Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0D07161g1801788221e-114
Kwal_26.86801581366368e-86
Sklu_2012.41501226322e-85
ACR112C1541306262e-84
YPL135W (ISU1)1651336186e-83
YOR226C (ISU2)1561296081e-81
Scas_640.221601346072e-81
CAGL0M02629g2131296061e-80
CAGL0J04048g1451295862e-78
Scas_700.391611325882e-78
Kwal_56.23855605105614.2
YOL076W (MDM20)79658614.2
YDR502C (SAM2)38476597.2
CAGL0J06226g50846597.7
CAGL0K05269g76189598.9
CAGL0C00759g78520598.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D07161g
         (178 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D07161g complement(612348..612890) some similarities with s...   321   e-114
Kwal_26.8680                                                          249   8e-86
Sklu_2012.4 YPL135W, Contig c2012 4922-5374 reverse complement        248   2e-85
ACR112C [1159] [Homologous to ScYPL135W (ISU1) - SH; ScYOR226C (...   245   2e-84
YPL135W (ISU1) [5310] chr16 (297552..298049) Protein with simila...   242   6e-83
YOR226C (ISU2) [5017] chr15 complement(761614..762084) Protein w...   238   1e-81
Scas_640.22                                                           238   2e-81
CAGL0M02629g 303016..303657 some similarities with tr|Q03020 Sac...   238   1e-80
CAGL0J04048g 381327..381764 highly similar to tr|Q12056 Saccharo...   230   2e-78
Scas_700.39                                                           231   2e-78
Kwal_56.23855                                                          28   4.2  
YOL076W (MDM20) [4744] chr15 (187023..189413) Protein required f...    28   4.2  
YDR502C (SAM2) [1317] chr4 complement(1453298..1454452) S-adenos...    27   7.2  
CAGL0J06226g 587164..588690 highly similar to sp|P39006 Saccharo...    27   7.7  
CAGL0K05269g 512844..515129 similar to tr|Q12311 Saccharomyces c...    27   8.9  
CAGL0C00759g complement(78078..80435) similar to sp|P39520 Sacch...    27   8.9  

>KLLA0D07161g complement(612348..612890) some similarities with
           sgd|S0006056 Saccharomyces cerevisiae YPL135w ISU1,
           hypothetical start
          Length = 180

 Score =  321 bits (822), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 156/178 (87%), Positives = 156/178 (87%)

Query: 1   MFRGQMFAVQRMGSALMHXXXXXXXXXXXXXXXXXXXXXXSSPSMASARFYHPKVIDHYT 60
           MFRGQMFAVQRMGSALMH                      SSPSMASARFYHPKVIDHYT
Sbjct: 1   MFRGQMFAVQRMGSALMHGGGGGTRIIGVAAARATAPTVGSSPSMASARFYHPKVIDHYT 60

Query: 61  NPRNVGSLDKNLPNVGTGLVGAPACGDVMKLQIQVNDETGVIENVKFKTFGCGSAIASSS 120
           NPRNVGSLDKNLPNVGTGLVGAPACGDVMKLQIQVNDETGVIENVKFKTFGCGSAIASSS
Sbjct: 61  NPRNVGSLDKNLPNVGTGLVGAPACGDVMKLQIQVNDETGVIENVKFKTFGCGSAIASSS 120

Query: 121 YMTELVRGKTLEDAAKIKNTEIARELSLPPVKLHCSMLAEDAIKAAIKDYQAKRPTTQ 178
           YMTELVRGKTLEDAAKIKNTEIARELSLPPVKLHCSMLAEDAIKAAIKDYQAKRPTTQ
Sbjct: 121 YMTELVRGKTLEDAAKIKNTEIARELSLPPVKLHCSMLAEDAIKAAIKDYQAKRPTTQ 178

>Kwal_26.8680
          Length = 158

 Score =  249 bits (636), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 121/136 (88%), Positives = 127/136 (93%), Gaps = 2/136 (1%)

Query: 44  SMASA--RFYHPKVIDHYTNPRNVGSLDKNLPNVGTGLVGAPACGDVMKLQIQVNDETGV 101
           SMAS   R YHPKVIDHYTNPRNVGSLDK L NVGTGLVGAPACGDVMKLQIQVNDETGV
Sbjct: 20  SMASVARRAYHPKVIDHYTNPRNVGSLDKKLENVGTGLVGAPACGDVMKLQIQVNDETGV 79

Query: 102 IENVKFKTFGCGSAIASSSYMTELVRGKTLEDAAKIKNTEIARELSLPPVKLHCSMLAED 161
           IENVKFKTFGCGSAIASSSYMTELVRGKTL+ A++IKNTEIA+ELSLPPVKLHCSMLAED
Sbjct: 80  IENVKFKTFGCGSAIASSSYMTELVRGKTLDVASQIKNTEIAKELSLPPVKLHCSMLAED 139

Query: 162 AIKAAIKDYQAKRPTT 177
           AIKAAIKDY++KR  T
Sbjct: 140 AIKAAIKDYRSKRKAT 155

>Sklu_2012.4 YPL135W, Contig c2012 4922-5374 reverse complement
          Length = 150

 Score =  248 bits (632), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 117/122 (95%), Positives = 120/122 (98%)

Query: 49  RFYHPKVIDHYTNPRNVGSLDKNLPNVGTGLVGAPACGDVMKLQIQVNDETGVIENVKFK 108
           R YHPKVIDHYTNPRNVGSLDKNL NVGTGLVGAPACGDVMKLQIQVND+TGVIENVKFK
Sbjct: 19  RLYHPKVIDHYTNPRNVGSLDKNLTNVGTGLVGAPACGDVMKLQIQVNDDTGVIENVKFK 78

Query: 109 TFGCGSAIASSSYMTELVRGKTLEDAAKIKNTEIARELSLPPVKLHCSMLAEDAIKAAIK 168
           TFGCGSAIASSSYMTELVRGKTL+DAAKI+NTEIARELSLPPVKLHCSMLAEDAIKAAIK
Sbjct: 79  TFGCGSAIASSSYMTELVRGKTLDDAAKIRNTEIARELSLPPVKLHCSMLAEDAIKAAIK 138

Query: 169 DY 170
           DY
Sbjct: 139 DY 140

>ACR112C [1159] [Homologous to ScYPL135W (ISU1) - SH; ScYOR226C
           (ISU2) - SH] (549554..550018) [465 bp, 154 aa]
          Length = 154

 Score =  245 bits (626), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 122/130 (93%)

Query: 49  RFYHPKVIDHYTNPRNVGSLDKNLPNVGTGLVGAPACGDVMKLQIQVNDETGVIENVKFK 108
           R YHPKVIDHYTNPRNVG+LDK L NVGTGLVGAPACGDVM+LQIQV+D TGVIENVKFK
Sbjct: 23  RCYHPKVIDHYTNPRNVGTLDKKLTNVGTGLVGAPACGDVMRLQIQVDDSTGVIENVKFK 82

Query: 109 TFGCGSAIASSSYMTELVRGKTLEDAAKIKNTEIARELSLPPVKLHCSMLAEDAIKAAIK 168
           TFGCGSAIASSSYMTELVRGKTL DA KIKNTEIARELSLPPVKLHCSMLAEDAIKAAIK
Sbjct: 83  TFGCGSAIASSSYMTELVRGKTLADAEKIKNTEIARELSLPPVKLHCSMLAEDAIKAAIK 142

Query: 169 DYQAKRPTTQ 178
           DY++KR  T+
Sbjct: 143 DYRSKRKATE 152

>YPL135W (ISU1) [5310] chr16 (297552..298049) Protein with
           similarity to iron-sulfur cluster nitrogen fixation
           proteins [498 bp, 165 aa]
          Length = 165

 Score =  242 bits (618), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 114/133 (85%), Positives = 125/133 (93%)

Query: 44  SMASARFYHPKVIDHYTNPRNVGSLDKNLPNVGTGLVGAPACGDVMKLQIQVNDETGVIE 103
           S  + R YHPKVI+HYT+PRNVGSLDK LPNVGTGLVGAPACGDVM+LQI+VND TGVIE
Sbjct: 28  SSITKRLYHPKVIEHYTHPRNVGSLDKKLPNVGTGLVGAPACGDVMRLQIKVNDSTGVIE 87

Query: 104 NVKFKTFGCGSAIASSSYMTELVRGKTLEDAAKIKNTEIARELSLPPVKLHCSMLAEDAI 163
           +VKFKTFGCGSAIASSSYMTELV+G TL+DAAKIKNTEIA+ELSLPPVKLHCSMLAEDAI
Sbjct: 88  DVKFKTFGCGSAIASSSYMTELVQGMTLDDAAKIKNTEIAKELSLPPVKLHCSMLAEDAI 147

Query: 164 KAAIKDYQAKRPT 176
           KAAIKDY++KR T
Sbjct: 148 KAAIKDYKSKRNT 160

>YOR226C (ISU2) [5017] chr15 complement(761614..762084) Protein with
           similarity to iron-sulfur cluster nitrogen fixation
           proteins [471 bp, 156 aa]
          Length = 156

 Score =  238 bits (608), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 123/129 (95%)

Query: 46  ASARFYHPKVIDHYTNPRNVGSLDKNLPNVGTGLVGAPACGDVMKLQIQVNDETGVIENV 105
           A+ R YHPKVIDHYTNPRNVGS+DK+L NVGTG+VGAPACGDV+KLQIQVND++G+IENV
Sbjct: 22  AAKRLYHPKVIDHYTNPRNVGSMDKSLANVGTGIVGAPACGDVIKLQIQVNDKSGIIENV 81

Query: 106 KFKTFGCGSAIASSSYMTELVRGKTLEDAAKIKNTEIARELSLPPVKLHCSMLAEDAIKA 165
           KFKTFGCGSAIASSSYMTELVRG +L++A KIKNTEIA+ELSLPPVKLHCSMLAEDAIKA
Sbjct: 82  KFKTFGCGSAIASSSYMTELVRGMSLDEAVKIKNTEIAKELSLPPVKLHCSMLAEDAIKA 141

Query: 166 AIKDYQAKR 174
           AIKDY+ KR
Sbjct: 142 AIKDYKTKR 150

>Scas_640.22
          Length = 160

 Score =  238 bits (607), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 124/134 (92%)

Query: 41  SSPSMASARFYHPKVIDHYTNPRNVGSLDKNLPNVGTGLVGAPACGDVMKLQIQVNDETG 100
           ++ S+ + R YH KVI+HYTNPRNVGSLDK+L NVGTG+VGAPACGDV+KLQIQVND+TG
Sbjct: 20  TTQSLLTKRLYHAKVIEHYTNPRNVGSLDKSLSNVGTGIVGAPACGDVIKLQIQVNDDTG 79

Query: 101 VIENVKFKTFGCGSAIASSSYMTELVRGKTLEDAAKIKNTEIARELSLPPVKLHCSMLAE 160
           +IENVKFKTFGCGSAIASSSYMTELV G +++DAAKIKN EIA+ELSLPPVKLHCSMLAE
Sbjct: 80  IIENVKFKTFGCGSAIASSSYMTELVNGMSVDDAAKIKNIEIAKELSLPPVKLHCSMLAE 139

Query: 161 DAIKAAIKDYQAKR 174
           DAIKAAIKDY+ KR
Sbjct: 140 DAIKAAIKDYKTKR 153

>CAGL0M02629g 303016..303657 some similarities with tr|Q03020
           Saccharomyces cerevisiae YPL135w ISU1 or tr|Q12056
           Saccharomyces cerevisiae YOR226c ISU2, hypothetical
           start
          Length = 213

 Score =  238 bits (606), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 123/129 (95%)

Query: 49  RFYHPKVIDHYTNPRNVGSLDKNLPNVGTGLVGAPACGDVMKLQIQVNDETGVIENVKFK 108
           R YHPKVI+HYT+PRNVGS+DK LPNVGTGLVGAPACGDVM+LQI+VND+TGVIE+VKFK
Sbjct: 81  RMYHPKVIEHYTHPRNVGSMDKTLPNVGTGLVGAPACGDVMRLQIKVNDKTGVIEDVKFK 140

Query: 109 TFGCGSAIASSSYMTELVRGKTLEDAAKIKNTEIARELSLPPVKLHCSMLAEDAIKAAIK 168
           TFGCGSAIASSSYMTELV G TL+DAAKIKNT IA+ELSLPPVKLHCSMLAEDAIKAAIK
Sbjct: 141 TFGCGSAIASSSYMTELVHGMTLDDAAKIKNTTIAKELSLPPVKLHCSMLAEDAIKAAIK 200

Query: 169 DYQAKRPTT 177
           DY++KR +T
Sbjct: 201 DYKSKRTST 209

>CAGL0J04048g 381327..381764 highly similar to tr|Q12056
           Saccharomyces cerevisiae YOR226c ISU2 or tr|Q03020
           Saccharomyces cerevisiae YPL135w ISU1, hypothetical
           start
          Length = 145

 Score =  230 bits (586), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 106/129 (82%), Positives = 118/129 (91%)

Query: 49  RFYHPKVIDHYTNPRNVGSLDKNLPNVGTGLVGAPACGDVMKLQIQVNDETGVIENVKFK 108
           R YHPKVI+HYTNPRNVGS+DK L NVGTG+VGAPACGDV+KLQIQVND TGVIE  KFK
Sbjct: 14  RMYHPKVIEHYTNPRNVGSMDKTLRNVGTGVVGAPACGDVIKLQIQVNDNTGVIEEAKFK 73

Query: 109 TFGCGSAIASSSYMTELVRGKTLEDAAKIKNTEIARELSLPPVKLHCSMLAEDAIKAAIK 168
           TFGCGSAIASSSY+TELV+G T+EDA KIKN EIA+ELSLPPVKLHCSMLAEDAIKAA++
Sbjct: 74  TFGCGSAIASSSYLTELVQGITIEDAEKIKNIEIAKELSLPPVKLHCSMLAEDAIKAAVR 133

Query: 169 DYQAKRPTT 177
           DY+ KR +T
Sbjct: 134 DYKTKRSST 142

>Scas_700.39
          Length = 161

 Score =  231 bits (588), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 119/132 (90%)

Query: 45  MASARFYHPKVIDHYTNPRNVGSLDKNLPNVGTGLVGAPACGDVMKLQIQVNDETGVIEN 104
           M   R YHPKVIDHYT+PRNVGSLDK   NVGTGLVGAPACGDVM+LQIQVND+TG+IEN
Sbjct: 25  MIQRRLYHPKVIDHYTHPRNVGSLDKKALNVGTGLVGAPACGDVMRLQIQVNDDTGIIEN 84

Query: 105 VKFKTFGCGSAIASSSYMTELVRGKTLEDAAKIKNTEIARELSLPPVKLHCSMLAEDAIK 164
           VKFKTFGCGSAIASSSYMTE+V+G ++ DA  IKNT+IA+ELSLPPVKLHCSMLAEDAIK
Sbjct: 85  VKFKTFGCGSAIASSSYMTEMVKGMSVNDAFLIKNTQIAKELSLPPVKLHCSMLAEDAIK 144

Query: 165 AAIKDYQAKRPT 176
           AAI DY++KR T
Sbjct: 145 AAINDYKSKRTT 156

>Kwal_56.23855
          Length = 605

 Score = 28.1 bits (61), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 44/105 (41%), Gaps = 19/105 (18%)

Query: 81  GAPACGDVMKLQIQ--------VNDETGVIENVKFKTFGCGSAIASSSYMTELVRGKTLE 132
           G PAC D+ K  ++         +D  G+++ +    FG G+  +S     E    K   
Sbjct: 327 GNPACKDLFKKLVEDHFSSNELTSDIEGLVDQLMTCQFGTGNYGSSEEEEVEKDPSKLRR 386

Query: 133 DAAKIKNTEIARELSLPPVKLHCSMLAEDAIKAAIKDYQAKRPTT 177
           D   + +  I         +L+ ++   D I A  KDY+A  P+T
Sbjct: 387 DVTSVHDNLI---------RLNNNL--SDVICAEGKDYEAANPST 420

>YOL076W (MDM20) [4744] chr15 (187023..189413) Protein required for
           transport of mitochondria into growing buds and for
           organization of actin cables, interacts genetically with
           Cin8p [2391 bp, 796 aa]
          Length = 796

 Score = 28.1 bits (61), Expect = 4.2,   Method: Composition-based stats.
 Identities = 16/58 (27%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 116 IASSSYMTELVRGKTLEDAAKIKNTEIAREL--SLPPVKLHCSMLAEDAIKAAIKDYQ 171
           + S +Y+T++   KTL+   +IK+ EI + +  SL  ++  C  + +   KA ++ Y+
Sbjct: 701 MVSHTYLTKMATLKTLDSLKRIKDKEIQKLIKNSLKELRSCCDDVFKGYSKALVQAYE 758

>YDR502C (SAM2) [1317] chr4 complement(1453298..1454452)
           S-adenosylmethionine synthetase 2 [1155 bp, 384 aa]
          Length = 384

 Score = 27.3 bits (59), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 34/76 (44%), Gaps = 4/76 (5%)

Query: 75  VGTGLVGAPACGDVMKLQIQVNDETGVIENVKFKTFGCGSAIASSSYMTELVRGK-TLED 133
           V   LV A  C    ++Q+Q +   G+ E +       G+A  S   + E+++    L  
Sbjct: 290 VAKSLVAAGLC---KRVQVQFSYAIGIAEPLSLHVDTYGTATKSDDEIIEIIKKNFDLRP 346

Query: 134 AAKIKNTEIARELSLP 149
              +K  ++AR + LP
Sbjct: 347 GVLVKELDLARPIYLP 362

>CAGL0J06226g 587164..588690 highly similar to sp|P39006
           Saccharomyces cerevisiae YNL169c PSD1, start by
           similarity
          Length = 508

 Score = 27.3 bits (59), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 76  GTGLVGAPACGDVMKLQIQVNDETGVIENVKFKTFGCGSAIASSSY 121
           G  ++  P+ G V+++ I +N ETG +E VK  T+     + + S+
Sbjct: 204 GDEVIVCPSDGKVLQIGI-INSETGEVEQVKGLTYSIKEFLGTHSH 248

>CAGL0K05269g 512844..515129 similar to tr|Q12311 Saccharomyces
           cerevisiae YPR031w, start by similarity
          Length = 761

 Score = 27.3 bits (59), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 20/89 (22%), Positives = 38/89 (42%), Gaps = 2/89 (2%)

Query: 87  DVMKLQIQVNDETGVIENVKFKTFGCGSAIASSSYMTELVRGKTLEDAAKIKNTEIAREL 146
           DV ++   VND    I+  ++     G+ + S  Y  + ++GKT     +I N   + ++
Sbjct: 79  DVQQIPYPVNDFATFIDAKRYSKKSVGNTLISKFYSQDHIQGKTKRRQQRIINAHDSDKI 138

Query: 147 SLPPVKLHCSMLAEDAIKAAIKDYQAKRP 175
                  H + +  D  KA    ++A  P
Sbjct: 139 YKDKFMTHSNQIKRD--KAIQSHFEALSP 165

>CAGL0C00759g complement(78078..80435) similar to sp|P39520
           Saccharomyces cerevisiae YLR223c IFH1 pre-rRNA
           processing machinery control protein, hypothetical start
          Length = 785

 Score = 27.3 bits (59), Expect = 8.9,   Method: Composition-based stats.
 Identities = 11/20 (55%), Positives = 16/20 (80%)

Query: 134 AAKIKNTEIARELSLPPVKL 153
           A +++ +EI R+LSLPPV L
Sbjct: 756 ARQLQESEIERQLSLPPVHL 775

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.131    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,656,834
Number of extensions: 167597
Number of successful extensions: 401
Number of sequences better than 10.0: 21
Number of HSP's gapped: 400
Number of HSP's successfully gapped: 21
Length of query: 178
Length of database: 16,596,109
Length adjustment: 95
Effective length of query: 83
Effective length of database: 13,307,399
Effective search space: 1104514117
Effective search space used: 1104514117
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 58 (26.9 bits)