Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0D07117g21821511461e-162
Kwal_26.86762071936743e-90
Scas_651.0d7450730.029
AER124W152283624.9
Kwal_47.1873464949609.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D07117g
         (215 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D07117g complement(609913..610569) similar to ca|CA0805|IPF...   446   e-162
Kwal_26.8676                                                          264   3e-90
Scas_651.0d                                                            33   0.029
AER124W [2628] [Homologous to ScYML059C - SH] complement(873382....    28   4.9  
Kwal_47.18734                                                          28   9.4  

>KLLA0D07117g complement(609913..610569) similar to
           ca|CA0805|IPF12568 Candida albicans unknown function,
           start by similarity
          Length = 218

 Score =  446 bits (1146), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 215/215 (100%), Positives = 215/215 (100%)

Query: 1   MSEIIDMVETDTDIPVQKSDPINDEEFPDSTDSNIRYAAYASRLRTIALTAHRYVAYTSD 60
           MSEIIDMVETDTDIPVQKSDPINDEEFPDSTDSNIRYAAYASRLRTIALTAHRYVAYTSD
Sbjct: 1   MSEIIDMVETDTDIPVQKSDPINDEEFPDSTDSNIRYAAYASRLRTIALTAHRYVAYTSD 60

Query: 61  IGESFRPVFPQAVVKLGYGISWLYILGDVSYITYRAKLKQEGYQLPSGWKPWDELSENNK 120
           IGESFRPVFPQAVVKLGYGISWLYILGDVSYITYRAKLKQEGYQLPSGWKPWDELSENNK
Sbjct: 61  IGESFRPVFPQAVVKLGYGISWLYILGDVSYITYRAKLKQEGYQLPSGWKPWDELSENNK 120

Query: 121 VLKSNVSPDWKMVGLERLIFQSVASMGLPAFTIHSLVKYSGNWFNKQYPKNAMLRTWGPI 180
           VLKSNVSPDWKMVGLERLIFQSVASMGLPAFTIHSLVKYSGNWFNKQYPKNAMLRTWGPI
Sbjct: 121 VLKSNVSPDWKMVGLERLIFQSVASMGLPAFTIHSLVKYSGNWFNKQYPKNAMLRTWGPI 180

Query: 181 SIGLAVVPMLPYAFDKPIEHFLSKYVFPGNHRHSQ 215
           SIGLAVVPMLPYAFDKPIEHFLSKYVFPGNHRHSQ
Sbjct: 181 SIGLAVVPMLPYAFDKPIEHFLSKYVFPGNHRHSQ 215

>Kwal_26.8676
          Length = 207

 Score =  264 bits (674), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 129/193 (66%), Positives = 154/193 (79%), Gaps = 5/193 (2%)

Query: 24  DEEFPDSTDSNIRYAAYASRLRTIALTAHRYVAYTSDIGESFRPVFPQAVVKLGYGISWL 83
           +   PDSTDS +RYAAYASRLRTIAL +HRYVAYTSDIGESFRPVF   +VK GYGISW 
Sbjct: 14  ETHIPDSTDSGVRYAAYASRLRTIALASHRYVAYTSDIGESFRPVFSPFLVKFGYGISWA 73

Query: 84  YILGDVSYITYRAKLKQEGYQLPSGWKPWDELSENN--KVLKSNVS--PDWKMVGLERLI 139
           YI+GDVSY ++ AKL++EG +  +G KPWD + + +  ++ K N+   PDWKMVGLER++
Sbjct: 74  YIIGDVSYTSWVAKLQKEG-RYRAGLKPWDPVPDVDVQQIEKGNLEKLPDWKMVGLERMV 132

Query: 140 FQSVASMGLPAFTIHSLVKYSGNWFNKQYPKNAMLRTWGPISIGLAVVPMLPYAFDKPIE 199
           FQSVASMGLPAFTIHS VKYSG WFNKQ+PKNA LRTWGPI +GL+VVP LPY FDKPIE
Sbjct: 133 FQSVASMGLPAFTIHSAVKYSGKWFNKQFPKNAALRTWGPIGLGLSVVPALPYIFDKPIE 192

Query: 200 HFLSKYVFPGNHR 212
           H L +   P + +
Sbjct: 193 HLLEQVFHPHHEK 205

>Scas_651.0d
          Length = 74

 Score = 32.7 bits (73), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 4/50 (8%)

Query: 146 MGLPAFTIHSLVKYSGNWFN--KQYPKNAMLRTWGPISIGLAVVPMLPYA 193
           M   A   H++ K +GN F   K+Y +NA  +T+GP+S  LA    L +A
Sbjct: 24  MAATAMLQHAVKKNAGNSFASFKEYRENA--KTYGPLSASLATRRKLAHA 71

>AER124W [2628] [Homologous to ScYML059C - SH]
           complement(873382..877950) [4569 bp, 1522 aa]
          Length = 1522

 Score = 28.5 bits (62), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 39/83 (46%), Gaps = 9/83 (10%)

Query: 132 MVGLERL----IFQSVASMGLPAFTIHSLVKYSGNWFNKQYPKNAMLRTWGPISIGLAV- 186
           M+ + RL    I Q  + +  P   ++S   Y  + FN   P +A   +WG  S G ++ 
Sbjct: 908 MIRVSRLVAHKILQRSSDIREPTKIVNSANGYRYD-FNLTIPPSAGTSSWGNNSDGGSIS 966

Query: 187 ---VPMLPYAFDKPIEHFLSKYV 206
              + +LP  +  P+E F +K V
Sbjct: 967 YKTITILPITYGLPVEEFANKLV 989

>Kwal_47.18734
          Length = 649

 Score = 27.7 bits (60), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 2/49 (4%)

Query: 22  INDEEFP-DSTDSNIRYAAYASRLRTIALTAHRYVAYT-SDIGESFRPV 68
            N+   P D  DSN+ Y+ Y +   T+A   + Y  YT  + GE   P 
Sbjct: 199 FNNSRIPGDGRDSNVLYSMYENLFITVAFRGNFYKLYTHRETGEVLTPA 247

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.136    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,580,092
Number of extensions: 320594
Number of successful extensions: 779
Number of sequences better than 10.0: 8
Number of HSP's gapped: 778
Number of HSP's successfully gapped: 8
Length of query: 215
Length of database: 16,596,109
Length adjustment: 97
Effective length of query: 118
Effective length of database: 13,238,163
Effective search space: 1562103234
Effective search space used: 1562103234
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)