Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0D07194g1241224653e-61
Kwal_55.2154077751602.5
Sklu_2371.619857584.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D07194g
         (122 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D07194g complement(613537..613911) no similarity, hypotheti...   183   3e-61
Kwal_55.21540                                                          28   2.5  
Sklu_2371.6 YDR032C, Contig c2371 10619-11215 reverse complement       27   4.6  

>KLLA0D07194g complement(613537..613911) no similarity, hypothetical
           start
          Length = 124

 Score =  183 bits (465), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 106/122 (86%), Positives = 106/122 (86%)

Query: 1   MRVRTGDDCEKNMSIMNHRRPLVNGNKRSSSAALHSTVSHTTPTHLTISACGESPSPHYP 60
           MRVRTGDDCEKNMSIMNHRRPLVNGNKRSSSAALHSTVSHTTPTHLTISACGESPSPHYP
Sbjct: 1   MRVRTGDDCEKNMSIMNHRRPLVNGNKRSSSAALHSTVSHTTPTHLTISACGESPSPHYP 60

Query: 61  SVIIPRLTSVRCRCGPPAAPPFPQFSXXXXXXXXXXXXXXXXKRRLVLTVVINIHGICSH 120
           SVIIPRLTSVRCRCGPPAAPPFPQFS                KRRLVLTVVINIHGICSH
Sbjct: 61  SVIIPRLTSVRCRCGPPAAPPFPQFSTFNIFFPGTGFGTTKGKRRLVLTVVINIHGICSH 120

Query: 121 DS 122
           DS
Sbjct: 121 DS 122

>Kwal_55.21540
          Length = 777

 Score = 27.7 bits (60), Expect = 2.5,   Method: Composition-based stats.
 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 5/51 (9%)

Query: 12  NMSIMNHRRPLVNGNKRSS-----SAALHSTVSHTTPTHLTISACGESPSP 57
           N  +M+ + P  NG  RS      S++ HST+S  +  HL  +    SP P
Sbjct: 301 NSFLMSLKPPPKNGRSRSQIGFSRSSSQHSTLSEKSQAHLDYNEMPPSPVP 351

>Sklu_2371.6 YDR032C, Contig c2371 10619-11215 reverse complement
          Length = 198

 Score = 26.9 bits (58), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 23/57 (40%), Gaps = 3/57 (5%)

Query: 14 SIMNHRRPLVNGNKRSSSAALHSTVSHTTPTHLT---ISACGESPSPHYPSVIIPRL 67
          ++  H   L    KR   AA      +  P  L+   + A G SP P+YP   +  L
Sbjct: 10 TLYGHTAILAEAQKRGVEAAGGEADIYQVPETLSDDILKALGSSPKPNYPIATLQTL 66

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.132    0.418 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,551,496
Number of extensions: 117699
Number of successful extensions: 382
Number of sequences better than 10.0: 12
Number of HSP's gapped: 380
Number of HSP's successfully gapped: 12
Length of query: 122
Length of database: 16,596,109
Length adjustment: 88
Effective length of query: 34
Effective length of database: 13,549,725
Effective search space: 460690650
Effective search space used: 460690650
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 55 (25.8 bits)