Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0D07095g24624210871e-152
Sklu_2012.22532355251e-66
Kwal_26.86732762415219e-66
YOR223W2922654578e-56
ACR110W2522304451e-54
CAGL0J04092g3012764091e-48
Scas_640.24*2892714082e-48
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D07095g
         (242 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D07095g 608975..609715 similar to sgd|S0005749 Saccharomyce...   423   e-152
Sklu_2012.2 YOR223W, Contig c2012 1288-2049                           206   1e-66
Kwal_26.8673                                                          205   9e-66
YOR223W (YOR223W) [5015] chr15 (759782..760660) Protein of unkno...   180   8e-56
ACR110W [1157] [Homologous to ScYOR223W - SH] complement(548056....   176   1e-54
CAGL0J04092g complement(382821..383726) similar to tr|Q12015 Sac...   162   1e-48
Scas_640.24*                                                          161   2e-48

>KLLA0D07095g 608975..609715 similar to sgd|S0005749 Saccharomyces
           cerevisiae YOR223w hypothetical protein, start by
           similarity
          Length = 246

 Score =  423 bits (1087), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 211/242 (87%), Positives = 211/242 (87%)

Query: 1   MSLSETGHGRKAVVIRFANDTIADLQLDITNIDPTLVTTSWLRRMCRQLKPTETRGKRLR 60
           MSLSETGHGRKAVVIRFANDTIADLQLDITNIDPTLVTTSWLRRMCRQLKPTETRGKRLR
Sbjct: 1   MSLSETGHGRKAVVIRFANDTIADLQLDITNIDPTLVTTSWLRRMCRQLKPTETRGKRLR 60

Query: 61  FIKNGRPLNSHSDLGIESFKDNPNITEMYIHGIIGAGLTAXXXXXXXXXXXXFSNTNENG 120
           FIKNGRPLNSHSDLGIESFKDNPNITEMYIHGIIGAGLTA            FSNTNENG
Sbjct: 61  FIKNGRPLNSHSDLGIESFKDNPNITEMYIHGIIGAGLTAEELINEDNLDDDFSNTNENG 120

Query: 121 TTQAIGFDRLRSVGFSEQEIDLLRQQFLATYGDLETMPNQQQRDIRQLEEQWMETGVNDP 180
           TTQAIGFDRLRSVGFSEQEIDLLRQQFLATYGDLETMPNQQQRDIRQLEEQWMETGVNDP
Sbjct: 121 TTQAIGFDRLRSVGFSEQEIDLLRQQFLATYGDLETMPNQQQRDIRQLEEQWMETGVNDP 180

Query: 181 QGQQFNSIGIANWKSNMDXXXXXXXXXXXXXXXXXXXKQQGLFSQRQKMSIVAGLIFNIA 240
           QGQQFNSIGIANWKSNMD                   KQQGLFSQRQKMSIVAGLIFNIA
Sbjct: 181 QGQQFNSIGIANWKSNMDLLIGLSIGSLLGVFSLLLLKQQGLFSQRQKMSIVAGLIFNIA 240

Query: 241 WW 242
           WW
Sbjct: 241 WW 242

>Sklu_2012.2 YOR223W, Contig c2012 1288-2049
          Length = 253

 Score =  206 bits (525), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 111/235 (47%), Positives = 153/235 (65%), Gaps = 8/235 (3%)

Query: 12  AVVIRFANDTIADLQLDITNIDPTLVTTSWLRRMCRQLKPTETRGKRLRFIKNGRPLNSH 71
           ++V+RF++  I DL LDI+N+    + T+WLRRMCRQL+   T  KRL+FI++GRPLNS+
Sbjct: 16  SIVVRFSDVAIHDLTLDISNLPWDSINTNWLRRMCRQLRKEATTNKRLKFIRSGRPLNSN 75

Query: 72  SDLGIE---SFKDNPNITEMYIHGIIGAGLTAXXXXXXXXXXXXFSNTNENGTTQAIGFD 128
           ++   E    F+ +   T+ Y+H I+G  LT                +NE  TTQA+GFD
Sbjct: 76  TNFASELQQFFQQDTENTKYYVHCIVGQDLTE-EELANEDVLDDIGPSNEGTTTQAVGFD 134

Query: 129 RLRSVGFSEQEIDLLRQQFLATYGDLETMPNQQQ--RDIRQLEEQWMETGVNDPQGQQFN 186
           RLRSVGFS++EI+LLR+QF +TYGDLE +  + Q  RDIRQLEEQWME+GV+D    QFN
Sbjct: 135 RLRSVGFSDEEIELLREQFRSTYGDLENVVQESQGGRDIRQLEEQWMESGVSDE--DQFN 192

Query: 187 SIGIANWKSNMDXXXXXXXXXXXXXXXXXXXKQQGLFSQRQKMSIVAGLIFNIAW 241
           S+ IA++K N D                   KQ+GLFS+RQKM++VAGL+ N+ +
Sbjct: 193 SVPIADYKRNRDLLIGLIIGCLLGIFSLLLLKQEGLFSKRQKMAVVAGLLVNLFF 247

>Kwal_26.8673
          Length = 276

 Score =  205 bits (521), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 112/241 (46%), Positives = 151/241 (62%), Gaps = 5/241 (2%)

Query: 3   LSETGHGRKAVVIRFANDTIADLQLDITNIDPTLVTTSWLRRMCRQLKPTETRGKRLRFI 62
           L+ T    K VV+RF+++ + DL L+++N+    + T WLRRMCRQL+   T  KRLRFI
Sbjct: 30  LASTSASGKLVVVRFSDEQLEDLPLNVSNVPLNEINTRWLRRMCRQLRGRFTGNKRLRFI 89

Query: 63  KNGRPLNSHSDLGIESFKDNPNITEMYIHGIIGAGLTAXXXXXXXXXXXXFSNTNENGTT 122
           +NGR L+ +SDL ++ + +  N  + Y+H I+G  LT               NT E  T 
Sbjct: 90  RNGRFLDINSDLQLQQYFEGSN-DKFYVHCIVGQELTPEELENEDVLDEAQQNT-EGTTA 147

Query: 123 QAIGFDRLRSVGFSEQEIDLLRQQFLATYGDLETMP--NQQQRDIRQLEEQWMETGVNDP 180
           QAIGFDRLRSVGFSE+EI+LLRQ+F +TYGDLE +   N + RDIRQLEEQWMETG N+ 
Sbjct: 148 QAIGFDRLRSVGFSEEEIELLRQRFRSTYGDLEELSRGNDEARDIRQLEEQWMETGANE- 206

Query: 181 QGQQFNSIGIANWKSNMDXXXXXXXXXXXXXXXXXXXKQQGLFSQRQKMSIVAGLIFNIA 240
           +  Q  S+GIAN+K N D                   KQ GLF++RQKM++V GL+ N+ 
Sbjct: 207 ENDQLGSVGIANYKHNTDLLVGLVVGCVLGVFSLLLMKQDGLFNKRQKMAMVGGLLMNLC 266

Query: 241 W 241
           +
Sbjct: 267 F 267

>YOR223W (YOR223W) [5015] chr15 (759782..760660) Protein of unknown
           function, has low similarity to uncharacterized C.
           albicans Orf6.1950p [879 bp, 292 aa]
          Length = 292

 Score =  180 bits (457), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 108/265 (40%), Positives = 147/265 (55%), Gaps = 32/265 (12%)

Query: 10  RKAVVIRFANDTIADLQLDITNIDPTLVTTSWLRRMCRQLKPTETRGKRLRFIKNGRPLN 69
           +K +VIRF++ ++ DLQL+I+N+  + + T WLRRMCR+L+P +T+ +RL+FI+NG  LN
Sbjct: 23  QKFIVIRFSDVSVRDLQLNISNVPFSNINTHWLRRMCRELRPQQTQKRRLKFIRNGSILN 82

Query: 70  SHSDLGIE-----SFKDNPNIT----------EMYIHGIIGAGLTAXXXXXXXXXXXXFS 114
           +HS +  E        +N N+             YIH IIG                  +
Sbjct: 83  THSKIAEELTHYFDTANNSNVATGTSVAPEQNNYYIHCIIGTEELTQAELANEDLKDDAT 142

Query: 115 NTNENGTTQAIGFDRLRSVGFSEQEIDLLRQQFLATYGDLETMP---------NQQQRDI 165
            +N++ TTQAIGFDRLRSVGF+EQEI+LLRQQF ATYGDLE            + +  DI
Sbjct: 143 PSNDSMTTQAIGFDRLRSVGFTEQEIELLRQQFRATYGDLEEEEERLAQNGNRDDEGHDI 202

Query: 166 RQLEEQWMETG--------VNDPQGQQFNSIGIANWKSNMDXXXXXXXXXXXXXXXXXXX 217
           RQLEEQWME+G               +FNS+ IAN K N D                   
Sbjct: 203 RQLEEQWMESGSGTAQGNGAGGGNEDRFNSVPIANIKHNKDLLLGICVGFFFGVFGILLM 262

Query: 218 KQQGLFSQRQKMSIVAGLIFNIAWW 242
           K  GLF++RQKM+I AG+I N+ + 
Sbjct: 263 KFDGLFNRRQKMAIFAGVIVNVMFC 287

>ACR110W [1157] [Homologous to ScYOR223W - SH]
           complement(548056..548814) [759 bp, 252 aa]
          Length = 252

 Score =  176 bits (445), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 100/230 (43%), Positives = 144/230 (62%), Gaps = 11/230 (4%)

Query: 18  ANDTIADLQLDITNIDPTLVTTSWLRRMCRQLKPTETRGKRLRFIKNGRPLNSHSDLGIE 77
           ++ T+ DL L++++I    VTT WLR M RQ++P +T   RL+FI+NG+PLN+ S+L +E
Sbjct: 23  SDPTLQDLTLEVSSIPYADVTTRWLRAMVRQIRPAKTVRHRLKFIRNGQPLNAMSNLRLE 82

Query: 78  SFKDNPNITE-MYIHGIIGAGLTAXXXXXXXXXXXXFSNTNE--NGTT-QAIGFDRLRSV 133
            F ++    +  YIH I+G  LT               N  +  +GTT + IGFDRLRSV
Sbjct: 83  QFFESAEENDKYYIHCIVGPELTT----EQLQDEDALDNVGQQVDGTTPEVIGFDRLRSV 138

Query: 134 GFSEQEIDLLRQQFLATYGDLET--MPNQQQRDIRQLEEQWMETGVNDPQGQQFNSIGIA 191
           GFS++EI+LLRQQF ATYGDL+T   P+ ++ D+RQLEEQW+ETG  + QG Q +SI  A
Sbjct: 139 GFSDEEIELLRQQFRATYGDLDTSQQPDGERADLRQLEEQWIETGATE-QGAQLSSIPTA 197

Query: 192 NWKSNMDXXXXXXXXXXXXXXXXXXXKQQGLFSQRQKMSIVAGLIFNIAW 241
           N++ NMD                   KQ  LF++RQKM++ AG++ N+ +
Sbjct: 198 NYRYNMDLLIGLMVGCLFGVFSILLLKQGELFTKRQKMAVFAGIVANVIF 247

>CAGL0J04092g complement(382821..383726) similar to tr|Q12015
           Saccharomyces cerevisiae YOR223w, hypothetical start
          Length = 301

 Score =  162 bits (409), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 100/276 (36%), Positives = 141/276 (51%), Gaps = 45/276 (16%)

Query: 11  KAVVIRFANDTIADLQLDITNIDPTLVTTSWLRRMCRQLKPTETRGKRLRFIKNGRPLNS 70
           + +V+RF +DTI DL+L+IT++    + T WLRR+CR+L+  +T  +RLRFI+NG  LNS
Sbjct: 22  RFIVVRFNDDTIPDLKLNITHVSMDTINTQWLRRLCRELRGEQTHRRRLRFIRNGNILNS 81

Query: 71  HSDLG-----------IESFKDNPNITEMYIHGIIGAGLTAXXXXXXXXXXXXFSNTNEN 119
            ++LG            E+ +   N    Y+H IIG                    + ++
Sbjct: 82  RANLGSEILQYFERLQAENTEGTLNELLFYVHCIIGTEDLTDEQLASEDVMDTMGPSADS 141

Query: 120 GTTQAIGFDRLRSVGFSEQEIDLLRQQFLATYGDLE----------------TMPNQQQR 163
            TTQAIGFDRL SVGFSE+EI+LLRQQF +TYGD E                +     +R
Sbjct: 142 VTTQAIGFDRLASVGFSEEEIELLRQQFRSTYGDPEEEDDLLNGDESQSNIGSRGGNARR 201

Query: 164 DIRQLEEQWMETGVNDPQG-----------------QQFNSIGIANWKSNMDXXXXXXXX 206
           DIRQLEE WME+G NDP                    +FNSI + + + N D        
Sbjct: 202 DIRQLEEMWMESG-NDPMATAGDGLQPGRDRNGEVEDRFNSIPVTDIRHNKDLLIGITTG 260

Query: 207 XXXXXXXXXXXKQQGLFSQRQKMSIVAGLIFNIAWW 242
                      K +GLF++RQ+MSI+ G+  N+ + 
Sbjct: 261 FCLGIFALLLMKNEGLFNKRQRMSIIVGVATNVLFC 296

>Scas_640.24*
          Length = 289

 Score =  161 bits (408), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 105/271 (38%), Positives = 141/271 (52%), Gaps = 39/271 (14%)

Query: 10  RKAVVIRFANDTIADLQLDITNIDPTLVTTSWLRRMCRQLKPTETRGKRLRFIKNGRPLN 69
           +K +VIRF++ TIADLQ++IT +  + + T WLR+MCR L+P ET+  RL+FI++G  LN
Sbjct: 13  QKFIVIRFSDVTIADLQINITQVPISNINTHWLRQMCRDLRPRETQSHRLKFIRSGALLN 72

Query: 70  SHSDLGI---ESFKDNPN------------ITEMYIHGIIGAGLTAXXXXXXXXXXXXFS 114
           S S L +   + F+ + +              + YIH IIG+ L +              
Sbjct: 73  SRSSLALQIQDYFRTSASDHTPQQEEEEEEANKFYIHCIIGSDLLSEDELAREDAMDDLG 132

Query: 115 NTNENGTTQAIGFDRLRSVGFSEQEIDLLRQQFLATYGDLETM-----------PNQQQR 163
              E  TTQAIGFDRLR+VGFSE+EI+LLRQQF +TYGDLE              N    
Sbjct: 133 PNEEGRTTQAIGFDRLRAVGFSEREIELLRQQFRSTYGDLEERLQGNDEFEEEGNNNSTT 192

Query: 164 DIRQLEEQW----------METG---VNDPQGQQFNSIGIANWKSNMDXXXXXXXXXXXX 210
           DIRQLEEQW          M+ G   +      +FNSI I N K N D            
Sbjct: 193 DIRQLEEQWMGKWWTWTHEMKMGWLIIMSFDDDRFNSIPITNLKHNKDLLIGIFIGFCFG 252

Query: 211 XXXXXXXKQQGLFSQRQKMSIVAGLIFNIAW 241
                     GL ++RQ+MS+ AG+I NI +
Sbjct: 253 IFAFILMNIDGLLNKRQRMSMFAGIIVNILF 283

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.134    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,973,629
Number of extensions: 270106
Number of successful extensions: 725
Number of sequences better than 10.0: 13
Number of HSP's gapped: 700
Number of HSP's successfully gapped: 13
Length of query: 242
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 143
Effective length of database: 13,168,927
Effective search space: 1883156561
Effective search space used: 1883156561
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 60 (27.7 bits)