLRLIF 954
            L  +   Q D TK YLLK++ EKI ++H  VQK ID MFE+R +  L L+ KENLLRL+ 
Sbjct: 864  LTSNLGDQSDPTKMYLLKKFVEKIESLHYEVQKKIDIMFEKRETGTLPLKEKENLLRLVL 923

Query: 955  MENTLGNILEYLSTNP-----------YIQELNYAXXXXXXXXXXXXE------RPVLKH 997
            +E  L NI++  ++              I + N+A                   RP LKH
Sbjct: 924  LEKNLSNIMQLFASTSSMKIMETPEAELIGKANFADDSNDSADEKNNSTNTSHIRPFLKH 983

Query: 998  VDSERIMYAKPLVDPIDQDIDQELEHEQDSNSAKPHLMATDSGRTIDVTTGRPILTKTSS 1057
            +DS+RI        P   D+D          S  PH MAT+SG+ +D TTG+ +L KTSS
Sbjct: 984  LDSDRIFGFASHHSPKSPDVDA---------SQIPHSMATESGKVVDATTGKALLYKTSS 1034

Query: 1058 QRSIFGKKQEEEEGELHKWGFFVQQQRSIYPENTPMSKYXXXXXHKHAQRKEPQLSQIVE 1117
              S+  KKQE EEGE HKWGFFV Q+ +  P+             K    K P +S+   
Sbjct: 1035 STSLLVKKQEHEEGEFHKWGFFVHQKGTTNPDT---------DDKKSGPEKTPNVSENTN 1085

Query: 1118 KPREQVQTSQKTGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIGKIPSGTELREAIIKA 1177
             P E+V   +                                 I  +PSG ELREAIIKA
Sbjct: 1086 AP-ERVTVPK---------------------------------IQTVPSGNELREAIIKA 1111

Query: 1178 KGINSIEDLIDNVNCQQVKLDNIYGIQVEP 1207
            KGI+SIEDLI  V+     L  IYG  ++P
Sbjct: 1112 KGIDSIEDLIKKVSKDDHGLKKIYGESLKP 1141

>Scas_690.33
          Length = 1423

 Score =  268 bits (685), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 169/521 (32%), Positives = 283/521 (54%), Gaps = 57/521 (10%)

Query: 472  DVVYTRCCHLREILPIPSTLRQLKEKKA-PLQTLKFLNPRPTLIDILSFSDFIAIVPIHN 530
            DVVYTRCCHLREILPIP+TL+QLK     P+  L+  NPRP++++I SFSDF++I P+  
Sbjct: 665  DVVYTRCCHLREILPIPATLKQLKPGSTDPIPLLQLRNPRPSMVEIWSFSDFLSIAPVSC 724

Query: 531  VVFDNVGLSPEMFKIVISSLVKSITLERLSMRNVVFDERGWKLLCKFLMRNKSLTKLDIS 590
            +  D V L+ +M K++++SL     LE++S+RN   D+ GWKLLC F+ +++SL  +D++
Sbjct: 725  LSLDGVSLTVDMLKVLLASLSAKRNLEKISLRNTPLDDEGWKLLCYFISKSRSLVSIDLT 784

Query: 591  QTK------------------IRHDLDLKLHRSQMDWSLFIDVLHKRQGKPLEELLLNGV 632
                                 IR + DL  +R++ +W+L    +  + G  LEEL+++GV
Sbjct: 785  MVPHIKTNVQKPSKSSLKSNIIRMECDLD-NRTKRNWNLLAGSIAMKGG--LEELVVSGV 841

Query: 633  SFANNLHTFENMIN-AFSSTKNEFSRKRKLGLAQSQIASSEQLEILFRWMSENDIIGVDL 691
              +  L+ F+N I  A  ST+       +LGLA + + S EQ +IL +W+ ++ + G+DL
Sbjct: 842  KMS--LNHFKNFIEVACISTE-------RLGLAYNNL-SKEQCDILAKWLVKSKVTGLDL 891

Query: 692  AFNDFEN----LTKPIIKEL-SQRSFDSLQYFTLNSTNIQSVQEAAL-----IIRELSKL 741
             FND        +  + +++ S    +  +Y +LN T+++ V+E A      ++R LS L
Sbjct: 892  GFNDLRGKLTTFSDAVWQKIQSNEVKNVFKYLSLNDTSLE-VEEGATSETNEVLRLLSIL 950

Query: 742  ---PKLYFLDLSGLPSLFPAIFPYLNKYLPRFPSLKRLHFDSNEWTYKDISLVTQILPKC 798
                 L FLDLS  P  FP     L K LP F +L R+H D+ + T  +I ++ + LP C
Sbjct: 951  CYSEDLKFLDLSNNPKCFPHCLDTLVKCLPVFVNLVRIHLDNEQLTSTNIIMLAEALPLC 1010

Query: 799  KELLHVSMMNQPQESWAMSAAVFLYDCIKNSDKLINLDFNYENIPEEINSRIAIALVRNA 858
              L+H SM+  P +   +++   L +  + S  L+ LD NY  +P+ I  +I +  +RN 
Sbjct: 1011 SRLIHFSMLGTPLD---LASCKALAEAFRRSTSLLTLDVNYVYMPDNIKEKITMYSMRNM 1067

Query: 859  QKSIDSNWXXXXXXXXXXXXXXGELISETAGNILDKLNDSAKLQEDSTKRYLLKRYWEKI 918
            Q  +                  G  +S     + + L ++   + DSTK   +  +  +I
Sbjct: 1068 QNEL---RKVNSENEADGKATDGFHLSNLQQELSELLTEN--YEADSTKNADI--FITRI 1120

Query: 919  HTIHANVQKTIDSMFEQRISKELSLQSKENLLRLIFMENTL 959
              I + + + ++ +F  ++  +L+L+ KE L+RL F++ TL
Sbjct: 1121 EQIRSKISRVVEDLFNLKVQGQLNLEGKETLIRLCFLDRTL 1161

 Score = 34.7 bits (78), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 21/31 (67%)

Query: 271 LKRVTFAVDEFGMDPPQQIPSRKPKLGNVLV 301
           LK V+F+ + +  DPPQQI S+ P+ G V V
Sbjct: 455 LKHVSFSTNTYFNDPPQQICSKNPRKGEVEV 485

>KLLA0E11847g complement(1044591..1048385) some similarities with
            sp|P43638 Saccharomyces cerevisiae YJL042w MHP1
            microtubule-associated protein, hypothetical start
          Length = 1264

 Score =  260 bits (664), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 167/530 (31%), Positives = 283/530 (53%), Gaps = 63/530 (11%)

Query: 472  DVVYTRCCHLREILPIPSTLRQLKEKKA-PLQTLKFLNPRPTLIDILSFSDFIAIVPIHN 530
            DVVYTRCCHLREILPIP+T++QLK+    P+  L+  NP+P+ +++LSFSDF++I P+  
Sbjct: 622  DVVYTRCCHLREILPIPATMKQLKKGSTEPIPFLQLRNPKPSKVEVLSFSDFLSIAPVLC 681

Query: 531  VVFDNVGLSPEMFKIVISSLVKSITLERLSMRNVVFDERGWKLLCKFLMRNKSLTKLDIS 590
            +  D V LS EM +I++SS+      E+LS+RN   D  GWK+L  F+ + KSL  LD++
Sbjct: 682  LSLDGVSLSVEMLRIILSSITYKDKFEKLSLRNTPVDHDGWKVLSYFVSKCKSLNSLDVT 741

Query: 591  ------------------QTKIRHDLDLKLHRSQMDWSLFIDVLHKRQGKPLEELLLNGV 632
                               T  R   +++ +RS M+WSL    +  + G  LEE++++G 
Sbjct: 742  MIPGLALNVQKPSKSSNGSTVPRMVCNME-NRSDMNWSLLSAAVAAKGG--LEEMIVSG- 797

Query: 633  SFANNLHTFENMINAFSSTKNEFSRKRKLGLAQSQIASSEQLEILFRWMSENDIIGVDLA 692
            +F N +   +N I+        +++  +LGLA + + + EQ + L  WM+ + I GVD+ 
Sbjct: 798  AFMNQVQ-LQNFIDI------AWTKTLRLGLAYNNL-TLEQCQCLATWMTNSKIQGVDVG 849

Query: 693  FNDFENLTKPIIK---ELSQRSFDSLQYFTLNSTNIQSVQEAA--------LIIRELSKL 741
            +ND      P I    E +++  +  ++ +LNSTN+ SV + A         ++  L   
Sbjct: 850  YNDLNGKLGPFISAVIEKTKKGKNVFKFLSLNSTNL-SVPKGAKSEDNEVLSLLNGLCYC 908

Query: 742  PKLYFLDLSGLPSLFPAIFPYLNKYLPRFPSLKRLHFDSNEWTYKDISLVTQILPKCKEL 801
              L FLDLS  P LFP     L   LP F SL RLH D+N  +   +    ++LP C+ +
Sbjct: 909  DSLKFLDLSNNPGLFPYGMRTLTAILPVFVSLLRLHLDNNNLSTTAVMQFAEVLPMCQRI 968

Query: 802  LHVSMMNQPQESWAMSAAVFLYDCIKNSDKLINLDFNYENIPEEINSRIAIALVRNAQKS 861
             ++S++     +  + +A  L   +KNS  +I +D +Y ++P+ I  +I++  +RN Q+ 
Sbjct: 969  NYISLLGT---NLNIISASALAAAVKNSKTIITMDIDYAHVPDRIKEKISVYSMRNTQRE 1025

Query: 862  IDSNWXXXXXXXXXXXXXXGELISETAGNILDKLNDSAKLQEDSTKR----YLLKRYWEK 917
            ++                 G+   E   ++ ++L     L EDS+ R     L+  + E+
Sbjct: 1026 LE-----------QINKSGGDDGHEKLKSLQEEL--GRLLTEDSSTRSDYDTLVSNFLER 1072

Query: 918  IHTIHANVQKTIDSMFEQRISKELSLQSKENLLRLIFMENTLGNILEYLS 967
            I T+ A +   I+ +F+ R++ ELS + KE L++  F++ +    L+ L+
Sbjct: 1073 IQTVRAKLHAAIEELFKLRLNGELSTEGKETLIKFCFIDASFEKGLKLLA 1122

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 19/34 (55%), Positives = 22/34 (64%)

Query: 271 LKRVTFAVDEFGMDPPQQIPSRKPKLGNVLVPND 304
           LKRV FA + +  DPPQQI SR P+ G V V  D
Sbjct: 435 LKRVAFAANTYFNDPPQQICSRNPRKGEVEVKAD 468

>Kwal_23.5488
          Length = 1112

 Score =  259 bits (661), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 198/745 (26%), Positives = 344/745 (46%), Gaps = 110/745 (14%)

Query: 271  LKRVTFAVDEFGMDPPQQIPSRKPKLGNV------------LVPNDMISDIPSISQGITT 318
             ++V+FA + +  DPPQQI S+ P+ G V            L P +    +   S GI  
Sbjct: 389  FRKVSFATNTYFNDPPQQICSKNPRRGEVEVKPDGSVIIHRLTPEEKREILQKTSTGIVV 448

Query: 319  TAQPSSHGNDQHGAL---PASAYTKDSKEYQLALENHKKCLKESEKHQQEAHYAAQRIAS 375
                   G   H  L   P  +  +  ++ +    N  KC ++       +       AS
Sbjct: 449  -------GGSGHLKLLSDPTLSEEEVKRKEEKKPVNANKCAEQDGTMTDPS-------AS 494

Query: 376  EVAGFKLKPSTSTDL-KPSANGTVPKSGAATDDEANAEAGVVADEKIKSLEIDKPIHMHE 434
            E A  K   STS  + +PS +                E  V+  +    ++IDKP+    
Sbjct: 495  EKAAQKAAESTSEQVNQPSGDN---------------EEEVIISKSASEVKIDKPMIS-- 537

Query: 435  HHFKEXXXXXXXXXXEHGANPSSTSGTQDENGNELMLDVVYTRCCHLREILPIPSTLRQL 494
               +                           G ++  D+VYTRCCHLREILPIP+TL+QL
Sbjct: 538  ---RRSASSLSTMIPAADPEEDDDDNIFPPPGMKIPHDLVYTRCCHLREILPIPATLKQL 594

Query: 495  KEKKA-PLQTLKFLNPRPTLIDILSFSDFIAIVPIHNVVFDNVGLSPEMFKIVISSLVKS 553
            K+    P+  L+  NP+P+LI++LSFSDF+ I P+  +  D V LS  M +I++ SL+  
Sbjct: 595  KKGSTDPIPLLQMRNPKPSLIEVLSFSDFLGITPVLCLSLDGVNLSAGMLRIILCSLMNK 654

Query: 554  ITLERLSMRNVVFDERGWKLLCKFLMRNKSLTKLDISQTK------------------IR 595
               E+LS+RN   D  GWK+LC F+ + KSL  +D++                     +R
Sbjct: 655  KQFEKLSLRNTPLDHEGWKILCYFISQCKSLNSIDLTMVPGISINVQKPSKSSQRSRVVR 714

Query: 596  HDLDLKLHRSQMDWSLFIDVLHKRQGKPLEELLLNGVSFANNLHTFENMINAFSSTKNEF 655
                +   R +M+W+L +  L   +G  LEE++++G   +  L  F++ +     TK   
Sbjct: 715  MTCSMT-DRKEMNWNLLVASLISVEG--LEEIIISGAKMS--LKEFKDFLQ-LGCTKT-- 766

Query: 656  SRKRKLGLAQSQIASSEQLEILFRWMSENDIIGVDLAFNDFENLTKPIIKELSQRSFDS- 714
                +LGLA +++ ++EQ  +L  W++ +++ G+D+ FND           +  R+  S 
Sbjct: 767  ---LRLGLAYNEL-TTEQCNVLAGWLAHSNVTGIDIGFNDLRGKLGAFASGIIDRTKSSR 822

Query: 715  --LQYFTLNSTNIQSVQEAA-------LIIRELSKLPKLYFLDLSGLPSLFPAIFPYLNK 765
               +YF+L+STN++  +++         +I  L     L  LD+S  P LFP +  +L  
Sbjct: 823  NVFKYFSLSSTNLEVSEDSTPENDDFLKLISVLCYCEDLKLLDISNNPKLFPYVTSHLTN 882

Query: 766  YLPRFPSLKRLHFDSNEWTYKDISLVTQILPKCKELLHVSMMNQPQESWAMSAAVFLYDC 825
            Y+P F +L RLH D+N      +  + ++LP C++L HVSM     + +A   A  L   
Sbjct: 883  YMPVFVNLLRLHMDNNNIPAPSVVALAEVLPMCQKLSHVSMRGTKLD-YATGCA--LAAA 939

Query: 826  IKNSDKLINLDFNYENIPEEINSRIAIALVRNAQKSIDSNWXXXXXXXXXXXXXXGELIS 885
            ++ S  L+ +D + EN+P +I  ++++  ++N +K+++                    +S
Sbjct: 940  MRQSSSLLTIDLDAENLPNKIKDKMSLYSMKNMEKTLN-----------RVDKSTSPEMS 988

Query: 886  ETAGNILDKLNDSAKLQEDSTKR---YLLKRYWEKIHTIHANVQKTIDSMFEQRISKELS 942
            +T   +  +L D   L E   K+    + + +  ++    + ++K  + +F+ R+   LS
Sbjct: 989  DTLACLQKELAD--LLTEQPNKQDVEVMAQNFLLRLSKARSFIKKVTEDLFKLRVEGNLS 1046

Query: 943  LQSKENLLRLIFMENTLGNILEYLS 967
               KE L+R  F++ T    L+ L+
Sbjct: 1047 TGGKETLIRFCFIDATFERGLQLLA 1071

>CAGL0J00803g complement(83483..87427) similar to sp|P43638
            Saccharomyces cerevisiae YJL042w MHP1, hypothetical start
          Length = 1314

 Score =  256 bits (653), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 166/536 (30%), Positives = 271/536 (50%), Gaps = 67/536 (12%)

Query: 472  DVVYTRCCHLREILPIPSTLRQLKEKKA-PLQTLKFLNPRPTLIDILSFSDFIAIVPIHN 530
            DVVYTRCCHLREILPIP+TL+Q+K+    P+  L+  NPRP+L++I SFSDF++I P+  
Sbjct: 510  DVVYTRCCHLREILPIPATLKQIKKGSTDPIPLLQLRNPRPSLLEIWSFSDFLSISPVLC 569

Query: 531  VVFDNVGLSPEMFKIVISSLVKSITLERLSMRNVVFDERGWKLLCKFLMRN-KSLTKLDI 589
            V  D V L+ EM +I++SSLV +  LE+L+MRN   +E GWK+L  F+ +  K+   LD+
Sbjct: 570  VSLDGVSLTEEMLRIILSSLVSNPHLEKLTMRNTPLNEDGWKILSYFITKQKKNFVALDL 629

Query: 590  SQT----------------------KIRHDLDLKLH-RSQMDWSLFIDVLHKRQGKPLEE 626
            +                         +   ++   H RS M+W L    +  ++G  +EE
Sbjct: 630  TMVPTIKTNVQKPSKSSLAKNANNPNLLKRMECNTHNRSDMNWDLLTAAVATKEGG-IEE 688

Query: 627  LLLNGVSFANNLHTFENMINAFSSTKNEFSRKRKLGLAQSQIASSEQLEILFRWMSENDI 686
             +L G   +     F+N I    +  +      +LGLA +++ + EQ ++L  W+  ++I
Sbjct: 689  FVLAGACMS--YTQFKNFIELACTNTD------RLGLAYNKL-TMEQCKVLAEWIVTSNI 739

Query: 687  IGVDLAFNDFENLTKPIIKELSQR-----SFDSLQYFTLNSTNIQ----SVQEAALIIRE 737
             G+DL FND +  T      ++ +       + ++Y +LNSTN+     +  E   ++R 
Sbjct: 740  RGLDLGFNDLKGKTSVFTDAVANKVQNVGEKNEMKYISLNSTNLSVEADTTPENNEVLRL 799

Query: 738  LSKL---PKLYFLDLSGLPSLFPAIFPYLNKYLPRFPSLKRLHFDSNEWTYKDISLVTQI 794
            LS L     L FLDLS  P +FP     L   LP + +L RLH D N+     I ++ + 
Sbjct: 800  LSVLCYSENLKFLDLSNNPKIFPHCIKTLTTSLPVYVNLIRLHLDYNDLDCASIVVLAES 859

Query: 795  LPKCKELLHVSMMNQPQESWAMSAAVFLYDCIKNSDKLINLDFNYENIPEEINSRIAIAL 854
            LP C +L H+S++        +++A  L + +  S+ L+ LD  Y  +PE I  R+++  
Sbjct: 860  LPLCSKLHHLSLLGS---KLNLASAKALTEAVNKSNTLMTLDLEYNTVPESIKERMSLYT 916

Query: 855  VRNAQKSIDSNWXXXXXXXXXXXXXXGE-----------LISETAGNILDKLNDSAKLQE 903
            +RN Q  +D+                 E           L  E +  + DK  DS  L+ 
Sbjct: 917  MRNIQNELDNVQKTKRKAGLSLPSVPQEEMAANEKQISTLQEELSSLLTDKFEDS--LEY 974

Query: 904  DSTKRYLLKRYWEKIHTIHANVQKTIDSMFEQRISKELSLQSKENLLRLIFMENTL 959
            D     L+  + EKI  +   ++K +  +F+ R+  ELS + KE L+ L  ++++ 
Sbjct: 975  DK----LVVEFIEKITKVRTKIEKVVSDLFDLRVKNELSCEGKETLINLCLIDSSF 1026

 Score = 35.4 bits (80), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 271 LKRVTFAVDEFGMDPPQQIPSRKPKLGNVLV-PNDMI 306
           LK V FA   +  DPPQQI S+ P+ G V V PN  +
Sbjct: 328 LKHVAFATTTYFNDPPQQICSKNPRKGEVEVKPNGSV 364

>YJL042W (MHP1) [2870] chr10 (361165..365361) Microtubule-interacting
            protein, functions in stabilization of microtubules [4197
            bp, 1398 aa]
          Length = 1398

 Score =  251 bits (640), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 164/548 (29%), Positives = 292/548 (53%), Gaps = 73/548 (13%)

Query: 456  SSTSGTQDENGNELM--------LDVVYTRCCHLREILPIPSTLRQLKEKKA-PLQTLKF 506
            S T+GT  ++  E++         D+VYTRCCHLREILPIP+TL+QLK+    P+  L+ 
Sbjct: 615  SDTNGTNADDEGEILPPPSLKIPHDIVYTRCCHLREILPIPATLKQLKKGSTDPIPILQL 674

Query: 507  LNPRPTLIDILSFSDFIAIVPIHNVVFDNVGLSPEMFKIVISSLVKSITLERLSMRNVVF 566
             NPRP++++I SFSDF++I P+  +  D V L+ +M +I++SSLV     ++LS+RN   
Sbjct: 675  RNPRPSMVEIWSFSDFLSIAPVLCLSLDGVQLTVQMLRIILSSLVYKQHFQKLSLRNTPL 734

Query: 567  DERGWKLLCKFLMRNKSLTKLDISQTK------------------IRHDLDLKLHRSQMD 608
            DE GWK+LC F+ + KSL  +D++                     +R   +L+ +RS M+
Sbjct: 735  DEEGWKVLCYFVSKAKSLHSIDLTMVPSIKTNVQKPSKSSLKSKILRMQCNLE-NRSDMN 793

Query: 609  WSLFIDVLHKRQGKPLEELLLNGVSFANNLHTFENMINAFSSTKNEFSRKRKLGLAQSQI 668
            W L    +    G  LEE++++G     N   F+N I   +    E     +LGLA + +
Sbjct: 794  WDLLTASIALMGG--LEEIVISGAKM--NSAQFKNFI-LVACIATE-----RLGLAYNGL 843

Query: 669  ASSEQLEILFRWMSENDIIGVDLAFND----FENLTKPIIKELSQRSFDSL-QYFTLNST 723
            + S Q + L +WM ++ + G+D+ FND      + T  ++ ++ + +  ++ ++ +LN T
Sbjct: 844  SKS-QCDDLAKWMVQSKVTGLDVGFNDLNGKLSSFTDAVLGKIQKANEKNVFKFLSLNGT 902

Query: 724  NIQSVQ-------EAALIIRELSKLPKLYFLDLSGLPSLFPAIFPYLNKYLPRFPSLKRL 776
            N++  +       E   +I  L  L  L FLD+S  P++FP   P L  +LP F +L RL
Sbjct: 903  NLRVNEHDTFENNEVLKLISVLCYLENLKFLDISNNPAIFPHCVPTLIDFLPVFVNLVRL 962

Query: 777  HFDSNEWTYKDISLVTQILPKCKELLHVSMMNQPQESWAMSAAVFLYDCIKNSDKLINLD 836
            H D N  +   + ++ +ILP C  L + SM+        ++++  L + ++ S  L+ LD
Sbjct: 963  HIDYNNLSSTSVVMLAEILPMCSRLNYFSMLGT---ELDLASSKALAEAVRKSSSLMTLD 1019

Query: 837  FNYENIPEEINSRIAIALVRNAQ---KSIDSNWXXXXXXXXXXXXXXGELISETAGNILD 893
             +Y  +PE I  +I++  +RN Q   K ++S+                ++      ++ D
Sbjct: 1020 VDYVYMPENIKEKISLYALRNIQGELKRVNSD--------------DKDIKDSQFSSLQD 1065

Query: 894  KLNDSAKLQEDSTKRY--LLKRYWEKIHTIHANVQKTIDSMFEQRISKELSLQSKENLLR 951
            +L+     + D+++ Y  +++ +  KI      + K +  +F+ +++ +L+L+ KE L+R
Sbjct: 1066 QLSLLLTEKADNSEHYNKMVENFMAKIALARIKISKVVHDLFDLKLNGQLNLEGKEALIR 1125

Query: 952  LIFMENTL 959
            L F+E +L
Sbjct: 1126 LCFIEASL 1133

>ACR059W [1107] [Homologous to ScYJL042W (MHP1) - SH]
           complement(459751..463401) [3651 bp, 1216 aa]
          Length = 1216

 Score =  206 bits (524), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 149/533 (27%), Positives = 253/533 (47%), Gaps = 56/533 (10%)

Query: 472 DVVYTRCCHLREILPIPSTLRQLKEKKA-PLQTLKFLNPRPTLIDILSFSDFIAIVPIHN 530
           D++YTRCC+LREILPIP+ L+QLK   + P+  L+  NP+P++I+ILS  DF++I P+  
Sbjct: 475 DMLYTRCCYLREILPIPAMLKQLKPGSSDPIPLLQLRNPKPSMIEILSLGDFLSIAPVLC 534

Query: 531 VVFDNVGLSPEMFKIVISSLVKSITLERLSMRNVVFDERGWKLLCKFLMRNKSLTKLDIS 590
              D V LS +M  I++SSL     LE+LSMRN   DE GWK L  F+  +K+L  LD++
Sbjct: 535 FSMDGVSLSVQMLHIILSSLRCMGRLEKLSMRNTPLDEEGWKTLAYFISSSKTLRGLDLT 594

Query: 591 -----------------QTKI-RHDLDLKLHRSQMDWSLFIDVLHKRQGKPLEELLLNGV 632
                            Q  I R   DL   R++ +W+LF   +       LEEL+++G 
Sbjct: 595 MIPGIPLNVQKPSKSSGQCSIPRMKCDLT-SRAEQNWNLFTAAIAINGN--LEELIISGA 651

Query: 633 SFANNLHTFENMINAFSSTKNEFSRKRKLGLAQSQIASSEQLEILFRWMSENDIIGVDLA 692
             +  L  F+ +++    +        +LGLA + + S    E L  W+    + G+D+ 
Sbjct: 652 KIS--LGQFKILLDIGCHSLE------RLGLAFNDL-SHGHCEALASWLPGCKVTGLDIG 702

Query: 693 FNDFENLTKPIIKELSQRS---FDSLQYFTLNSTNIQ-------SVQEAALIIRELSKLP 742
           FN      +P+ + L ++S    +S+   +LNST++           +   ++  L    
Sbjct: 703 FNPLNGKMRPLAEALMRKSKVGNNSIACISLNSTDLAIPPNATVETSDVVALLSALGYCE 762

Query: 743 KLYFLDLSGLPSLFPAIFPYLNKYLPRFPSLKRLHFDSNEWTYKDISLVTQILPKCKELL 802
            L FL LS  P++F      L   LP      RL  D N  +   I  + ++LP C  + 
Sbjct: 763 NLKFLPLSNNPNMFIYGMKPLTDILPVLVGFARLQLDYNNLSSTSIITLAEVLPMCTTIG 822

Query: 803 HVSMMNQPQESWAMSAAVFLYDCIKNSDKLINLDFNYENIPEEINSRIAIALVRNAQKSI 862
           ++S++    ++ + +A V     +K S  L  +D ++  +P+ I   ++I  ++N +  +
Sbjct: 823 YLSLVGSKLDTSSGAALVL---ALKKSGSLFTIDADFSEMPDAIRHDVSIYSLKNLENVL 879

Query: 863 DSNWXXXXXXXXXXXXXXGELISETAGNILDKLNDSAKLQEDSTKRYLLKRYWEKIHTIH 922
           +                  EL    AG   DK        ED    +L++ + ++I  I 
Sbjct: 880 E--LSKTGHDMGKSTSLQQELAVLLAGKTQDK--------EDYD--HLVESFAKRICDIR 927

Query: 923 ANVQKTIDSMFEQRISKELSLQSKENLLRLIFMENTLGNILEYLSTNPYIQEL 975
             ++     +F+ R+  ELS + KE L+R  F++++    L  L+     Q L
Sbjct: 928 KRLKTVTKDLFKLRVRGELSTEGKETLIRFCFLDSSFEKALGLLAQRDKSQAL 980

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 22/34 (64%)

Query: 271 LKRVTFAVDEFGMDPPQQIPSRKPKLGNVLVPND 304
           LKRV+FA + +   PPQQI SR P+ G V V  D
Sbjct: 335 LKRVSFARNTYFNSPPQQICSRNPRKGEVEVKAD 368

>AER397C [2897] [Homologous to ScYBL079W (NUP170) - SH; ScYER105C
            (NUP157) - SH] (1392748..1397034) [4287 bp, 1428 aa]
          Length = 1428

 Score = 34.7 bits (78), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 62/135 (45%), Gaps = 24/135 (17%)

Query: 680  WMSENDIIGVDLAFNDFENLTKPIIKELSQRSFDSLQYFTLNST----------NIQSVQ 729
            + S +D++G    F   E+L K   KE+  R FD+L Y   N+T          +I  ++
Sbjct: 929  FCSSSDVLG----FRAVEHLRKA--KEVGLRDFDTLNYHLTNATRLFEKIVDDISIDKLK 982

Query: 730  EAALIIRELSKLPKL--YFLDLSGLPSLFPAIFPYL-NKYLPRFPSLKRLHFDSNEWTYK 786
            EA  I+ EL+  PK   + L+++ L       + Y+ + YL      K+ +FD     Y 
Sbjct: 983  EAVAIMLELNYFPKTIEFLLNIANLTDKGKLAYQYVSDGYLEH--DEKKKYFDKRVCIYD 1040

Query: 787  DISLVTQILPKCKEL 801
               LV Q L K  +L
Sbjct: 1041 ---LVFQTLIKIDDL 1052

>Kwal_27.12514
          Length = 958

 Score = 33.9 bits (76), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 6/52 (11%)

Query: 554 ITLERLSMRNVVF-DERGWKLLCKFLMRNKSLTKLDISQTKIRHDLDLKLHR 604
           +TL+ LSM N  F DE  W+ LC+ ++ N+SL +L  +     H LD  L R
Sbjct: 482 VTLKLLSMSNASFNDEDIWQRLCQIVVNNESLHQLTCN-----HLLDYLLQR 528

>YLR176C (RFX1) [3580] chr12 complement(507799..510234) Repressor of
           DNA damage-inducible genes [2436 bp, 811 aa]
          Length = 811

 Score = 33.9 bits (76), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 2/42 (4%)

Query: 927 KTID--SMFEQRISKELSLQSKENLLRLIFMENTLGNILEYL 966
           K ID  + F   I  ++SL+S ENLL  +F+ N +G +L Y 
Sbjct: 758 KLIDCSTRFRNAIIGDISLKSNENLLSWLFLNNVMGQLLNYC 799

>Scas_651.8
          Length = 607

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 40/69 (57%), Gaps = 1/69 (1%)

Query: 792 TQILPKCKELLHVSMMNQPQESWAMSAAVFLYDCIKNSDKLINLDFNYENIPEEINSRIA 851
             +L +CKE ++++ ++       ++  V L+  +KN  +L  +DF  + IPE  NS+I 
Sbjct: 285 VDMLKECKEFIYLNDLSLISIRQDVNILVELFSNLKNLKRL-KMDFLEDYIPESTNSQIF 343

Query: 852 IALVRNAQK 860
           ++++ N +K
Sbjct: 344 LSILLNCKK 352

>AAL104C [83] [Homologous to ScYPL169C (MEX67) - SH]
           (159179..160936) [1758 bp, 585 aa]
          Length = 585

 Score = 30.8 bits (68), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 50/108 (46%), Gaps = 9/108 (8%)

Query: 573 LLCKFLMRNKSLTKLDISQTKIRHDLDLKLHRSQMDWS----LFIDVLHKRQGKPLEELL 628
           LL  FLM+  ++    +    +  D DL  H      S    +F+ ++     +P  +L+
Sbjct: 105 LLRNFLMKRYNVQTKMLDLGGLYADPDLTQHGLVSSMSTQSKMFMALMKLAGSEP--QLV 162

Query: 629 LNGVSFANNLHTFENMINAFSSTKNEFSRKRKLGLAQSQIASSEQLEI 676
           +  V+ +NN     N I + + T   F R R L LA +QIA  + LE+
Sbjct: 163 VESVNLSNNGLKDVNSITSLAQT---FPRLRNLCLANNQIARFQSLEV 207

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.131    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 36,785,510
Number of extensions: 1576479
Number of successful extensions: 4492
Number of sequences better than 10.0: 43
Number of HSP's gapped: 4594
Number of HSP's successfully gapped: 74
Length of query: 1259
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1146
Effective length of database: 12,684,275
Effective search space: 14536179150
Effective search space used: 14536179150
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 68 (30.8 bits)