Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0D07139g1451437591e-105
ACR111C1441435919e-80
Sklu_2012.31441435665e-76
Kwal_26.86781441435544e-74
YOR224C (RPB8)1461455266e-70
Scas_640.231471465214e-69
CAGL0J04070g1501494921e-64
YNL172W (APC1)174858700.24
YGR288W (MAL13)47374622.1
CAGL0C01881g99941586.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D07139g
         (143 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D07139g complement(611102..611539) similar to sp|P20436 Sac...   296   e-105
ACR111C [1158] [Homologous to ScYOR224C (RPB8) - SH] (548897..54...   232   9e-80
Sklu_2012.3 YOR224C, Contig c2012 3508-3942 reverse complement        222   5e-76
Kwal_26.8678                                                          218   4e-74
YOR224C (RPB8) [5016] chr15 complement(760825..761265) Shared su...   207   6e-70
Scas_640.23                                                           205   4e-69
CAGL0J04070g 382116..382568 highly similar to sp|P20436 Saccharo...   194   1e-64
YNL172W (APC1) [4426] chr14 (310636..315882) Component of the an...    32   0.24 
YGR288W (MAL13) [2233] chr7 (1070298..1071719) Maltose pathway r...    28   2.1  
CAGL0C01881g 196299..199298 similar to sp|P38041 Saccharomyces c...    27   6.7  

>KLLA0D07139g complement(611102..611539) similar to sp|P20436
           Saccharomyces cerevisiae YOR224c RPB8 DNA-directed RNA
           polymerase I, II, III 16 KD subunit singleton, start by
           similarity
          Length = 145

 Score =  296 bits (759), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 143/143 (100%), Positives = 143/143 (100%)

Query: 1   MSSALFDDVFTVQEVDTGRYNKVSRIEAQSTSQESCKLTLDINSELFPIKTQDQLAVMIT 60
           MSSALFDDVFTVQEVDTGRYNKVSRIEAQSTSQESCKLTLDINSELFPIKTQDQLAVMIT
Sbjct: 1   MSSALFDDVFTVQEVDTGRYNKVSRIEAQSTSQESCKLTLDINSELFPIKTQDQLAVMIT 60

Query: 61  TSLQLDGSEEPQGTSWRAPPAGTRSLADDYDYVMYGTAYKFEEVKGNKDLLAVYYSFGGL 120
           TSLQLDGSEEPQGTSWRAPPAGTRSLADDYDYVMYGTAYKFEEVKGNKDLLAVYYSFGGL
Sbjct: 61  TSLQLDGSEEPQGTSWRAPPAGTRSLADDYDYVMYGTAYKFEEVKGNKDLLAVYYSFGGL 120

Query: 121 LMRLEGNYRLLNNLKQENAYLLC 143
           LMRLEGNYRLLNNLKQENAYLLC
Sbjct: 121 LMRLEGNYRLLNNLKQENAYLLC 143

>ACR111C [1158] [Homologous to ScYOR224C (RPB8) - SH]
           (548897..549331) [435 bp, 144 aa]
          Length = 144

 Score =  232 bits (591), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 108/143 (75%), Positives = 123/143 (86%), Gaps = 1/143 (0%)

Query: 1   MSSALFDDVFTVQEVDTGRYNKVSRIEAQSTSQESCKLTLDINSELFPIKTQDQLAVMIT 60
           MSS LFDD+FT+QEVD GRYNKVSRIEA STSQ++CKLTLD+N+ELFP++ Q QL VM+ 
Sbjct: 1   MSSTLFDDIFTIQEVDQGRYNKVSRIEAISTSQDTCKLTLDVNTELFPLQPQQQLTVMLA 60

Query: 61  TSLQLDGSEEPQGTSWRAPPAGTRSLADDYDYVMYGTAYKFEEVKGNKDLLAVYYSFGGL 120
           T+L LDG+E+  G SWR P  G RSLADD+DYV YGTAYKFEE  GNKD+LAVYYSFGGL
Sbjct: 61  TTLNLDGTEDSHG-SWRPPAPGARSLADDFDYVTYGTAYKFEEANGNKDMLAVYYSFGGL 119

Query: 121 LMRLEGNYRLLNNLKQENAYLLC 143
           LMRLEGNYRLL+N KQEN YLLC
Sbjct: 120 LMRLEGNYRLLSNFKQENVYLLC 142

>Sklu_2012.3 YOR224C, Contig c2012 3508-3942 reverse complement
          Length = 144

 Score =  222 bits (566), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 119/143 (83%), Gaps = 1/143 (0%)

Query: 1   MSSALFDDVFTVQEVDTGRYNKVSRIEAQSTSQESCKLTLDINSELFPIKTQDQLAVMIT 60
           MS+ LFDD+F VQEVD GRYNKVSRIEA STS E CKLTLDIN++LFP+   D L VM++
Sbjct: 1   MSTTLFDDIFQVQEVDQGRYNKVSRIEATSTSTEQCKLTLDINTDLFPVHVNDNLTVMLS 60

Query: 61  TSLQLDGSEEPQGTSWRAPPAGTRSLADDYDYVMYGTAYKFEEVKGNKDLLAVYYSFGGL 120
           ++L LDG EE    SWRAP  G RSLADDYDYVMYGTAY+FE+V  NKD++AVYYSFGGL
Sbjct: 61  STLNLDGHEES-SVSWRAPQPGQRSLADDYDYVMYGTAYRFEDVNNNKDVIAVYYSFGGL 119

Query: 121 LMRLEGNYRLLNNLKQENAYLLC 143
           LMRLEGNYR L+NLKQENAYLL 
Sbjct: 120 LMRLEGNYRNLSNLKQENAYLLV 142

>Kwal_26.8678
          Length = 144

 Score =  218 bits (554), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 119/143 (83%), Gaps = 1/143 (0%)

Query: 1   MSSALFDDVFTVQEVDTGRYNKVSRIEAQSTSQESCKLTLDINSELFPIKTQDQLAVMIT 60
           MS+ LFDDVF V EVD GRYNKVSRIEA STSQE  +LT+DIN+ELFP++  D L VM++
Sbjct: 1   MSTTLFDDVFQVTEVDLGRYNKVSRIEAHSTSQE-FQLTVDINTELFPVRVNDNLTVMLS 59

Query: 61  TSLQLDGSEEPQGTSWRAPPAGTRSLADDYDYVMYGTAYKFEEVKGNKDLLAVYYSFGGL 120
           +SL LD +E  Q  SWRAP  G RSLADDYDYVMYGTAY+FEEV G KDL+AVYYSFGGL
Sbjct: 60  SSLSLDETETVQNGSWRAPQPGERSLADDYDYVMYGTAYRFEEVAGKKDLIAVYYSFGGL 119

Query: 121 LMRLEGNYRLLNNLKQENAYLLC 143
           LMRLEGNYR L+NLKQENAYLL 
Sbjct: 120 LMRLEGNYRGLSNLKQENAYLLV 142

>YOR224C (RPB8) [5016] chr15 complement(760825..761265) Shared
           subunit of RNA polymerases I, II, and III (ABC14.5) [441
           bp, 146 aa]
          Length = 146

 Score =  207 bits (526), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 104/145 (71%), Positives = 115/145 (79%), Gaps = 5/145 (3%)

Query: 1   MSSALFDDVFTVQEVDTGRYNKVSRIEAQSTSQESCKLTLDINSELFPIKTQDQLAVMIT 60
           MS+ LFDD+F V EVD GRYNKV RIEA ST+Q+ CKLTLDIN ELFP+  QD L V I 
Sbjct: 1   MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIA 60

Query: 61  TSLQLD---GSEEPQGTSWRAPPAGTRSLADDYDYVMYGTAYKFEEVKGNKDLLAVYYSF 117
           +SL L+    ++     SWR P AG RSLADDYDYVMYGTAYKFEEV  +KDL+AVYYSF
Sbjct: 61  SSLNLEDTPANDSSATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEV--SKDLIAVYYSF 118

Query: 118 GGLLMRLEGNYRLLNNLKQENAYLL 142
           GGLLMRLEGNYR LNNLKQENAYLL
Sbjct: 119 GGLLMRLEGNYRNLNNLKQENAYLL 143

>Scas_640.23
          Length = 147

 Score =  205 bits (521), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 115/146 (78%), Gaps = 6/146 (4%)

Query: 1   MSSALFDDVFTVQEVDTGRYNKVSRIEAQSTSQESCKLTLDINSELFPIKTQDQLAVMIT 60
           MS+ LFDD+FTV EVD GRYNKV RIEA ST+QE CKLTLDIN+ELFP+   DQL + I 
Sbjct: 1   MSNTLFDDIFTVSEVDPGRYNKVCRIEATSTTQEQCKLTLDINTELFPVSNNDQLTITIA 60

Query: 61  TSLQLD----GSEEPQGTSWRAPPAGTRSLADDYDYVMYGTAYKFEEVKGNKDLLAVYYS 116
           +SL ++     +++    SWR P    RS+ADDYDYVMYGTAYKFEEV  NKD++AVYYS
Sbjct: 61  SSLSIESDSNANQDAAQRSWRPPQPDERSIADDYDYVMYGTAYKFEEV--NKDIIAVYYS 118

Query: 117 FGGLLMRLEGNYRLLNNLKQENAYLL 142
           FGGLLMRLEGNYR LN LKQENAYLL
Sbjct: 119 FGGLLMRLEGNYRNLNTLKQENAYLL 144

>CAGL0J04070g 382116..382568 highly similar to sp|P20436
           Saccharomyces cerevisiae YOR224c RPB8, start by
           similarity
          Length = 150

 Score =  194 bits (492), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 115/149 (77%), Gaps = 9/149 (6%)

Query: 1   MSSALFDDVFTVQEVDTGRYNKVSRIEAQSTSQESCKLTLDINSELFPIKTQDQLAVMIT 60
           MS+ LFDD+FT+ EVD GRYN V RIEA ST+QE CKLTLDIN+ LFP++  +QL V + 
Sbjct: 1   MSTTLFDDIFTISEVDPGRYNNVCRIEAGSTTQEQCKLTLDINTNLFPVQVNEQLTVTVA 60

Query: 61  TSLQLDGSEEPQ-------GTSWRAPPAGTRSLADDYDYVMYGTAYKFEEVKGNKDLLAV 113
           +SL +D  ++ +         SWR P  G RSLADDYDYVM+GTAYKFEEV  +KD++AV
Sbjct: 61  SSLDVDDDDKAKVNDSTGASRSWRPPQPGDRSLADDYDYVMHGTAYKFEEV--SKDVIAV 118

Query: 114 YYSFGGLLMRLEGNYRLLNNLKQENAYLL 142
           YYSFGGLLMRLEGNYR LNNLKQE AYLL
Sbjct: 119 YYSFGGLLMRLEGNYRNLNNLKQETAYLL 147

>YNL172W (APC1) [4426] chr14 (310636..315882) Component of the
            anaphase-promoting complex (APC), required for Clb2p
            degradation and for the metaphase-anaphase transition
            [5247 bp, 1748 aa]
          Length = 1748

 Score = 31.6 bits (70), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 4/58 (6%)

Query: 86   LADDYDYVM--YGTAYKFEEVKGNKDLLAVYYSFGGLLMRLEGNYRLLNNLKQENAYL 141
            + DD  ++M       KF E+  N DLL +YY+  G ++ +   +    NLK  N  L
Sbjct: 1301 IGDDLSFIMKDVDIGVKFSEL--NTDLLPIYYTMAGRILAMGIRFASTGNLKIRNILL 1356

>YGR288W (MAL13) [2233] chr7 (1070298..1071719) Maltose pathway
           regulatory protein, contains a Zn[2]-Cys[6] fungal-type
           binuclear cluster domain [1422 bp, 473 aa]
          Length = 473

 Score = 28.5 bits (62), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 35/74 (47%), Gaps = 15/74 (20%)

Query: 1   MSSALFDDVFTVQEVDTGRYNKVSRIEAQSTSQESCKLTLDINS------ELFPIKTQDQ 54
           +++AL D V        G+Y+   ++EA +   + CK    +N       + F  K Q+ 
Sbjct: 398 IATALVDIV--------GQYDHNMKLEAWNVLHDVCKFAFSLNHYNNDMLKRFSTKCQNA 449

Query: 55  LAVM-ITTSLQLDG 67
           L  + I+  LQLDG
Sbjct: 450 LITLPISKPLQLDG 463

>CAGL0C01881g 196299..199298 similar to sp|P38041 Saccharomyces
           cerevisiae YBL085w BOB1 BEM1 protein-binding protein,
           hypothetical start
          Length = 999

 Score = 26.9 bits (58), Expect = 6.7,   Method: Composition-based stats.
 Identities = 13/41 (31%), Positives = 22/41 (53%)

Query: 47  FPIKTQDQLAVMITTSLQLDGSEEPQGTSWRAPPAGTRSLA 87
           FP    D+++ ++  S ++  S E  G S R   +GTR +A
Sbjct: 472 FPANQNDKVSGLLAPSKEISPSLEMDGLSGRTSSSGTRDVA 512

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.132    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,554,889
Number of extensions: 178518
Number of successful extensions: 469
Number of sequences better than 10.0: 15
Number of HSP's gapped: 460
Number of HSP's successfully gapped: 15
Length of query: 143
Length of database: 16,596,109
Length adjustment: 92
Effective length of query: 51
Effective length of database: 13,411,253
Effective search space: 683973903
Effective search space used: 683973903
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 56 (26.2 bits)