Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0D07073g29729315380.0
Kwal_26.866929629313080.0
ACR109W29929211971e-167
Scas_640.2530629610651e-147
CAGL0J04114g30329610241e-141
YPL134C (ODC1)31030310241e-140
YOR222W (ODC2)30729710141e-139
Scas_589.103163037801e-103
ADL049W9122984044e-44
YPR021C (AGC1)9022883825e-41
Sklu_2359.69022983666e-39
Kwal_47.173218812953666e-39
Scas_602.88852933533e-37
CAGL0K02365g9192963411e-35
KLLA0E13453g9062943384e-35
Sklu_2334.23193102931e-30
Scas_691.43343202922e-30
AGL311C3623002853e-29
YJR095W (SFC1)3223042815e-29
CAGL0M09020g3483212652e-26
CAGL0L02079g2973012604e-26
Kwal_47.182163333302572e-25
Scas_489.42973022526e-25
Kwal_33.154463052842501e-24
KLLA0B12826g3192772501e-24
CAGL0J01661g3273042483e-24
Kwal_26.79672973002464e-24
CAGL0K12210g3113042465e-24
Scas_718.53242892458e-24
YPR058W (YMC1)3072922449e-24
Scas_582.73292872459e-24
Kwal_23.43543432682441e-23
CAGL0K08250g2972952422e-23
YBR291C (CTP1)2992992412e-23
AER184W3052942394e-23
CAGL0D01606g3052942394e-23
KLLA0F03212g3052952386e-23
Sklu_1149.22963002376e-23
YJL133W (MRS3)3142942387e-23
Sklu_1926.23052862378e-23
YBR104W (YMC2)3293042389e-23
Sklu_2075.33452702353e-22
Scas_379.23012972324e-22
Scas_667.223062862315e-22
Kwal_55.213353172792325e-22
KLLA0A09383g3662692337e-22
KLLA0E02772g2842882298e-22
Scas_645.93912602311e-21
Sklu_2430.103242802282e-21
CAGL0B03883g3062932272e-21
KLLA0B08503g3032792272e-21
Sklu_2127.52782802262e-21
ACR260W3112862272e-21
YPR011C3263052273e-21
AFR146W2812802227e-21
AFR131C3442672248e-21
KLLA0E09680g3072712202e-20
Sklu_2398.43093012192e-20
Kwal_26.76533252772194e-20
KLLA0E18810g3773022188e-20
CAGL0L05742g3052792159e-20
Sklu_2363.23232992142e-19
YGR257C (MTM1)3662602143e-19
YEL006W3352902124e-19
Kwal_27.124813042972105e-19
CAGL0F08305g3742582109e-19
Kwal_33.140503142832089e-19
KLLA0F17864g3072952071e-18
YIL006W3732932091e-18
YBR085W (AAC3)3072952071e-18
YBL030C (PET9)3182882062e-18
YKR052C (MRS4)3042932052e-18
YNL003C (PET8)2843002042e-18
Scas_718.243372972053e-18
CAGL0J02002g3613002054e-18
Kwal_14.22103152982035e-18
Sklu_1119.13072702026e-18
YOR130C (ORT1)2922882018e-18
Scas_632.92922812018e-18
KLLA0E12353g3052952001e-17
YMR166C3683162021e-17
YKL120W (OAC1)3242771992e-17
Kwal_27.125993043041992e-17
CAGL0F04213g3062881973e-17
Sklu_1275.13113011973e-17
CAGL0H03839g2823001954e-17
CAGL0K11616g3202771965e-17
ADL009W3792961967e-17
KLLA0D15015g3172911957e-17
Scas_709.93652961959e-17
Sklu_2431.53703201951e-16
YLR348C (DIC1)2982791921e-16
Kwal_55.208683802981932e-16
Kwal_56.230113032921912e-16
CAGL0K10362g3012931903e-16
Kwal_33.129883032881893e-16
CAGL0J09790g3002811893e-16
CAGL0F00231g3072711893e-16
Scas_721.273743251904e-16
Kwal_0.2322742961859e-16
YJR077C (MIR1)3112701861e-15
KLLA0E15532g3263001851e-15
YMR056C (AAC1)3092861851e-15
Kwal_33.155973052701842e-15
Sklu_2117.22982921842e-15
Sklu_2432.52882851832e-15
CAGL0F07711g3682471852e-15
Scas_558.22892961813e-15
KLLA0E23705g3681911825e-15
Scas_667.43082931798e-15
Scas_669.63732941791e-14
Scas_715.453052591771e-14
AGL065C3353021781e-14
KLLA0D09889g3642851772e-14
AEL253W3652971772e-14
Sklu_2442.82752981752e-14
Scas_721.1293232031753e-14
Scas_562.123002951743e-14
AAL014C2712981724e-14
YGR096W (TPC1)3142721735e-14
Scas_714.183052991726e-14
Sklu_2037.23103021727e-14
Kwal_26.79723583081737e-14
YDL198C (YHM1)3002781718e-14
Kwal_27.120813693301711e-13
Sklu_2260.53022921691e-13
Scas_673.173142711673e-13
Kwal_27.116262992901673e-13
Scas_697.473282791674e-13
AGL064W2962851664e-13
ADL264C3292721674e-13
CAGL0G01166g2952791655e-13
CAGL0K02915g3423241656e-13
CAGL0B04543g3173091648e-13
Scas_716.293163021649e-13
AER450C3082701631e-12
AFL196W3612821641e-12
Kwal_23.39653072981621e-12
KLLA0D14036g4313241641e-12
CAGL0H10538g2972971621e-12
Sklu_2115.42992871612e-12
YPR128C (ANT1)3282891612e-12
Scas_687.15*3283311594e-12
YOR100C (CRC1)3272881586e-12
KLLA0C13431g3282831586e-12
Kwal_23.35293952801587e-12
Kwal_23.57573072581561e-11
YIL134W (FLX1)3113111551e-11
Scas_702.103022871551e-11
KLLA0B14454g3052701541e-11
KLLA0F13464g3002771541e-11
KLLA0D04950g2742981522e-11
Kwal_23.47313143081532e-11
Scas_717.203563281532e-11
KLLA0E18788g3813141508e-11
Scas_662.123082991489e-11
KLLA0F08547g3083071481e-10
AGL047C3162901471e-10
CAGL0G08910g2893051471e-10
YER053C3002561452e-10
YHR002W (LEU5)3573131462e-10
YMR241W (YHM2)3142971435e-10
YBR192W (RIM2)3771641436e-10
CAGL0D04774g3222921392e-09
AGR191W2982871392e-09
Kwal_27.114192982931382e-09
CAGL0G03135g3073001372e-09
CAGL0M05225g3813381365e-09
AER366W2932911345e-09
ABL023W3092811346e-09
Sklu_2194.33123071346e-09
KLLA0A00979g3433521347e-09
CAGL0K07436g3073091339e-09
AAR036W3172901302e-08
AGR383W2931841275e-08
YFR045W2852181265e-08
AFR542W3102851275e-08
KLLA0F04697g3071831266e-08
KLLA0E08877g2941901267e-08
YDL119C3072891267e-08
CAGL0C02013g3293291259e-08
Kwal_23.30425423171269e-08
Kwal_34.159073122831241e-07
Scas_705.93232861231e-07
KLLA0D04290g1881971202e-07
AFR253W3443261222e-07
Sklu_2433.84203281213e-07
AFR147C3152471213e-07
Sklu_2127.43231531171e-06
Kwal_55.211063282921171e-06
KLLA0D04312g103831091e-06
YNL083W5452941171e-06
Kwal_55.213383231401151e-06
Scas_696.93122821152e-06
KLLA0E02750g3042621142e-06
Scas_613.241771811103e-06
KLLA0C11363g5173181134e-06
Scas_328.1227691096e-06
Scas_578.3*5243021109e-06
CAGL0J05522g5192021091e-05
Kwal_23.29133201851072e-05
ADR036C3403111072e-05
AER419W4932281045e-05
Kwal_47.192282811521035e-05
Sklu_2374.7513831029e-05
Sklu_2435.23443111001e-04
KLLA0B11319g355319992e-04
Scas_671.1*12386720.17
Sklu_1809.266869691.1
AER138C54241672.1
YBR054W (YRO2)34436653.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D07073g
         (293 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces c...   597   0.0  
Kwal_26.8669                                                          508   0.0  
ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C (...   465   e-167
Scas_640.25                                                           414   e-147
CAGL0J04114g complement(384321..385232) similar to sp|Q99297 Sac...   399   e-141
YPL134C (ODC1) [5311] chr16 complement(298570..299502) 2-Oxodica...   399   e-140
YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate ...   395   e-139
Scas_589.10                                                           305   e-103
ADL049W [1692] [Homologous to ScYPR021C - SH] complement(598135....   160   4e-44
YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of...   151   5e-41
Sklu_2359.6 YPR021C, Contig c2359 14617-17325                         145   6e-39
Kwal_47.17321                                                         145   6e-39
Scas_602.8                                                            140   3e-37
CAGL0K02365g 212702..215461 highly similar to tr|Q12482 Saccharo...   135   1e-35
KLLA0E13453g complement(1184806..1187526) similar to sgd|S000622...   134   4e-35
Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement        117   1e-30
Scas_691.4                                                            117   2e-30
AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH] (119645..12...   114   3e-29
YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membr...   112   5e-29
CAGL0M09020g complement(896312..897358) highly similar to sp|P33...   106   2e-26
CAGL0L02079g 243467..244360 highly similar to sp|P38152 Saccharo...   104   4e-26
Kwal_47.18216                                                         103   2e-25
Scas_489.4                                                            101   6e-25
Kwal_33.15446                                                         100   1e-24
KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces...   100   1e-24
CAGL0J01661g 154646..155629 highly similar to tr|Q12251 Saccharo...   100   3e-24
Kwal_26.7967                                                           99   4e-24
CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces...    99   5e-24
Scas_718.5                                                             99   8e-24
YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the mitoc...    99   9e-24
Scas_582.7                                                             99   9e-24
Kwal_23.4354                                                           99   1e-23
CAGL0K08250g complement(820185..821078) highly similar to sp|P23...    98   2e-23
YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondri...    97   2e-23
AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W (...    97   4e-23
CAGL0D01606g complement(169066..169983) highly similar to sp|P32...    97   4e-23
KLLA0F03212g 302915..303832 highly similar to sp|P33303 Saccharo...    96   6e-23
Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement         96   6e-23
YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the mitoc...    96   7e-23
Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement          96   8e-23
YBR104W (YMC2) [293] chr2 (449624..450613) Member of the mitocho...    96   9e-23
Sklu_2075.3 , Contig c2075 6414-7451 reverse complement                95   3e-22
Scas_379.2                                                             94   4e-22
Scas_667.22                                                            94   5e-22
Kwal_55.21335                                                          94   5e-22
KLLA0A09383g complement(818752..819852) similar to sp|P53320 Sac...    94   7e-22
KLLA0E02772g complement(261895..262749) similar to sp|Q12375 Sac...    93   8e-22
Scas_645.9                                                             94   1e-21
Sklu_2430.10 YKL120W, Contig c2430 18856-19830                         92   2e-21
CAGL0B03883g 383602..384522 weakly similar to sp|P32331 Saccharo...    92   2e-21
KLLA0B08503g complement(753498..754409) similar to sp|P32331 Sac...    92   2e-21
Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement         92   2e-21
ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C (...    92   2e-21
YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protei...    92   3e-21
AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH] complement(...    90   7e-21
AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033) [...    91   8e-21
KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaY...    89   2e-20
Sklu_2398.4 , Contig c2398 9476-10405                                  89   2e-20
Kwal_26.7653                                                           89   4e-20
KLLA0E18810g 1663220..1664353 some similarities with sp|P38152 S...    89   8e-20
CAGL0L05742g complement(630844..631761) similar to sp|P10566 Sac...    87   9e-20
Sklu_2363.2 YPR011C, Contig c2363 11969-12940                          87   2e-19
YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member o...    87   3e-19
YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the mit...    86   4e-19
Kwal_27.12481                                                          86   5e-19
CAGL0F08305g complement(827705..828829) similar to sp|P53320 Sac...    86   9e-19
Kwal_33.14050                                                          85   9e-19
KLLA0F17864g complement(1634241..1635164) similar to sp|P32331 S...    84   1e-18
YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the mit...    85   1e-18
YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter p...    84   1e-18
YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP car...    84   2e-18
YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of...    84   2e-18
YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein o...    83   2e-18
Scas_718.24                                                            84   3e-18
CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces c...    84   4e-18
Kwal_14.2210                                                           83   5e-18
Sklu_1119.1 YJR077C, Contig c1119 366-1289                             82   6e-18
YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine...    82   8e-18
Scas_632.9                                                             82   8e-18
KLLA0E12353g complement(1092303..1093220) gi|1351895|sp|P49382|A...    82   1e-17
YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member...    82   1e-17
YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial oxalo...    81   2e-17
Kwal_27.12599                                                          81   2e-17
CAGL0F04213g 419473..420393 highly similar to sp|P18239 Saccharo...    80   3e-17
Sklu_1275.1 , Contig c1275 314-1249                                    80   3e-17
CAGL0H03839g 359987..360835 highly similar to sp|P38921 Saccharo...    80   4e-17
CAGL0K11616g complement(1121834..1122796) highly similar to sp|P...    80   5e-17
ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH] co...    80   7e-17
KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces...    80   7e-17
Scas_709.9                                                             80   9e-17
Sklu_2431.5 YBR192W, Contig c2431 8526-9638                            80   1e-16
YLR348C (DIC1) [3731] chr12 complement(826976..827872) Mitochond...    79   1e-16
Kwal_55.20868                                                          79   2e-16
Kwal_56.23011                                                          78   2e-16
CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375 S...    78   3e-16
Kwal_33.12988                                                          77   3e-16
CAGL0J09790g complement(957759..958661) highly similar to sp|P38...    77   3e-16
CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomy...    77   3e-16
Scas_721.27                                                            78   4e-16
Kwal_0.232                                                             76   9e-16
YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate...    76   1e-15
KLLA0E15532g complement(1383230..1384210) similar to sp|P23500 S...    76   1e-15
YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP c...    76   1e-15
Kwal_33.15597                                                          75   2e-15
Sklu_2117.2 YDL198C, Contig c2117 3737-4633                            75   2e-15
Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement       75   2e-15
CAGL0F07711g complement(751794..752900) similar to sp|Q03829 Sac...    76   2e-15
Scas_558.2                                                             74   3e-15
KLLA0E23705g complement(2099965..2101071) highly similar to sp|P...    75   5e-15
Scas_667.4                                                             74   8e-15
Scas_669.6                                                             74   1e-14
Scas_715.45                                                            73   1e-14
AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH] (585963..58...    73   1e-14
KLLA0D09889g complement(834904..835998) similar to sp|Q03829 Sac...    73   2e-14
AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH] complement(...    73   2e-14
Sklu_2442.8 YNL003C, Contig c2442 12309-13136                          72   2e-14
Scas_721.129                                                           72   3e-14
Scas_562.12                                                            72   3e-14
AAL014C [173] [Homologous to ScYNL003C (PET8) - SH] (317388..318...    71   4e-14
YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiami...    71   5e-14
Scas_714.18                                                            71   6e-14
Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement         71   7e-14
Kwal_26.7972                                                           71   7e-14
YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of t...    70   8e-14
Kwal_27.12081                                                          70   1e-13
Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement         70   1e-13
Scas_673.17                                                            69   3e-13
Kwal_27.11626                                                          69   3e-13
Scas_697.47                                                            69   4e-13
AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH] complement(...    69   4e-13
ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH] (241532..24...    69   4e-13
CAGL0G01166g complement(111298..112185) highly similar to tr|Q06...    68   5e-13
CAGL0K02915g 259026..260054 highly similar to sp|P38702 Saccharo...    68   6e-13
CAGL0B04543g 441599..442552 highly similar to tr|Q12289 Saccharo...    68   8e-13
Scas_716.29                                                            68   9e-13
AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH] (1500683..1...    67   1e-12
AFL196W [2999] [Homologous to ScYMR166C - SH] complement(66955.....    68   1e-12
Kwal_23.3965                                                           67   1e-12
KLLA0D14036g complement(1203522..1204817) some similarities with...    68   1e-12
CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534 Saccha...    67   1e-12
Sklu_2115.4 YDL119C, Contig c2115 2906-3805                            67   2e-12
YPR128C (ANT1) [5547] chr16 complement(791212..792198) Peroxisom...    67   2e-12
Scas_687.15*                                                           66   4e-12
YOR100C (CRC1) [4905] chr15 complement(513295..514278) Mitochond...    65   6e-12
KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomy...    65   6e-12
Kwal_23.3529                                                           65   7e-12
Kwal_23.5757                                                           65   1e-11
YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in tr...    64   1e-11
Scas_702.10                                                            64   1e-11
KLLA0B14454g complement(1268709..1269626) highly similar to sp|P...    64   1e-11
KLLA0F13464g 1246646..1247548 highly similar to sp|P38988 Saccha...    64   1e-11
KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces c...    63   2e-11
Kwal_23.4731                                                           64   2e-11
Scas_717.20                                                            64   2e-11
KLLA0E18788g complement(1661093..1662238) similar to sp|P38702 S...    62   8e-11
Scas_662.12                                                            62   9e-11
KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces c...    62   1e-10
AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803) ...    61   1e-10
CAGL0G08910g complement(853693..854562) similar to sp|P40464 Sac...    61   1e-10
YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of ...    60   2e-10
YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similar...    61   2e-10
YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1 ...    60   5e-10
YBR192W (RIM2) [375] chr2 (607609..608742) Member of the mitocho...    60   6e-10
CAGL0D04774g complement(467712..468680) similar to tr|Q06497 Sac...    58   2e-09
AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH] complement(...    58   2e-09
Kwal_27.11419                                                          58   2e-09
CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces c...    57   2e-09
CAGL0M05225g 563163..564308 highly similar to sp|P38127 Saccharo...    57   5e-09
AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH] complement(...    56   5e-09
ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH] complement(3...    56   6e-09
Sklu_2194.3 YMR241W, Contig c2194 5245-6183                            56   6e-09
KLLA0A00979g complement(92561..93592) weakly similar to sp|P3815...    56   7e-09
CAGL0K07436g complement(734496..735419) highly similar to sp|Q04...    56   9e-09
AAR036W [222] [Homologous to ScYGR096W - SH] complement(406887.....    55   2e-08
AGR383W [4694] [Homologous to ScYDL119C - SH] complement(1436769...    54   5e-08
YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the mit...    53   5e-08
AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH] complement(...    54   5e-08
KLLA0F04697g complement(461126..462049) similar to sp|P40464 Sac...    53   6e-08
KLLA0E08877g complement(791157..792041) similar to sgd|S0002277 ...    53   7e-08
YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member o...    53   7e-08
CAGL0C02013g complement(209930..210919) weakly similar to sp|P38...    53   9e-08
Kwal_23.3042                                                           53   9e-08
Kwal_34.15907                                                          52   1e-07
Scas_705.9                                                             52   1e-07
KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyce...    51   2e-07
AFR253W [3445] [Homologous to ScYFR045W - SH] complement(892939....    52   2e-07
Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement       51   3e-07
AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 3...    51   3e-07
Sklu_2127.4 , Contig c2127 6322-7293                                   50   1e-06
Kwal_55.21106                                                          50   1e-06
KLLA0D04312g 367160..367471 highly similar to sgd|S0006215 Sacch...    47   1e-06
YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the mi...    50   1e-06
Kwal_55.21338                                                          49   1e-06
Scas_696.9                                                             49   2e-06
KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida ...    49   2e-06
Scas_613.24                                                            47   3e-06
KLLA0C11363g complement(975442..976995) similar to sp|P48233 Sac...    48   4e-06
Scas_328.1                                                             47   6e-06
Scas_578.3*                                                            47   9e-06
CAGL0J05522g complement(524930..526489) highly similar to sp|P48...    47   1e-05
Kwal_23.2913                                                           46   2e-05
ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH] (771097..77...    46   2e-05
AER419W [2919] [Homologous to ScYNL083W - SH] complement(1442595...    45   5e-05
Kwal_47.19228                                                          44   5e-05
Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement       44   9e-05
Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement         43   1e-04
KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyce...    43   2e-04
Scas_671.1*                                                            32   0.17 
Sklu_1809.2 YDR194C, Contig c1809 1564-3570 reverse complement         31   1.1  
AER138C [2642] [Homologous to ScYML069W (POB3) - SH] (897283..89...    30   2.1  
YBR054W (YRO2) [244] chr2 (343061..344095) Protein paralog of Mr...    30   3.2  

>KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces
           cerevisiae YPL134c ODC1, start by similarity
          Length = 297

 Score =  597 bits (1538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/293 (100%), Positives = 293/293 (100%)

Query: 1   MSDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIA 60
           MSDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIA
Sbjct: 1   MSDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIA 60

Query: 61  AKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGI 120
           AKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGI
Sbjct: 61  AKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGI 120

Query: 121 CESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGY 180
           CESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGY
Sbjct: 121 CESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGY 180

Query: 181 FGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPR 240
           FGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPR
Sbjct: 181 FGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPR 240

Query: 241 KYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFFRTV 293
           KYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFFRTV
Sbjct: 241 KYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFFRTV 293

>Kwal_26.8669
          Length = 296

 Score =  508 bits (1308), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 239/293 (81%), Positives = 267/293 (91%)

Query: 1   MSDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIA 60
           M+D +PLPF YQF AGAVAG+SEILVMYPLD+VKT MQLQVSGG GPQYKGV DC+KQI 
Sbjct: 1   MTDARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIV 60

Query: 61  AKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGI 120
           AKEG SRLYKGISSP+LMEAPKRATKFACNDEFQKIYK  FG EKLTQ LSILSGASAG 
Sbjct: 61  AKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGC 120

Query: 121 CESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGY 180
           CE+FVVVPFELVKIRLQDVSS +  PI VV+ I+ +EG+LAMYNGLEST+WRHG+WNAGY
Sbjct: 121 CEAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGY 180

Query: 181 FGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPR 240
           FGIIFQVRALLP+A +KS+QTRNDL+AG++GGT+ SL+STPFDVVKSR+QNTAV+ G  R
Sbjct: 181 FGIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGAR 240

Query: 241 KYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFFRTV 293
           KYNWSWP++ TIYKEEGF+ALYKGFVPKVLRLGPGGGILLVVFTG MDFFRT+
Sbjct: 241 KYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFFRTL 293

>ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C
           (ODC1) - SH] complement(546745..547644) [900 bp, 299 aa]
          Length = 299

 Score =  465 bits (1197), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 219/292 (75%), Positives = 250/292 (85%)

Query: 2   SDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAA 61
           SD K LPF+YQF AGAVAGVSEILVMYPLD+VKT MQLQV GG+GP Y GV DCLK+I A
Sbjct: 4   SDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVA 63

Query: 62  KEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGIC 121
            EG  RLYKGISSPILMEAPKRATKFACNDEFQK+YK  FG EKL+QPLS+L+GASAG  
Sbjct: 64  GEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCV 123

Query: 122 ESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYF 181
           E+FVVVPFELVKIRLQD SS +  P+ VV+ IV +EG+LAMYNGLEST+WRH +WN GYF
Sbjct: 124 EAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYF 183

Query: 182 GIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRK 241
           GIIFQ RALLP A  K++   NDL++ ++G ++  +LSTPFDVVKSR+QNTAVIPGV RK
Sbjct: 184 GIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRK 243

Query: 242 YNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFFRTV 293
           YNWS P+L TIY+EEGF+ALYKGFVPKVLRLGPGGGILLVVFTGV+DF R +
Sbjct: 244 YNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGVLDFCRAI 295

 Score = 35.8 bits (81), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 34/84 (40%), Gaps = 1/84 (1%)

Query: 191 LPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALA 250
           +  + TKS        AG V G    L+  P DVVK+R+Q   V  G    Y      L 
Sbjct: 1   MSSSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQ-LQVQGGAGPHYTGVVDCLK 59

Query: 251 TIYKEEGFKALYKGFVPKVLRLGP 274
            I   EG   LYKG    +L   P
Sbjct: 60  KIVAGEGVGRLYKGISSPILMEAP 83

>Scas_640.25
          Length = 306

 Score =  414 bits (1065), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 196/296 (66%), Positives = 242/296 (81%), Gaps = 7/296 (2%)

Query: 2   SDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVS----GGSGPQYKGVFDCLK 57
           + Q PLPF YQFMAGA+AG+SE++VMYPLD+VKT MQLQVS    G S   YKGV DCL 
Sbjct: 6   NTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLS 65

Query: 58  QIAAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGAS 117
           QI  KEGP  +YKGISSP+LMEAPKRA KFA NDEF K++K +FG ++LTQ +S+LSGAS
Sbjct: 66  QIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGAS 125

Query: 118 AGICESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWN 177
           AGI E+ V+VPFELVKIRLQDV+SKF  P+ V+K+I++++G+  +Y+G+EST+WR+ +WN
Sbjct: 126 AGITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWN 185

Query: 178 AGYFGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQN--TAVI 235
           AGYFG+IFQVR LLP A +K E+TRNDL AG VGGT   + +TPFDVVKSR+Q+    +I
Sbjct: 186 AGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEII 245

Query: 236 PGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFFR 291
            GV RKYNW+WP++  IY EEGF+ALYKGFVPKVLRLGPGG +LLVVFT VM+ FR
Sbjct: 246 NGV-RKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVFR 300

>CAGL0J04114g complement(384321..385232) similar to sp|Q99297
           Saccharomyces cerevisiae YOR222w ODC2 or sp|Q03028
           Saccharomyces cerevisiae YPL134c ODC1, start by
           similarity
          Length = 303

 Score =  399 bits (1024), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 194/296 (65%), Positives = 234/296 (79%), Gaps = 7/296 (2%)

Query: 3   DQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGG--SGPQYKGVFDCLKQIA 60
            +KPLPF+YQF++GA AGVSE+LVMYPLD+VKT MQLQV  G  SG  Y GV DCL QI 
Sbjct: 2   SEKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIV 61

Query: 61  AKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGI 120
            +EG SRLYKGISSP+LMEAPKRATKFACND +QK++KDL+G +KLTQ +SILSG+ AG+
Sbjct: 62  KREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGV 121

Query: 121 CESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGY 180
            E+ V+VPFELVKIRLQDV+SKF  P+ VV   + + GIL++YNGLESTMWR+  WN GY
Sbjct: 122 TEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGY 181

Query: 181 FGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLS-SLLSTPFDVVKSRVQNTAVIP--- 236
           FG+IFQ+RALLPKA T +E+T NDL+AGT+GG    S   T   VVKSR+Q+ A      
Sbjct: 182 FGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLAD 241

Query: 237 -GVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFFR 291
             V  KYNW+WP+L  IY EEGF ALYKGF+PK+LRLGPGGGI+LVVF G+M FF+
Sbjct: 242 GTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAFFQ 297

>YPL134C (ODC1) [5311] chr16 complement(298570..299502)
           2-Oxodicarboxylate transporter, has specificity for
           2-oxoadipate and 2-oxoglutarate, member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [933 bp, 310 aa]
          Length = 310

 Score =  399 bits (1024), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 195/303 (64%), Positives = 236/303 (77%), Gaps = 15/303 (4%)

Query: 3   DQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGP----------QYKGV 52
           D +PLPF+YQF AGA+AGVSE+LVMYPLD+VKT MQLQV+    P           Y GV
Sbjct: 5   DNRPLPFIYQFTAGAIAGVSELLVMYPLDVVKTRMQLQVTTKGHPAVVAAKAAVDHYTGV 64

Query: 53  FDCLKQIAAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAE--KLTQPL 110
            DCL +I  KEG S LYKGI+SPILMEAPKRA KF+ ND FQ  YK +F     ++TQ +
Sbjct: 65  MDCLTKIVKKEGFSHLYKGITSPILMEAPKRAIKFSGNDTFQTFYKKIFPTPNGEMTQKI 124

Query: 111 SILSGASAGICESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTM 170
           +I SGASAG  E+FVV PFELVKIRLQDV+S+F +PI VVKN V K G+L+++NGLE+T+
Sbjct: 125 AIYSGASAGAVEAFVVAPFELVKIRLQDVNSQFKTPIEVVKNSVVKGGVLSLFNGLEATI 184

Query: 171 WRHGIWNAGYFGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQ 230
           WRH +WNAGYFGIIFQ+R LLP A T +E+TRNDL+AG +GGT+  LL+TPFDVVKSR+Q
Sbjct: 185 WRHVLWNAGYFGIIFQIRKLLPAAKTSTEKTRNDLIAGAIGGTVGCLLNTPFDVVKSRIQ 244

Query: 231 NTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFF 290
            ++   G  RKYNWS P++  +Y+EEGFKALYKGF PKV+RL PGGG+LLVVFT VMDFF
Sbjct: 245 RSS---GPLRKYNWSLPSVLLVYREEGFKALYKGFAPKVMRLAPGGGLLLVVFTNVMDFF 301

Query: 291 RTV 293
           R V
Sbjct: 302 REV 304

>YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate
           transporter, specific for 2-oxoadipate and
           2-oxoglutarate, member of the mitochondrial carrier
           family (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score =  395 bits (1014), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 178/297 (59%), Positives = 235/297 (79%), Gaps = 7/297 (2%)

Query: 2   SDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVS-------GGSGPQYKGVFD 54
           S+ KPLPF+YQF++GAVAG+SE+ VMYPLD+VKT  QL+V+       G    +Y GV D
Sbjct: 5   SNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVID 64

Query: 55  CLKQIAAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILS 114
           CLK+I  KEG SRLY+GISSP+LMEAPKRATKFACND++QKI+K+LF   + TQ +SI +
Sbjct: 65  CLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIAA 124

Query: 115 GASAGICESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHG 174
           GASAG+ E+ V+VPFEL+KIR+QDV S +  P+  +K  ++ EGI+ +Y G+ESTMWR+ 
Sbjct: 125 GASAGMTEAAVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNA 184

Query: 175 IWNAGYFGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAV 234
           +WN GYFG+I+QVR  +P A TK ++TRNDL+AG +GGT+ ++L+TPFDVVKSR+Q+   
Sbjct: 185 LWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDA 244

Query: 235 IPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFFR 291
           +    +KYNW  P+L  IY+EEGF+ALYKGFVPKV RL PGG ++LVVFTG+M+FFR
Sbjct: 245 VSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFFR 301

>Scas_589.10
          Length = 316

 Score =  305 bits (780), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 147/303 (48%), Positives = 204/303 (67%), Gaps = 15/303 (4%)

Query: 3   DQKP--LPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGS----------GPQYK 50
           D+ P  LPF+YQF++GAVAG+SE ++MYPLD+VKT  QLQ++  +           P++ 
Sbjct: 5   DKDPVKLPFIYQFISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHS 64

Query: 51  GVFDCLKQIAAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPL 110
            +  CL +I  +EG   LYKG+S P+LME PKRA KFA N++FQ+I    F  +++T  +
Sbjct: 65  SILSCLSKILKEEGFKNLYKGMSPPLLMEVPKRAVKFASNEQFQQIMMKKFKLKEVTSTV 124

Query: 111 SILSGASAGICESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTM 170
           ++L+G  AGI ES +VVPFELVKIRLQD  S + SPI   + I+E +G+  +Y G EST+
Sbjct: 125 TLLAGTFAGITESLIVVPFELVKIRLQDAQSDYRSPIRCTRTIIENQGLFGIYAGFESTI 184

Query: 171 WRHGIWNAGYFGIIFQVRALLPKA--STKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSR 228
           WR+ IWNA YFG+IFQV+  +P+A  +TK +  RND L G + G +S  LS PFDVVK+R
Sbjct: 185 WRNTIWNASYFGLIFQVKKFIPRAKSTTKFQGIRNDFLVGAIAGCMSCFLSVPFDVVKTR 244

Query: 229 VQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMD 288
           +Q +         Y W+W ++  IY+ EG K +YKG +P + R GPGGG+LLVVF GV +
Sbjct: 245 MQGSKKTSS-GMCYGWAWQSVFLIYRTEGIKGIYKGILPIICRYGPGGGLLLVVFNGVNE 303

Query: 289 FFR 291
            FR
Sbjct: 304 LFR 306

>ADL049W [1692] [Homologous to ScYPR021C - SH]
           complement(598135..600873) [2739 bp, 912 aa]
          Length = 912

 Score =  160 bits (404), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 103/298 (34%), Positives = 153/298 (51%), Gaps = 32/298 (10%)

Query: 10  VYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLY 69
           +Y F  G+VAG    +V+YP+DMVKT MQ Q       +YK   DCL +I +KEG   LY
Sbjct: 525 IYNFTLGSVAGCIGAMVVYPIDMVKTRMQAQRDFS---KYKNSIDCLLKILSKEGVRGLY 581

Query: 70  KGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESFVVVPF 129
            G+   ++  AP++A K   ND  +       G  KL+ P  I+SGA+AG C+     P 
Sbjct: 582 SGLGPQLIGVAPEKAIKLTVNDHMRATLAGRDG--KLSLPCEIISGATAGACQVVFTNPL 639

Query: 130 ELVKIRLQ-------DVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFG 182
           E+VKIRLQ       D +    + I+V+KN+    G++ +Y G  + + R   ++A YF 
Sbjct: 640 EIVKIRLQVKSDYVADAARNSVNAISVIKNL----GLIGLYRGAGACLLRDIPFSAIYFP 695

Query: 183 IIFQVRALLPKASTKSEQTRND------LLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIP 236
               +++ +     K    RN       L++G + G  ++ L+TPFDV+K+R+Q      
Sbjct: 696 TYAHIKSNVFNFDPKDSDKRNKLNTWQLLVSGGLAGMPAAFLTTPFDVIKTRLQID---- 751

Query: 237 GVPRK----YNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFF 290
             P+K    YN  W A  TI KEEG K+ +KG   +VLR  P  G  L  +    + F
Sbjct: 752 --PKKGESVYNGIWDAARTILKEEGIKSFFKGGPARVLRSSPQFGFTLAAYEIFHNLF 807

>YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [2709 bp, 902 aa]
          Length = 902

 Score =  151 bits (382), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 104/288 (36%), Positives = 148/288 (51%), Gaps = 25/288 (8%)

Query: 10  VYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLY 69
           +Y F  G++AG     V+YP+D +KT MQ Q S     QYK   DCL +I ++EG   LY
Sbjct: 531 LYNFSLGSIAGCIGATVVYPIDFIKTRMQAQRSLA---QYKNSIDCLLKIISREGIKGLY 587

Query: 70  KGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESFVVVPF 129
            G+   ++  AP++A K   ND  +    D  G  KL+    I+SGASAG C+     P 
Sbjct: 588 SGLGPQLIGVAPEKAIKLTVNDFMRNRLTDKNG--KLSLFPEIISGASAGACQVIFTNPL 645

Query: 130 ELVKIRLQDVSSKFTSPIA----VVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIF 185
           E+VKIRLQ  S      I         IV+K G+  +YNG+ + + R   ++A YF    
Sbjct: 646 EIVKIRLQVQSDYVGENIQQANETATQIVKKLGLRGLYNGVAACLMRDVPFSAIYFPTYA 705

Query: 186 QVRALL----PKASTKSE--QTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVP 239
            ++  L    P   TK    +T   L AG + G  ++ L+TPFDV+K+R+Q        P
Sbjct: 706 HLKKDLFDFDPNDKTKRNRLKTWELLTAGAIAGMPAAFLTTPFDVIKTRLQID------P 759

Query: 240 R----KYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVF 283
           R    KYN  + A+ TI KEE F++ +KG   +VLR  P  G  L  +
Sbjct: 760 RKGETKYNGIFHAIRTILKEESFRSFFKGGGARVLRSSPQFGFTLAAY 807

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 22/80 (27%), Positives = 41/80 (51%), Gaps = 1/80 (1%)

Query: 15  AGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGISS 74
           AGA+AG+    +  P D++KT +Q+    G   +Y G+F  ++ I  +E     +KG  +
Sbjct: 733 AGAIAGMPAAFLTTPFDVIKTRLQIDPRKGE-TKYNGIFHAIRTILKEESFRSFFKGGGA 791

Query: 75  PILMEAPKRATKFACNDEFQ 94
            +L  +P+     A  + F+
Sbjct: 792 RVLRSSPQFGFTLAAYELFK 811

>Sklu_2359.6 YPR021C, Contig c2359 14617-17325
          Length = 902

 Score =  145 bits (366), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 100/298 (33%), Positives = 147/298 (49%), Gaps = 32/298 (10%)

Query: 10  VYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLY 69
           +Y F  G++AG     V+YP+D+VKT MQ Q S     QYK   DC  +I ++EG   +Y
Sbjct: 519 IYNFTLGSIAGCIGATVVYPIDLVKTRMQAQRSFS---QYKNSIDCFAKIFSREGIRGIY 575

Query: 70  KGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESFVVVPF 129
            G+   ++  AP++A K   ND  +    D      L     ILSGA AG C+     P 
Sbjct: 576 SGLGPQLIGVAPEKAIKLTVNDYMRGRLMDKHA--NLKWYFEILSGACAGACQVVFTNPL 633

Query: 130 ELVKIRLQ-------DVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFG 182
           E+VKIRLQ       DV     + + V+K +    GI  +Y G+ + + R   ++A YF 
Sbjct: 634 EVVKIRLQVRSEYAGDVLKSQVTALGVIKQL----GIKGLYKGIAACLMRDVPFSAIYFP 689

Query: 183 IIFQVRALLPKASTKSEQTRND------LLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIP 236
               ++  + K   K ++ RN       L+AG + G  ++ L+TPFDV+K+R+Q      
Sbjct: 690 TYAHLKKDVFKYDPKDKKQRNKLKTWELLVAGGLAGMPAAYLTTPFDVIKTRLQID---- 745

Query: 237 GVPRK----YNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFF 290
             PRK    Y   + A  TI KEE FK+ +KG   +VLR  P  G  L  +    + F
Sbjct: 746 --PRKGETRYEGIFHAARTILKEESFKSFFKGGSARVLRSSPQFGFTLAAYEIFQNMF 801

 Score = 59.7 bits (143), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 61/251 (24%), Positives = 115/251 (45%), Gaps = 33/251 (13%)

Query: 1   MSDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLK-QI 59
           M     L + ++ ++GA AG  +++   PL++VK  +Q++       +Y G  D LK Q+
Sbjct: 604 MDKHANLKWYFEILSGACAGACQVVFTNPLEVVKIRLQVR------SEYAG--DVLKSQV 655

Query: 60  AA-----KEGPSRLYKGISSPILMEAPKRATKFAC-----NDEFQKIYKDLFGAEKLTQP 109
            A     + G   LYKGI++ ++ + P  A  F        D F+   KD     KL   
Sbjct: 656 TALGVIKQLGIKGLYKGIAACLMRDVPFSAIYFPTYAHLKKDVFKYDPKDKKQRNKLKTW 715

Query: 110 LSILSGASAGICESFVVVPFELVKIRLQ----DVSSKFTSPIAVVKNIVEKEGILAMYNG 165
             +++G  AG+  +++  PF+++K RLQ       +++       + I+++E   + + G
Sbjct: 716 ELLVAGGLAGMPAAYLTTPFDVIKTRLQIDPRKGETRYEGIFHAARTILKEESFKSFFKG 775

Query: 166 LESTMWRH----GIWNAGYFGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTP 221
             + + R     G   A Y   IFQ   + P    +S  T++D  A  V  + ++   + 
Sbjct: 776 GSARVLRSSPQFGFTLAAYE--IFQ--NMFPLKREESTFTKDDTPA--VTSSFTAFFKSL 829

Query: 222 FDVVKSRVQNT 232
            D  ++  +NT
Sbjct: 830 KDSSRTASENT 840

>Kwal_47.17321
          Length = 881

 Score =  145 bits (366), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 100/295 (33%), Positives = 152/295 (51%), Gaps = 26/295 (8%)

Query: 10  VYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLY 69
           +Y F+ G+VAG      +YP+D+VKT MQ Q +     QYK   DC  +I ++EG   +Y
Sbjct: 501 IYNFLLGSVAGCIGATAVYPIDLVKTRMQAQRNFS---QYKNSIDCFVKIFSREGIRGIY 557

Query: 70  KGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESFVVVPF 129
            G+   ++  AP++A K   ND  +K+  D     +LT PL I+SGA+AG C+     P 
Sbjct: 558 SGLGPQLVGVAPEKAIKLTVNDYVRKLLMD--ENNRLTLPLEIISGAAAGACQVIFTNPL 615

Query: 130 ELVKIRLQDVSSKFTSPIAVVK----NIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIF 185
           E+VKIRLQ V S++   +   +     +V+  G+  +Y GL + + R   ++A YF    
Sbjct: 616 EIVKIRLQ-VRSEYADSLPKSQLTALGVVKSLGLRGLYKGLVACLMRDVPFSAIYFPTYA 674

Query: 186 QVRALL----PKASTKSEQ--TRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVP 239
            ++  +    P+   K  +  T   L AG + G  ++ L+TPFDV+K+R+Q        P
Sbjct: 675 HLKRDIFNYDPQDKNKRARLHTWELLTAGGLAGMPAAYLTTPFDVIKTRLQID------P 728

Query: 240 RK----YNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFF 290
           RK    Y     A  TI KEE FK+ +KG   +VLR  P  G  L  +    + F
Sbjct: 729 RKGETRYTGILHAARTILKEERFKSFFKGGGARVLRSSPQFGFTLAAYEIFQNMF 783

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 57/259 (22%), Positives = 111/259 (42%), Gaps = 35/259 (13%)

Query: 1   MSDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVS-GGSGPQYK----GVFDC 55
           M +   L    + ++GA AG  +++   PL++VK  +Q++     S P+ +    GV   
Sbjct: 586 MDENNRLTLPLEIISGAAAGACQVIFTNPLEIVKIRLQVRSEYADSLPKSQLTALGVVKS 645

Query: 56  LKQIAAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAE--------KLT 107
           L       G   LYKG+ + ++ + P  A  F     +  + +D+F  +        +L 
Sbjct: 646 L-------GLRGLYKGLVACLMRDVPFSAIYFP---TYAHLKRDIFNYDPQDKNKRARLH 695

Query: 108 QPLSILSGASAGICESFVVVPFELVKIRLQ----DVSSKFTSPIAVVKNIVEKEGILAMY 163
               + +G  AG+  +++  PF+++K RLQ       +++T  +   + I+++E   + +
Sbjct: 696 TWELLTAGGLAGMPAAYLTTPFDVIKTRLQIDPRKGETRYTGILHAARTILKEERFKSFF 755

Query: 164 NGLESTMWRH----GIWNAGYFGIIFQVRALLPKASTKSEQTRND--LLAGTVGGTLSSL 217
            G  + + R     G   A Y   IFQ    L  +     +  ND  ++ G     L SL
Sbjct: 756 KGGGARVLRSSPQFGFTLAAYE--IFQNMFPLQHSENNESRETNDTPIVTGMFSNFLESL 813

Query: 218 LSTPFDVVKSRVQNTAVIP 236
             + + V  +     +V P
Sbjct: 814 KKSKYHVEVTEFFGPSVDP 832

>Scas_602.8
          Length = 885

 Score =  140 bits (353), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 96/293 (32%), Positives = 153/293 (52%), Gaps = 21/293 (7%)

Query: 10  VYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLY 69
           ++ F  G+VAG     ++YP+D +KT MQ Q    S  +YK   DCL +I  KEG   LY
Sbjct: 499 IFNFSLGSVAGCIGATLVYPIDFIKTRMQAQ---RSLTKYKNSIDCLVKIFGKEGIRGLY 555

Query: 70  KGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESFVVVPF 129
            G+   ++  AP++A K   ND  +K   D  G  +L     +LSGA+AG C+     P 
Sbjct: 556 SGLGPQLIGVAPEKAIKLTVNDFMRKSLVDKKGNLQLGA--EVLSGATAGACQVVFTNPL 613

Query: 130 ELVKIRLQDVSSKFTSPIA-----VVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGII 184
           E+VKIRLQ V S++T+ +          I+++  ++ +Y G+ + + R   ++A YF   
Sbjct: 614 EIVKIRLQ-VKSEYTNAMIPKSQLTAFQIIKELKLIGLYKGVGACLLRDVPFSAIYFPTY 672

Query: 185 FQVRALL----PKASTKSE--QTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGV 238
             ++  +    P    K +  +T   L AG + G  ++ L+TPFDV+K+R+Q   + PGV
Sbjct: 673 AHLKKNVFQFDPNDKDKRDRLKTWELLTAGALAGVPAAFLTTPFDVIKTRLQ---IEPGV 729

Query: 239 -PRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFF 290
              +Y     A+ TI KEE F++ +KG   +V+R  P  G  L  +    + F
Sbjct: 730 GETRYTGILHAVRTILKEESFRSFFKGGAARVMRSSPQFGFTLAAYELFKNMF 782

 Score = 44.3 bits (103), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 49/96 (51%), Gaps = 7/96 (7%)

Query: 15  AGAVAGVSEILVMYPLDMVKTVMQLQVSGGSG-PQYKGVFDCLKQIAAKEGPSRLYKGIS 73
           AGA+AGV    +  P D++KT  +LQ+  G G  +Y G+   ++ I  +E     +KG +
Sbjct: 701 AGALAGVPAAFLTTPFDVIKT--RLQIEPGVGETRYTGILHAVRTILKEESFRSFFKGGA 758

Query: 74  SPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQP 109
           + ++  +P+     A  +    ++K++F      QP
Sbjct: 759 ARVMRSSPQFGFTLAAYE----LFKNMFNISDDKQP 790

>CAGL0K02365g 212702..215461 highly similar to tr|Q12482
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 919

 Score =  135 bits (341), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 99/296 (33%), Positives = 146/296 (49%), Gaps = 27/296 (9%)

Query: 10  VYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLY 69
           +Y F  G+VAG     ++YP+D VKT MQ Q S     QYK   DC  +I ++EG   +Y
Sbjct: 544 LYNFSLGSVAGCIGATIVYPIDFVKTRMQAQRSLS---QYKNSIDCFLKILSREGIRGVY 600

Query: 70  KGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESFVVVPF 129
            G+   ++  AP++A K   ND  +   KD  G  KL     I+SGASAG C+     P 
Sbjct: 601 SGLGPQLIGVAPEKAIKLTVNDYMRNKLKDKNG--KLGLLSEIISGASAGACQVIFTNPL 658

Query: 130 ELVKIRLQDVSSKFTSPIA-----VVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGII 184
           E+VKIRLQ V  ++ +  A         I+++ G+  +Y G  + + R   ++A YF   
Sbjct: 659 EIVKIRLQ-VKGEYVAENAENAKLTALQIIKRLGLPGLYKGAAACLLRDVPFSAIYFPTY 717

Query: 185 FQVRALL----PKASTKSEQ--TRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGV 238
             ++  L    P    K  +  T   L AG + G  ++ L+TPFDV+K+R+Q        
Sbjct: 718 AHLKRDLFNFDPNDKNKRSRLNTWELLSAGALAGMPAAYLTTPFDVIKTRLQID------ 771

Query: 239 PRK----YNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFF 290
           P+K    Y     A  TI +EE FK+ +KG   +VLR  P  G  L  +    + F
Sbjct: 772 PKKGETIYKGIIHAARTILREESFKSFFKGGAARVLRSSPQFGFTLAAYELFHNIF 827

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 42/178 (23%), Positives = 82/178 (46%), Gaps = 16/178 (8%)

Query: 7   LPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPS 66
           L  + + ++GA AG  +++   PL++VK  +Q++    +          L QI  + G  
Sbjct: 635 LGLLSEIISGASAGACQVIFTNPLEIVKIRLQVKGEYVAENAENAKLTAL-QIIKRLGLP 693

Query: 67  RLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAE--------KLTQPLSILSGASA 118
            LYKG ++ +L + P  A  F     +  + +DLF  +        +L     + +GA A
Sbjct: 694 GLYKGAAACLLRDVPFSAIYFP---TYAHLKRDLFNFDPNDKNKRSRLNTWELLSAGALA 750

Query: 119 GICESFVVVPFELVKIRLQDVSSK----FTSPIAVVKNIVEKEGILAMYNGLESTMWR 172
           G+  +++  PF+++K RLQ    K    +   I   + I+ +E   + + G  + + R
Sbjct: 751 GMPAAYLTTPFDVIKTRLQIDPKKGETIYKGIIHAARTILREESFKSFFKGGAARVLR 808

>KLLA0E13453g complement(1184806..1187526) similar to sgd|S0006225
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 906

 Score =  134 bits (338), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 95/294 (32%), Positives = 141/294 (47%), Gaps = 24/294 (8%)

Query: 10  VYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLY 69
           ++ F  G++AG     V+YP+D+VKT MQ Q    +  QYK   DC+ +I   +G   LY
Sbjct: 505 IHNFTLGSIAGCIGATVVYPIDLVKTRMQAQ---RNSVQYKNSIDCVVKIFQTKGIRGLY 561

Query: 70  KGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESFVVVPF 129
            G+   ++  AP++A K   ND  ++ + +     K  Q   ILSGA+AG C+     P 
Sbjct: 562 SGLGPQLIGVAPEKAIKLTVNDFMRQYFMNKSRTIKWYQ--EILSGATAGACQVVFTNPL 619

Query: 130 ELVKIRLQ---DVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIFQ 186
           E+VKIRLQ   D   +   P      I+ + G+  +Y G  + + R   ++A YF     
Sbjct: 620 EIVKIRLQMRSDYVGENARPQLGAVGIIRQLGLRGLYKGAAACLLRDVPFSAIYFPTYAH 679

Query: 187 VRALLPKASTKSEQTRND------LLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPR 240
           ++  +       +  RN       LLAG + G  ++ L+TPFDV+K+R+Q        PR
Sbjct: 680 LKKDVFNFDPNDKNKRNKLKTWELLLAGGIAGMPAAYLTTPFDVIKTRLQID------PR 733

Query: 241 K----YNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFF 290
           K    Y     A  TI KEE  K+ +KG   +VLR  P  G  L  F      F
Sbjct: 734 KGETTYTGVIHAARTILKEESIKSFFKGGPARVLRSSPQFGFTLAAFEMFQGLF 787

 Score = 61.2 bits (147), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 45/180 (25%), Positives = 89/180 (49%), Gaps = 23/180 (12%)

Query: 1   MSDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQ---VSGGSGPQYKGVFDCLK 57
           M+  + + +  + ++GA AG  +++   PL++VK  +Q++   V   + PQ  G    ++
Sbjct: 590 MNKSRTIKWYQEILSGATAGACQVVFTNPLEIVKIRLQMRSDYVGENARPQL-GAVGIIR 648

Query: 58  QIAAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAE--------KLTQP 109
           Q+    G   LYKG ++ +L + P  A  F     +  + KD+F  +        KL   
Sbjct: 649 QL----GLRGLYKGAAACLLRDVPFSAIYFP---TYAHLKKDVFNFDPNDKNKRNKLKTW 701

Query: 110 LSILSGASAGICESFVVVPFELVKIRLQ----DVSSKFTSPIAVVKNIVEKEGILAMYNG 165
             +L+G  AG+  +++  PF+++K RLQ       + +T  I   + I+++E I + + G
Sbjct: 702 ELLLAGGIAGMPAAYLTTPFDVIKTRLQIDPRKGETTYTGVIHAARTILKEESIKSFFKG 761

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 23/89 (25%), Positives = 41/89 (46%), Gaps = 1/89 (1%)

Query: 13  FMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGI 72
            +AG +AG+    +  P D++KT +Q+    G    Y GV    + I  +E     +KG 
Sbjct: 704 LLAGGIAGMPAAYLTTPFDVIKTRLQIDPRKGE-TTYTGVIHAARTILKEESIKSFFKGG 762

Query: 73  SSPILMEAPKRATKFACNDEFQKIYKDLF 101
            + +L  +P+     A  + FQ ++   F
Sbjct: 763 PARVLRSSPQFGFTLAAFEMFQGLFPSHF 791

>Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement
          Length = 319

 Score =  117 bits (293), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 92/310 (29%), Positives = 145/310 (46%), Gaps = 47/310 (15%)

Query: 12  QFMAGAVAGVSEILVMYPLDMVKTVMQL-QVSGGSGPQYKGVFDCLKQIAAKEGPSRLYK 70
             +AG  AG+ E L  +PLD +K  MQ+ + S   G +  G     + I  +EG   LYK
Sbjct: 13  NLIAGGTAGLFEALCCHPLDTIKVRMQIYRRSALEGIKPPGFIKTGRNIYTEEGLLALYK 72

Query: 71  GISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLS----ILSGASAGICESFVV 126
           G+ + ++   PK A +F+  + ++    D     K T  +S     L+G  AG  E+ +V
Sbjct: 73  GLGAVVIGIIPKMAIRFSSYEFYRSALAD-----KQTGSVSTGNTFLAGVGAGTTEAVLV 127

Query: 127 V-PFELVKIRLQD--------VSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWN 177
           V P E+VKIRLQ          S ++ + +     IV++EGI A+Y G+  T  R     
Sbjct: 128 VNPMEVVKIRLQAQHLHPETAASPRYRNALQACYLIVKEEGIGALYRGVSLTAARQATNQ 187

Query: 178 AGYFGIIFQVRALLPKASTKSEQTRNDLLA-------GTVGGTLSSLLSTPFDVVKSRVQ 230
              F +  +++  L       E  + D L        G + G +    + P D +K+R+Q
Sbjct: 188 GANFTVYSKLKEFL------QEHHKTDALPSWETSCIGLISGAIGPFSNAPLDTIKTRLQ 241

Query: 231 ---NTAVIPGVPRKYNWSWPALATI----YKEEGFKALYKGFVPKVLRLGPGGGILLVVF 283
              +TA + G        W  + TI     KEEGF+ALYKG  P+V+R+ PG  +   V+
Sbjct: 242 KDKSTANMSG--------WSRIVTIGKQLIKEEGFRALYKGITPRVMRVAPGQAVTFTVY 293

Query: 284 TGVMDFFRTV 293
             V +   T+
Sbjct: 294 EFVREHLETL 303

 Score = 67.0 bits (162), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 57/192 (29%), Positives = 88/192 (45%), Gaps = 11/192 (5%)

Query: 110 LSILSGASAGICESFVVVPFELVKIRLQ----DVSSKFTSP--IAVVKNIVEKEGILAMY 163
           +++++G +AG+ E+    P + +K+R+Q            P  I   +NI  +EG+LA+Y
Sbjct: 12  VNLIAGGTAGLFEALCCHPLDTIKVRMQIYRRSALEGIKPPGFIKTGRNIYTEEGLLALY 71

Query: 164 NGLESTMWRHGIWNAGYFGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSS-LLSTPF 222
            GL + +       A  F      R+ L    T S  T N  LAG   GT  + L+  P 
Sbjct: 72  KGLGAVVIGIIPKMAIRFSSYEFYRSALADKQTGSVSTGNTFLAGVGAGTTEAVLVVNPM 131

Query: 223 DVVKSRVQNTAVIP---GVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGIL 279
           +VVK R+Q   + P     PR Y  +  A   I KEEG  ALY+G      R     G  
Sbjct: 132 EVVKIRLQAQHLHPETAASPR-YRNALQACYLIVKEEGIGALYRGVSLTAARQATNQGAN 190

Query: 280 LVVFTGVMDFFR 291
             V++ + +F +
Sbjct: 191 FTVYSKLKEFLQ 202

 Score = 35.0 bits (79), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 43/98 (43%), Gaps = 8/98 (8%)

Query: 197 KSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQ--NTAVIPGVPRKYNWSWPALATIYK 254
           KS     +L+AG   G   +L   P D +K R+Q    + + G+  K          IY 
Sbjct: 6   KSSNPAVNLIAGGTAGLFEALCCHPLDTIKVRMQIYRRSALEGI--KPPGFIKTGRNIYT 63

Query: 255 EEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFFRT 292
           EEG  ALYKG    V+ + P   I    +    +F+R+
Sbjct: 64  EEGLLALYKGLGAVVIGIIPKMAIRFSSY----EFYRS 97

>Scas_691.4
          Length = 334

 Score =  117 bits (292), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 92/320 (28%), Positives = 145/320 (45%), Gaps = 36/320 (11%)

Query: 2   SDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAA 61
           +D+K  P +   +AG  AG+ E L  +PLD +K  MQ+      G +  G     + I +
Sbjct: 7   NDKKSSPLI-NLVAGGTAGLFEALCCHPLDTIKVRMQI-AKRTEGMRPHGFITTGRNIYS 64

Query: 62  KEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGIC 121
            EG   LYKG+ + ++   PK A +F+  + ++    D      +T   + L+G  AGI 
Sbjct: 65  HEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRNALTDK-ETRTITTGNTFLAGVGAGIT 123

Query: 122 ESFVVV-PFELVKIRLQ------------DVSS----------KFTSPIAVVKNIVEKEG 158
           E+ +VV P E+VKIRLQ             VS+          K+ + I     IV++EG
Sbjct: 124 EAVLVVNPMEVVKIRLQAQHLNDLIPQPAGVSAAGTAATVTKPKYANAIHAAYTIVKEEG 183

Query: 159 ILAMYNGLESTMWRHGIWNAGYFGIIFQVRALLPKASTK-SEQTRNDLLAGTVGGTLSSL 217
             A+Y G+  T  R        F +   ++  L K   + S  +      G + G +   
Sbjct: 184 AGALYRGVSLTAARQATNQGANFTVYSYLKDYLQKYHNRESLPSWETSCIGLISGAIGPF 243

Query: 218 LSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATI----YKEEGFKALYKGFVPKVLRLG 273
            + P D +K+R+Q    I       N +W  +  I     KEEGF+ALYKG  P+V+R+ 
Sbjct: 244 SNAPLDTIKTRLQKDKSISS-----NSAWKKIYIIGTQLIKEEGFRALYKGITPRVMRVA 298

Query: 274 PGGGILLVVFTGVMDFFRTV 293
           PG  +   V+  V     T+
Sbjct: 299 PGQAVTFTVYEFVRKHLETL 318

>AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH]
           (119645..120733) [1089 bp, 362 aa]
          Length = 362

 Score =  114 bits (285), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 88/300 (29%), Positives = 141/300 (47%), Gaps = 27/300 (9%)

Query: 1   MSDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIA 60
           MS +K        +AG  AG+ E L  +PLD +K  MQ+      G +  G       I 
Sbjct: 49  MSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIY 108

Query: 61  AKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLS----ILSGA 116
           + EG    YKG+ + ++   PK A +F+  +     Y+ L  A++ T  +S     L+G 
Sbjct: 109 SGEGLLAFYKGLGAVVIGIIPKMAIRFSSYE----FYRTLL-ADRQTGVVSTGNTFLAGV 163

Query: 117 SAGICESFVVV-PFELVKIRLQDVS-------SKFTSPIAVVKNIVEKEGILAMYNGLES 168
            AG+ E+ +VV P E+VKIRLQ           K+ + I     IV++EGI A+Y G+  
Sbjct: 164 GAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSL 223

Query: 169 TMWRHGIWNAGYFGIIFQVRALLPK-ASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKS 227
           T  R        F +  ++   L +   +++  +    L G V G +    + P D +K+
Sbjct: 224 TAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKT 283

Query: 228 RVQNTAVIPGVPRKYNWSWPALATI----YKEEGFKALYKGFVPKVLRLGPGGGILLVVF 283
           R+Q       +      +W  + TI     +EEGF+ALYKG  P+V+R+ PG  +   V+
Sbjct: 284 RLQKDKSTRNLS-----NWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVY 338

 Score = 69.7 bits (169), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 64/222 (28%), Positives = 104/222 (46%), Gaps = 9/222 (4%)

Query: 76  ILMEAPKRATKFACNDEFQKIYKD-LFGAEKLTQP-LSILSGASAGICESFVVVPFELVK 133
           + + A +R+    C+   Q+ Y D    ++K T P +++++G +AG+ E+    P + +K
Sbjct: 23  VYIGARRRSVADPCSAVCQQPYPDNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIK 82

Query: 134 IRLQ--DVSSKFTSPIAVVK---NIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIFQVR 188
           +R+Q    +++ T P   ++   NI   EG+LA Y GL + +       A  F      R
Sbjct: 83  VRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYR 142

Query: 189 ALLPKASTKSEQTRNDLLAGTVGG-TLSSLLSTPFDVVKSRVQNTAVIPGVPR-KYNWSW 246
            LL    T    T N  LAG   G T + L+  P +VVK R+Q   +     + KY  + 
Sbjct: 143 TLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAI 202

Query: 247 PALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMD 288
            A   I KEEG  ALY+G      R     G    V++ +M+
Sbjct: 203 QAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLME 244

>YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membrane
           succinate-fumarate transporter, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [969 bp, 322 aa]
          Length = 322

 Score =  112 bits (281), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 86/304 (28%), Positives = 143/304 (47%), Gaps = 31/304 (10%)

Query: 12  QFMAGAVAGVSEILVMYPLDMVKTVMQL--QVSGGSGPQYKGVFDCLKQIAAKEGPSRLY 69
             MAG  AG+ E L  +PLD +K  MQ+  +V+G    +  G     + I  KEG   LY
Sbjct: 13  NLMAGGTAGLFEALCCHPLDTIKVRMQIYRRVAGIEHVKPPGFIKTGRTIYQKEGFLALY 72

Query: 70  KGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEK--LTQPLSILSGASAGICESFVVV 127
           KG+ + ++   PK A +F+  + ++ +   L   E   ++   + ++G  AGI E+ +VV
Sbjct: 73  KGLGAVVIGIIPKMAIRFSSYEFYRTL---LVNKESGIVSTGNTFVAGVGAGITEAVLVV 129

Query: 128 -PFELVKIRLQ---------DVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWN 177
            P E+VKIRLQ         +   K+ + I     IV++EG+ A+Y G+  T  R     
Sbjct: 130 NPMEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSLTAARQATNQ 189

Query: 178 AGYFGIIFQVRALLPKASTKSEQTRNDLLA-------GTVGGTLSSLLSTPFDVVKSRVQ 230
              F +  +++  L          + D+L        G + G +    + P D +K+R+Q
Sbjct: 190 GANFTVYSKLKEFL------QNYHQMDVLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQ 243

Query: 231 NTAVIPGVPRKYNWSWPAL-ATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDF 289
               I    +        + A + KEEGF+ALYKG  P+V+R+ PG  +   V+  V + 
Sbjct: 244 KDKSISLEKQSGMKKIITIGAQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYEYVREH 303

Query: 290 FRTV 293
              +
Sbjct: 304 LENL 307

 Score = 72.0 bits (175), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 59/201 (29%), Positives = 93/201 (46%), Gaps = 12/201 (5%)

Query: 104 EKLTQP-LSILSGASAGICESFVVVPFELVKIRLQDVSS----KFTSPIAVVKN---IVE 155
           +K + P +++++G +AG+ E+    P + +K+R+Q        +   P   +K    I +
Sbjct: 5   KKASHPAINLMAGGTAGLFEALCCHPLDTIKVRMQIYRRVAGIEHVKPPGFIKTGRTIYQ 64

Query: 156 KEGILAMYNGLESTMWRHGIWNAGYFGIIFQVRALLPKASTKSEQTRNDLLAGTVGG-TL 214
           KEG LA+Y GL + +       A  F      R LL    +    T N  +AG   G T 
Sbjct: 65  KEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRTLLVNKESGIVSTGNTFVAGVGAGITE 124

Query: 215 SSLLSTPFDVVKSRVQNTAVIPGVPR---KYNWSWPALATIYKEEGFKALYKGFVPKVLR 271
           + L+  P +VVK R+Q   + P  P    KYN +  A  TI KEEG  ALY+G      R
Sbjct: 125 AVLVVNPMEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSLTAAR 184

Query: 272 LGPGGGILLVVFTGVMDFFRT 292
                G    V++ + +F + 
Sbjct: 185 QATNQGANFTVYSKLKEFLQN 205

>CAGL0M09020g complement(896312..897358) highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w succinate-fumarate
           transporter, start by similarity
          Length = 348

 Score =  106 bits (265), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 89/321 (27%), Positives = 144/321 (44%), Gaps = 55/321 (17%)

Query: 10  VYQFMAGAVAGVSEILVMYPLDMVKTVMQL----------------------------QV 41
           V   +AG  AG+ E L  +PLD +K  MQ+                              
Sbjct: 12  VVNLVAGGTAGLFEALCCHPLDTIKVRMQIYKRQAAPAAAAVASMAGGAGGAATATVGGG 71

Query: 42  SGGSGPQYKGVFDCLKQIAAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLF 101
              +  +  G     + I A+EG   LYKG+ + ++   PK A +F+  +     Y+ L 
Sbjct: 72  DATAAIKPPGFIRTGRNIYAQEGFLALYKGLGAVVIGIIPKMAIRFSSYE----FYRTLL 127

Query: 102 GAEKLTQPLS----ILSGASAGICESFVVV-PFELVKIRLQ--------DVSS-KFTSPI 147
            A+K T  +S     ++G  AG+ E+ +VV P E+VKIRLQ        D++  K+T+ +
Sbjct: 128 -ADKQTGVVSTSNTFIAGVGAGVTEAVLVVNPMEVVKIRLQAQHLNPNHDLAKPKYTNAV 186

Query: 148 AVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIFQVRALLPK-ASTKSEQTRNDLL 206
                I+++EGI A+Y G+  T  R        F +  ++R  L +   T++  +     
Sbjct: 187 QAGYTIIKEEGISALYRGVSLTAARQATNQGANFTVYSKLREFLQEYHGTETLPSWETSC 246

Query: 207 AGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATI----YKEEGFKALY 262
            G + G +    + P D +K+R+Q          K    W  +A I     KEEGF+ALY
Sbjct: 247 IGLISGAIGPFSNAPLDTIKTRLQKDK---STSFKGESGWKRIAHIGTQLLKEEGFRALY 303

Query: 263 KGFVPKVLRLGPGGGILLVVF 283
           KG  P+V+R+ PG  +   V+
Sbjct: 304 KGITPRVMRVAPGQAVTFTVY 324

 Score = 59.7 bits (143), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 89/219 (40%), Gaps = 37/219 (16%)

Query: 110 LSILSGASAGICESFVVVPFELVKIRLQ-------------------------------D 138
           +++++G +AG+ E+    P + +K+R+Q                               D
Sbjct: 13  VNLVAGGTAGLFEALCCHPLDTIKVRMQIYKRQAAPAAAAVASMAGGAGGAATATVGGGD 72

Query: 139 VSSKFTSP--IAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIFQVRALLPKAST 196
            ++    P  I   +NI  +EG LA+Y GL + +       A  F      R LL    T
Sbjct: 73  ATAAIKPPGFIRTGRNIYAQEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADKQT 132

Query: 197 KSEQTRNDLLAGTVGG-TLSSLLSTPFDVVKSRVQNTAVIPG---VPRKYNWSWPALATI 252
               T N  +AG   G T + L+  P +VVK R+Q   + P       KY  +  A  TI
Sbjct: 133 GVVSTSNTFIAGVGAGVTEAVLVVNPMEVVKIRLQAQHLNPNHDLAKPKYTNAVQAGYTI 192

Query: 253 YKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFFR 291
            KEEG  ALY+G      R     G    V++ + +F +
Sbjct: 193 IKEEGISALYRGVSLTAARQATNQGANFTVYSKLREFLQ 231

>CAGL0L02079g 243467..244360 highly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, hypothetical start
          Length = 297

 Score =  104 bits (260), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 86/301 (28%), Positives = 140/301 (46%), Gaps = 21/301 (6%)

Query: 3   DQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAK 62
           D K +     F+AGA+AG  E  + YP +  KT  +LQ+   S    +     +   A  
Sbjct: 4   DSKKVDPTKSFVAGALAGAVEASITYPFEFAKT--RLQLIDKSSKASRNPLVLIYNTAKT 61

Query: 63  EGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICE 122
           +G   +Y G  + I+    K AT+F   D  + + KD    E L+ P  +L+G  AG+ E
Sbjct: 62  QGVGAIYVGCPAFIVGNTAKAATRFLGYDTIRNLLKDKKTGE-LSGPRGVLAGLGAGLLE 120

Query: 123 SFV-VVPFELVKIRL----QDVSSKF-TSPIAVVKN---IVEKEGILAMYNGLESTMWRH 173
           S V V PFE +K  L    Q V  K+  +  ++ +N   +V+ EG   +Y G+     R 
Sbjct: 121 SVVAVTPFEAIKTVLIDDKQSVRPKYQNNGRSMARNYISLVKDEGFRGLYGGVLPVSMRQ 180

Query: 174 GIWNAGYFGIIFQVRALLPK--ASTKSEQTRNDL--LAGTVGGTLSSLLSTPFDVVKSRV 229
               A   G   +++ L+     + K +   + L  + G   G ++   + P D VK+R+
Sbjct: 181 AANQAVRLGCYNKIKVLVQDYTGAPKDKPLTSGLTFIVGAFSGVVTVYATMPIDTVKTRM 240

Query: 230 QNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDF 289
           Q+         KY+ +     TIYKEEG K  +KG  P++ RL   GGI+  ++  V+ +
Sbjct: 241 QSLTA-----SKYSSTLNCFTTIYKEEGLKTFWKGATPRLGRLILSGGIVFTIYENVLLY 295

Query: 290 F 290
            
Sbjct: 296 L 296

>Kwal_47.18216
          Length = 333

 Score =  103 bits (257), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 88/330 (26%), Positives = 144/330 (43%), Gaps = 58/330 (17%)

Query: 1   MSDQKPLPF-VYQFMAGAVAGVSEILVMYPLDMVKTVMQL-QVSGGSGPQYKGVFDCLKQ 58
           MS++K         +AG  AG+ E L  +PLD +K  MQ+   +   G + +G     + 
Sbjct: 1   MSNRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARD 60

Query: 59  IAAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASA 118
           I+ +EG   LYKG+ + ++   PK A +F   + F+ +  D      ++   + ++G  A
Sbjct: 61  ISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADR-QTGVVSTGNTFVAGVGA 119

Query: 119 GICESFVVV-PFELVKIRLQ----------------------------------DVSSKF 143
           GI E+ +VV P E+VKIRLQ                                    + K+
Sbjct: 120 GITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVTSSSATFSSATTATENVAATPKY 179

Query: 144 TSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIFQVRALLPKASTKSEQTRN 203
            + I     IV++EG  A+Y G+  T  R        F +   +++ L       E  + 
Sbjct: 180 RNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRL------QEYHQT 233

Query: 204 DL-------LAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALA---TIY 253
           D+       L G + G L    + P D +K+R+Q         +   WS   LA    + 
Sbjct: 234 DMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKD---KSTSKDSGWSR-ILAIGRQLI 289

Query: 254 KEEGFKALYKGFVPKVLRLGPGGGILLVVF 283
           +EEGF+ALYKG  P+V+R+ PG  +   V+
Sbjct: 290 REEGFRALYKGITPRVMRVAPGQAVTFTVY 319

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 55/224 (24%), Positives = 87/224 (38%), Gaps = 63/224 (28%)

Query: 110 LSILSGASAGICESFVVVPFELVKIRLQDVS------SKFTSPIAVVKNIVEKEGILAMY 163
           +++++G +AG+ E+    P + +K+R+Q  S       +    I   ++I  +EG LA+Y
Sbjct: 12  INLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALY 71

Query: 164 NGLESTMWRHGIWNAGYFGIIFQV----------RALLPKASTKSEQTRNDLLAGTVGG- 212
            GL + +           GII ++          R LL    T    T N  +AG   G 
Sbjct: 72  KGLGAVV----------IGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAGI 121

Query: 213 TLSSLLSTPFDVVKSRVQ--------------------------------NTAVIPGVPR 240
           T + ++  P +VVK R+Q                                N A  P    
Sbjct: 122 TEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVTSSSATFSSATTATENVAATP---- 177

Query: 241 KYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFT 284
           KY  +  A   I KEEG +ALY+G      R     G    V++
Sbjct: 178 KYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYS 221

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 40/82 (48%), Gaps = 6/82 (7%)

Query: 29  PLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGISSPILMEAPKRATKFA 88
           PLD +KT +Q   S      +  +    +Q+  +EG   LYKGI+  ++  AP +A  F 
Sbjct: 258 PLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFT 317

Query: 89  CNDEFQKIYKDLFGAEKLTQPL 110
               ++ I K L   E LT PL
Sbjct: 318 V---YELIRKKL---EGLTAPL 333

>Scas_489.4
          Length = 297

 Score =  101 bits (252), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 79/302 (26%), Positives = 139/302 (46%), Gaps = 23/302 (7%)

Query: 3   DQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAK 62
           ++KP+  ++ F+AGA+AG  E  + YP +  KT +QL     +  +   V   +   A  
Sbjct: 4   EKKPVDPLHSFIAGALAGAIEASITYPFEFAKTRLQLIDKTSTASRNPLVL--IYNTAKT 61

Query: 63  EGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICE 122
           +G   +Y G  + I+    K   +F   D  + + +D    E L+ P  +++G  AG+ E
Sbjct: 62  QGTGAIYVGCPAFIVGNTAKAGIRFLGFDTIKNMLRDPVTGE-LSGPRGVVAGLGAGLLE 120

Query: 123 SFV-VVPFELVKIRLQDVSSKF-----TSPIAVVKN---IVEKEGILAMYNGLESTMWRH 173
           S V V PFE +K  L D           +   +++N   +V  +GI+ +Y G+     R 
Sbjct: 121 SVVAVTPFEAIKTALIDDKQALKPKYQNNGRGMLRNYGSLVRDQGIMGLYRGVLPVSMRQ 180

Query: 174 GIWNAGYFGIIFQVRALLPKASTKSEQTRN-----DLLAGTVGGTLSSLLSTPFDVVKSR 228
               A   G   +++ ++ +  T + + R        + G   G ++   + P D VK+R
Sbjct: 181 AANQAVRLGCYNKIKTMV-QDYTNAPKDRPLSSGLTFIVGAFSGVVTVYTTMPIDTVKTR 239

Query: 229 VQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMD 288
           +Q+         KY  +    A I+KEEG K  +KG  P++ RL   GGI+  ++  V+ 
Sbjct: 240 MQSLDAT-----KYTSTVNCFAKIFKEEGLKTFWKGATPRLGRLILSGGIVFTIYENVLV 294

Query: 289 FF 290
           F 
Sbjct: 295 FL 296

>Kwal_33.15446
          Length = 305

 Score =  100 bits (250), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 78/284 (27%), Positives = 132/284 (46%), Gaps = 19/284 (6%)

Query: 13  FMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGI 72
           F++G  +G+++  V +P D +K  ++LQ S  +G ++KG  DC+ Q   ++G    Y G 
Sbjct: 22  FVSGMFSGIAKNAVGHPFDTIK--VRLQTSQDTG-RFKGPLDCVYQTMRQQGIRGFYLGF 78

Query: 73  SSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLS--ILSGASAGICESFVVVPFE 130
           + P++      +    C   ++ + K      +   PLS  ILSG  AG   SF+  P E
Sbjct: 79  TPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVE 138

Query: 131 LVKIRLQ----DVSSKFTSPIAVVKNIVEKEGILAMYNGLESTM--WRHGIWNAGYFGII 184
           L K +LQ      ++++  P+ V+K +   +GI  MY GL ST+    H ++  G + ++
Sbjct: 139 LAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHFVYWWGSYELL 198

Query: 185 FQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLST-PFDVVKSRVQNTAVIPGVPRKYN 243
            +      KA+T    T  +  AG    +     +  P DV+K  +       G  R + 
Sbjct: 199 TR----WFKANTNLSDTAINFWAGGFSASFGFWTTAYPSDVIKQVILCNDKYDGSLRSWR 254

Query: 244 WSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVM 287
               A + I++  G +  +KGFVP  LR  P     L  F  V+
Sbjct: 255 ---NAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFVL 295

 Score = 56.2 bits (134), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 80/172 (46%), Gaps = 7/172 (4%)

Query: 104 EKLTQPLSILSGASAGICESFVVVPFELVKIRLQDV--SSKFTSPIAVVKNIVEKEGILA 161
           E  ++ +  +SG  +GI ++ V  PF+ +K+RLQ    + +F  P+  V   + ++GI  
Sbjct: 14  EAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRG 73

Query: 162 MYNGLESTMWRHGIWNAGYFGIIFQVRALLPKASTKSEQT---RNDLLAGTVGGTLSSLL 218
            Y G    +    + ++   G +   R LL K   + E+       +L+G + G   S +
Sbjct: 74  FYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFI 133

Query: 219 STPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVL 270
           + P ++ K+++Q          +Y      +  +Y  +G + +YKG V  ++
Sbjct: 134 AAPVELAKAKLQ--VQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLI 183

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 42/77 (54%), Gaps = 1/77 (1%)

Query: 3   DQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAK 62
            ++ LP     ++G +AG S   +  P+++ K  +Q+Q    +  +Y+G  D +K++ A 
Sbjct: 110 HEEKLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQT-TRYRGPLDVIKKVYAA 168

Query: 63  EGPSRLYKGISSPILME 79
           +G   +YKG+ S ++  
Sbjct: 169 DGIRGMYKGLVSTLIFR 185

>KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces
           cerevisiae YKL120w PMT, start by similarity
          Length = 319

 Score =  100 bits (250), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 77/277 (27%), Positives = 126/277 (45%), Gaps = 20/277 (7%)

Query: 13  FMAGAVAGVSEILVMYPLDMVKTVMQLQ--VSGGSGPQYKGVFDCLKQIAAKEGPSRLYK 70
           F+AG +A    + V  P D VKT MQLQ  +   +   Y         I   EG + L K
Sbjct: 24  FVAGGLAACIAVTVTNPFDCVKTRMQLQGELHANAAKVYTNPIQAFGVIFKNEGIAGLQK 83

Query: 71  GISSPILMEAPKRATKFACNDEFQKIYKDLF----GAEKLTQ-PLSILSGASAGICESFV 125
           G++S  L +     ++    +  + I  ++F     + K+    +++ +GA++G+  +F+
Sbjct: 84  GLASAYLYQIALNGSRLGFYEPIRGILNNVFYPNVESHKVQHIGINVAAGATSGVVGAFI 143

Query: 126 VVPFELVKIRLQDVS--------SKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWN 177
             P  LVK R+Q  S        + +TS    +  I   EGI  ++ G+++ M R GI +
Sbjct: 144 GSPLFLVKTRMQSYSNAIHIGQQTHYTSAFNGLATIFRSEGIKGLFRGVDAAMLRTGIGS 203

Query: 178 AGYFGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPG 237
           A    I    +  L K    ++ T   LL+ T+ G    +   P+DVV +RV N      
Sbjct: 204 AVQLPIYNICKNFLLKHDLMNDGTGLHLLSSTIAGFGVGVAMNPWDVVLTRVYNQK---- 259

Query: 238 VPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGP 274
               Y+          + EG  ALYKGF  ++LR+GP
Sbjct: 260 -GNLYSGPIDCFIKTVRNEGLSALYKGFGAQILRIGP 295

 Score = 77.0 bits (188), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 92/203 (45%), Gaps = 15/203 (7%)

Query: 103 AEKLTQPLSILSGASAGICESFVVVPFELVKIRLQ-------DVSSKFTSPIAVVKNIVE 155
           A K+++  S ++G  A      V  PF+ VK R+Q       + +  +T+PI     I +
Sbjct: 15  AHKVSKFGSFVAGGLAACIAVTVTNPFDCVKTRMQLQGELHANAAKVYTNPIQAFGVIFK 74

Query: 156 KEGILAMYNGLESTMWRHGIWNAGYFGIIFQVRALLPKA------STKSEQTRNDLLAGT 209
            EGI  +  GL S        N    G    +R +L         S K +    ++ AG 
Sbjct: 75  NEGIAGLQKGLASAYLYQIALNGSRLGFYEPIRGILNNVFYPNVESHKVQHIGINVAAGA 134

Query: 210 VGGTLSSLLSTPFDVVKSRVQN--TAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVP 267
             G + + + +P  +VK+R+Q+   A+  G    Y  ++  LATI++ EG K L++G   
Sbjct: 135 TSGVVGAFIGSPLFLVKTRMQSYSNAIHIGQQTHYTSAFNGLATIFRSEGIKGLFRGVDA 194

Query: 268 KVLRLGPGGGILLVVFTGVMDFF 290
            +LR G G  + L ++    +F 
Sbjct: 195 AMLRTGIGSAVQLPIYNICKNFL 217

>CAGL0J01661g 154646..155629 highly similar to tr|Q12251
           Saccharomyces cerevisiae YPR011c, start by similarity
          Length = 327

 Score =  100 bits (248), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 81/304 (26%), Positives = 134/304 (44%), Gaps = 30/304 (9%)

Query: 13  FMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGI 72
           F+AG +AG     V+ P + VK ++Q+Q S  +    KG+FD + Q+  +E    L++G 
Sbjct: 27  FLAGGIAGAISRTVVSPFERVKILLQVQSS--TTAYNKGLFDAIGQVYKEENIKGLFRGN 84

Query: 73  SSPILMEAPKRATKFACNDEFQKIYKDLFG------AEKLTQPLSILSGASAGICESFVV 126
               +   P  A +F     F+   K +F        E+L     + SGA  G C     
Sbjct: 85  GLNCIRVFPYSAVQFVV---FEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVAT 141

Query: 127 VPFELVKIRLQ-------DVSSKFTSPIA--------VVKNIVEKEGILAMYNGLESTMW 171
            P +LV+ RL         +S    S IA        + K   E+ GI+ +Y G+  T  
Sbjct: 142 YPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSL 201

Query: 172 RHGIWNAGYFGIIFQVRALLPKASTKSEQTRNDLLA---GTVGGTLSSLLSTPFDVVKSR 228
               + A  F +  Q++  +P     +   R+ L     G + G ++  ++ PFD+++ R
Sbjct: 202 GIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRR 261

Query: 229 VQNTAVIPG-VPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVM 287
            Q  A+    +   YN  W AL TI K EGFK  YKG    + ++ P   +  +V+    
Sbjct: 262 FQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYELTW 321

Query: 288 DFFR 291
           D+ +
Sbjct: 322 DYMK 325

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 79/180 (43%), Gaps = 19/180 (10%)

Query: 12  QFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYK---------GVFDCLKQIAAK 62
           +  +GA+ G   ++  YPLD+V+T + +Q +  S              GV+  L +  A+
Sbjct: 126 RLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAE 185

Query: 63  EGPSR-LYKGISSPILMEAPKRATKFACNDEFQKIY-KDLFGAEKLTQPLSILS-GASAG 119
           EG    LY+G+    L   P  A  FA  ++ ++    D  G   +   L  LS GA +G
Sbjct: 186 EGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISG 245

Query: 120 ICESFVVVPFELVKIRLQ-------DVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWR 172
                +  PF+L++ R Q       ++   + S    +  I + EG    Y GL + +++
Sbjct: 246 GVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFK 305

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 56/208 (26%), Positives = 83/208 (39%), Gaps = 30/208 (14%)

Query: 105 KLTQPLSILSGASAGICESFVVVPFELVKIRLQDVSSKFTSP---IAVVKNIVEKEGILA 161
           K    ++ L+G  AG     VV PFE VKI LQ  SS           +  + ++E I  
Sbjct: 20  KQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKG 79

Query: 162 MYNGLESTMWRHGIWNAGYFGIIFQVRALLPKAST--KSEQTRN--DLLAGTVGGTLSSL 217
           ++ G      R   ++A  F +    +  +    T  K EQ  N   L +G + G  S +
Sbjct: 80  LFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVV 139

Query: 218 LSTPFDVV---------------KSRVQNTAVIPGVPRKYNWSWPALATIYKEE-GFKAL 261
            + P D+V               KSR  + A  PGV       W  L+  Y EE G   L
Sbjct: 140 ATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGV-------WKLLSKAYAEEGGIMGL 192

Query: 262 YKGFVPKVLRLGPGGGILLVVFTGVMDF 289
           Y+G  P  L + P   +   V+  + +F
Sbjct: 193 YRGVWPTSLGIVPYVALNFAVYEQLKEF 220

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 39/80 (48%), Gaps = 2/80 (2%)

Query: 10  VYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGS--GPQYKGVFDCLKQIAAKEGPSR 67
           +Y+   GA++G     + YP D+++   Q+   GG+  G  Y  V+D L  I   EG   
Sbjct: 235 LYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKG 294

Query: 68  LYKGISSPILMEAPKRATKF 87
            YKG+++ +    P  A  +
Sbjct: 295 YYKGLTANLFKVVPSTAVSW 314

>Kwal_26.7967
          Length = 297

 Score = 99.4 bits (246), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 80/300 (26%), Positives = 140/300 (46%), Gaps = 21/300 (7%)

Query: 1   MSDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIA 60
           MS +K +  ++ F+AG++AG  E  + YP +  KT  +LQ+   S    +     + + A
Sbjct: 1   MSQKKQVDPLHSFLAGSLAGAVEASITYPFEFAKT--RLQLVDKSSTASRNPLTLIYRTA 58

Query: 61  AKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGI 120
             +G   +Y G  + I+    K   +F   D  + I +D    E L+ P  I++G  AG+
Sbjct: 59  KVQGLGAVYVGCPAFIVGNTAKAGVRFLGFDAIKNILRDPTTGE-LSGPRGIVAGLGAGL 117

Query: 121 CESFV-VVPFELVKIRL----QDVSSKF-TSPIAVVKN---IVEKEGILAMYNGLESTMW 171
            ES V V PFE +K  L    Q  S K+  +   +++N   +V  +G   +Y G+     
Sbjct: 118 LESVVAVTPFEAIKTALIDDKQSASPKYHNNGRGMLRNYSSLVYDKGFSGLYRGVLPVSM 177

Query: 172 RHGIWNAGYFGIIFQVRALLPK----ASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKS 227
           R     A   G   +++ ++      A  K   +    + G   G ++   + P D VK+
Sbjct: 178 RQAANQAVRLGCYNKIKTMIQDYTNSAKDKPLSSGMTFVVGAFSGIVTVYTTMPIDTVKT 237

Query: 228 RVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVM 287
           R+Q+         KY+ +    AT+++EEG K  +KG  P++ RL   GGI+  ++  V+
Sbjct: 238 RMQSLD-----SSKYSSTINCFATVFREEGLKTFWKGATPRLGRLILSGGIVFTIYEKVL 292

>CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces
           cerevisiae YBR104w YMC2 or sp|P32331 Saccharomyces
           cerevisiae YPR058w YMC1, start by similarity
          Length = 311

 Score = 99.4 bits (246), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 87/304 (28%), Positives = 136/304 (44%), Gaps = 38/304 (12%)

Query: 6   PLPF---VYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAK 62
           P P+   V    AG + GV+++LV  P D  K  +Q      +     GV + ++ +   
Sbjct: 20  PTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQ------TSKTKIGVIEVVQNLLRN 73

Query: 63  EGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQ----PLSI----LS 114
           EG    YKG+ +P+L      + +F  N+  ++ +   + A+++      PL +    L 
Sbjct: 74  EGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAA-YNADRVDPQKHVPLPLHQYYLC 132

Query: 115 GASAGICESFVVVPFELVKIRLQDVSSK-----FTSPIAVVKNIVEKEGILAMYNGLEST 169
           G + G+  SF+  P E V+IRLQ  +S+     F  P   +K + + +   A+  GL  T
Sbjct: 133 GLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAK---ALMRGLLPT 189

Query: 170 MWRHGIWNAGYFGIIFQVRALLPKASTKSEQTRNDLLA------GTVGGTLSSLLSTPFD 223
           M R G     YF       AL+ K   K    RN + A      G + GT+  L   P D
Sbjct: 190 MIRAGHGLGTYFA---AYEALVVKEFEKGT-PRNQIPAWKLCSFGALSGTILWLTVYPVD 245

Query: 224 VVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVF 283
           VVKS +Q  ++    P+  N    A   +YK+ G  A +KGFVP ++R  P      V F
Sbjct: 246 VVKSVLQTDSI--ENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSF 303

Query: 284 TGVM 287
              M
Sbjct: 304 EMTM 307

>Scas_718.5
          Length = 324

 Score = 99.0 bits (245), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 77/289 (26%), Positives = 133/289 (46%), Gaps = 27/289 (9%)

Query: 14  MAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGIS 73
           +AG   G+S+++V  P D  K  MQ      +  +  G  D ++++   EG    YKG  
Sbjct: 44  LAGTCGGISQVIVGQPFDTTKVRMQ------TSAKSVGALDIIRKLVKNEGVWAFYKGSL 97

Query: 74  SPILMEAPKRATKFACNDEFQKIYKDLF---GAEKLTQPLSI----LSGASAGICESFVV 126
            PI+      + +F  N+  ++ +++     G +     L +    + G + G+  SF+ 
Sbjct: 98  IPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLA 157

Query: 127 VPFELVKIRLQDVSS-----KFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYF 181
            P E V+IRLQ  +      +F  P+  ++ +V+++ ++    GL   M R G     YF
Sbjct: 158 SPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLM---RGLRPMMLRAGHGLGCYF 214

Query: 182 GIIFQ--VRALLPKASTKSEQTRNDLLA-GTVGGTLSSLLSTPFDVVKSRVQNTAVIPGV 238
            + ++  +   + K   +SE     L + G++ G +  L   P DVVKS +Q   +    
Sbjct: 215 -LTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRN-- 271

Query: 239 PRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVM 287
           PR  N     +  +Y+E+G  A +KGF P +LR  P  G   V F  VM
Sbjct: 272 PRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVM 320

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 89/185 (48%), Gaps = 13/185 (7%)

Query: 111 SILSGASAGICESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTM 170
            IL+G   GI +  V  PF+  K+R+Q  S+K    + +++ +V+ EG+ A Y G    +
Sbjct: 42  DILAGTCGGISQVIVGQPFDTTKVRMQ-TSAKSVGALDIIRKLVKNEGVWAFYKGSLIPI 100

Query: 171 WRHGIWNAGYFGIIFQVRALLPKAST-KSEQTRNDLL-------AGTVGGTLSSLLSTPF 222
              G   +  FG+   ++    + +T +  Q R+  L        G  GG ++S L++P 
Sbjct: 101 VGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPI 160

Query: 223 DVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVV 282
           + V+ R+Q T    G  R++      +  + KE   K+L +G  P +LR G G G   + 
Sbjct: 161 EHVRIRLQ-TQTGNGNEREFKGPLDCIRKLVKE---KSLMRGLRPMMLRAGHGLGCYFLT 216

Query: 283 FTGVM 287
           +  ++
Sbjct: 217 YEALI 221

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/175 (21%), Positives = 77/175 (44%), Gaps = 10/175 (5%)

Query: 13  FMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGI 72
           ++ G   GV    +  P++ V+  +Q Q   G+  ++KG  DC++++  ++    L +G+
Sbjct: 143 YICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKS---LMRGL 199

Query: 73  SSPILMEAPKRATKFACNDEF--QKIYKDLFGAEKLTQPLSILSGASAGICESFVVVPFE 130
              +L         F   +     +I K    +E  +  L    G+ +G+     + P +
Sbjct: 200 RPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSY-GSLSGVVLWLAIYPLD 258

Query: 131 LVKIRLQD---VSSKFTSPIA-VVKNIVEKEGILAMYNGLESTMWRHGIWNAGYF 181
           +VK  +Q     + +F + +  V+ ++  ++GI A + G   TM R    N   F
Sbjct: 259 VVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATF 313

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 45/99 (45%), Gaps = 9/99 (9%)

Query: 195 STKSEQTR--NDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATI 252
           S   + TR   D+LAGT GG    ++  PFD  K R+Q +A   G       +   +  +
Sbjct: 31  SMAKDSTRVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVG-------ALDIIRKL 83

Query: 253 YKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFFR 291
            K EG  A YKG +  ++ +G    +   V   +  FFR
Sbjct: 84  VKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFR 122

>YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 98.6 bits (244), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 81/292 (27%), Positives = 133/292 (45%), Gaps = 28/292 (9%)

Query: 10  VYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLY 69
           V   +AG   G++++LV  P D  K  ++LQ S  S P      + ++++ A EGP   Y
Sbjct: 26  VKDLLAGTAGGIAQVLVGQPFDTTK--VRLQTS--STPTT--AMEVVRKLLANEGPRGFY 79

Query: 70  KGISSPILMEAPKRATKFACNDEFQKI--YKDLFGAEKLTQPLSILSGASAGICESFVVV 127
           KG  +P++      + +F  N+  ++   +++   +  L+ P     G + GI  SF+  
Sbjct: 80  KGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLAS 139

Query: 128 PFELVKIRLQD-----VSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFG 182
           P E V+IRLQ       +++F  P+  +K +   + +L    GL  T+ R G     YF 
Sbjct: 140 PIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALL---RGLTPTILREGHGCGTYF- 195

Query: 183 IIFQVRALLPKASTKSEQ-TRNDLLA------GTVGGTLSSLLSTPFDVVKSRVQNTAVI 235
           ++++  AL+     K     R D+ A      G + GT   L+  P DV+KS +Q   + 
Sbjct: 196 LVYE--ALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQ 253

Query: 236 PGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVM 287
              P+  N       T+Y   G  A +KGF P +LR  P  G     F   M
Sbjct: 254 K--PKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFELAM 303

 Score = 50.1 bits (118), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 78/188 (41%), Gaps = 12/188 (6%)

Query: 1   MSDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIA 60
           MS    LP  Y    G   G+    +  P++ V+  +Q Q   G+  ++KG  +C+K++ 
Sbjct: 114 MSSTLSLPQYYA--CGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLR 171

Query: 61  AKEGPSRLYKGISSPILMEAPKRATKFACNDEF-QKIYKDLFGAEKLTQPLSILS--GAS 117
             +    L +G++  IL E     T F   +           G E+   P   L   GA 
Sbjct: 172 HNKA---LLRGLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGAL 228

Query: 118 AGICESFVVVPFELVKIRLQDVS---SKFTSPI-AVVKNIVEKEGILAMYNGLESTMWRH 173
           +G     +V P +++K  +Q  +    KF + I +V K +    GI A + G   TM R 
Sbjct: 229 SGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRA 288

Query: 174 GIWNAGYF 181
              N   F
Sbjct: 289 APANGATF 296

>Scas_582.7
          Length = 329

 Score = 99.0 bits (245), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 77/287 (26%), Positives = 128/287 (44%), Gaps = 7/287 (2%)

Query: 8   PFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSR 67
           P  +Q +AGA AG+ E   M+P+D +KT +Q   + G+      +   + +I+  EG   
Sbjct: 35  PLSHQLLAGAFAGIMEHSTMFPIDALKTRIQSTTTKGTEQTSTSIIKQISKISTMEGSLA 94

Query: 68  LYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSI-LSGASAGICESFVV 126
           L+KG+ S IL   P  A  FA   EF K +       +  QP+ + +SGA+A +   F +
Sbjct: 95  LWKGVQSVILGAGPAHAVYFATY-EFTKAHLIPDSQRETHQPIKVAVSGATATVASDFFM 153

Query: 127 VPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIFQ 186
            PF+ +K R+Q    K      V K I   EG+ A Y    +T+  +  + A  F I   
Sbjct: 154 NPFDTIKQRMQISDLKKEKVYNVAKKIYNLEGLSAFYYSYPTTIAMNIPFAAFNFMIYES 213

Query: 187 VRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQ---NTAVIPGVPRKYN 243
                      +       L G + G +++ ++TP D +K+ +Q   ++ V   V +K N
Sbjct: 214 ASKFFNPLHHYNPLIH--CLCGGISGAIAAAVTTPLDCIKTVIQIRGSSVVSLEVMKKAN 271

Query: 244 WSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFF 290
               A + I    G+K  ++G  P++L   P   I    +     F 
Sbjct: 272 TFKKATSAILMVYGWKGFWRGLQPRILANMPATAISWTAYECAKHFL 318

>Kwal_23.4354
          Length = 343

 Score = 98.6 bits (244), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 72/268 (26%), Positives = 131/268 (48%), Gaps = 30/268 (11%)

Query: 48  QYKGVFDCLKQIAAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLT 107
           +Y   +D   +IA  EG   L++G+S  +LM AP     F         Y+ L    +L 
Sbjct: 83  RYNSTWDAFGKIAKIEGVQSLWRGLSITLLMAAPANMVYFIG-------YESLRDKSRLQ 135

Query: 108 QPLSILS----GASAGICESFVVVPFELVKIRLQDV--SSKFTSPIAVVKNIVE------ 155
                L+    GA A +  +  V P EL + RLQ +  SS  ++   ++K++++      
Sbjct: 136 DKYPTLNPLMCGALARVLAATTVAPLELFRTRLQSIPRSSPKSTTAMMIKDLIKESRYEI 195

Query: 156 -KEGILAMYNGLESTMWRHGIWNAGYFGI---------IFQVRALLPKASTKSEQTRNDL 205
            K G  A++ GLE T+WR   +++ Y+G          I   ++++  +++      N  
Sbjct: 196 SKVGYKALFRGLEITLWRDVPFSSIYWGCYEFYKSNVSIDSEKSIVNSSNSNWNHFVNSF 255

Query: 206 LAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWS-WPALATIYKEEGFKALYKG 264
           + G+ GG ++++L+ PFDV K+R+Q T +   + +K + + +  L  + K EG  ALY G
Sbjct: 256 VGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKPSKNMFKYLNQMRKSEGLAALYTG 315

Query: 265 FVPKVLRLGPGGGILLVVFTGVMDFFRT 292
            VP+V+++ P   I++  +      F T
Sbjct: 316 LVPRVIKIAPSCAIMISTYEVCKRLFST 343

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 49/122 (40%), Gaps = 32/122 (26%)

Query: 202 RNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGV----------------------- 238
           +  LL+  VG  L+SL+ TP DVV+ R+Q   ++P                         
Sbjct: 12  KERLLSAVVGSLLTSLILTPMDVVRIRLQQQKMLPDCGCETDAGLTSRASSKGVFWQDIC 71

Query: 239 ---------PRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDF 289
                    P +YN +W A   I K EG ++L++G    +L   P   +  + +  + D 
Sbjct: 72  FEDVRCKTSPVRYNSTWDAFGKIAKIEGVQSLWRGLSITLLMAAPANMVYFIGYESLRDK 131

Query: 290 FR 291
            R
Sbjct: 132 SR 133

 Score = 37.0 bits (84), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 44/91 (48%), Gaps = 2/91 (2%)

Query: 9   FVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQ--YKGVFDCLKQIAAKEGPS 66
           FV  F+ G+  G    ++ +P D+ KT MQ+     +  +   K +F  L Q+   EG +
Sbjct: 251 FVNSFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKPSKNMFKYLNQMRKSEGLA 310

Query: 67  RLYKGISSPILMEAPKRATKFACNDEFQKIY 97
            LY G+   ++  AP  A   +  +  ++++
Sbjct: 311 ALYTGLVPRVIKIAPSCAIMISTYEVCKRLF 341

 Score = 31.2 bits (69), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 42/185 (22%), Positives = 74/185 (40%), Gaps = 25/185 (13%)

Query: 4   QKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVF---DCLKQIA 60
           Q   P +   M GA+A V     + PL++ +T  +LQ    S P+        D +K+  
Sbjct: 135 QDKYPTLNPLMCGALARVLAATTVAPLELFRT--RLQSIPRSSPKSTTAMMIKDLIKESR 192

Query: 61  ---AKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPL------- 110
              +K G   L++G+   +  + P  +  + C  EF K    +   + +           
Sbjct: 193 YEISKVGYKALFRGLEITLWRDVPFSSIYWGCY-EFYKSNVSIDSEKSIVNSSNSNWNHF 251

Query: 111 --SILSGASAGICESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIV-------EKEGILA 161
             S + G+  G   + +  PF++ K R+Q      T      KN+        + EG+ A
Sbjct: 252 VNSFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKPSKNMFKYLNQMRKSEGLAA 311

Query: 162 MYNGL 166
           +Y GL
Sbjct: 312 LYTGL 316

>CAGL0K08250g complement(820185..821078) highly similar to sp|P23500
           Saccharomyces cerevisiae YKR052c Mitochondrial RNA
           splicing protein, hypothetical start
          Length = 297

 Score = 97.8 bits (242), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 82/295 (27%), Positives = 138/295 (46%), Gaps = 28/295 (9%)

Query: 8   PFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSR 67
           P  +Q +AGA AG+ E  V++P+D +KT +Q   S  SG   +G+   + +I   EG   
Sbjct: 15  PLHHQLLAGAFAGIMEHSVLFPVDAIKTRIQ---SSSSGAATQGLIKQISKITTAEGSLA 71

Query: 68  LYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKL--TQPL-SILSGASAGICESF 124
           L+KG+ S IL   P  A  FA   EF K    L   + +   QP+ + +SG +A      
Sbjct: 72  LWKGVQSVILGAGPAHAVYFA-TYEFSK--SKLIDPQDMHTHQPIKTAISGMAATTVADA 128

Query: 125 VVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGII 184
           ++ PF+++K R+Q  + +  S   V KNI  KEG  A Y    +T+    + N  +    
Sbjct: 129 LMNPFDVIKQRMQLNTRE--SVWHVTKNIYHKEGFAAFYYSYPTTL----VMNIPFAAFN 182

Query: 185 FQVRALLPKASTKSEQTRND------LLAGTVGGTLSSLLSTPFDVVKSRVQ---NTAVI 235
           F +     +++TK     N+       ++G + G   + ++TP D +K+ +Q   +  V 
Sbjct: 183 FAIY----ESATKFMNPSNEYNPFIHCISGGLSGATCAAITTPLDCIKTVLQVRGSETVS 238

Query: 236 PGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFF 290
             + ++ N    A + IYK  G+K   +G  P+V+   P   I    +     F 
Sbjct: 239 NEIMKQANTFQRAASAIYKIHGWKGFLRGLKPRVIANMPATAISWTSYECAKHFL 293

>YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondrial
           inner membrane citrate transport protein, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [900 bp, 299 aa]
          Length = 299

 Score = 97.4 bits (241), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 83/299 (27%), Positives = 136/299 (45%), Gaps = 24/299 (8%)

Query: 2   SDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAA 61
           SD  PL   + F+AG++AG +E  + YP +  KT +QL        +   V   + + A 
Sbjct: 8   SDVDPL---HSFLAGSLAGAAEACITYPFEFAKTRLQLIDKASKASRNPLVL--IYKTAK 62

Query: 62  KEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGIC 121
            +G   +Y G  + I+    K   +F   D  + + +D    E L+    +++G  AG+ 
Sbjct: 63  TQGIGSIYVGCPAFIIGNTAKAGIRFLGFDTIKDMLRDSETGE-LSGTRGVIAGLGAGLL 121

Query: 122 ESFV-VVPFELVKIRLQDVSSKFT-----SPIAVVKN---IVEKEGILAMYNGLESTMWR 172
           ES   V PFE +K  L D     T     +   VV+N   +V  +G   +Y G+     R
Sbjct: 122 ESVAAVTPFEAIKTALIDDKQSATPKYHNNGRGVVRNYSSLVRDKGFSGLYRGVLPVSMR 181

Query: 173 HGIWNAGYFGIIFQVRALLPK--ASTKSEQTRNDL--LAGTVGGTLSSLLSTPFDVVKSR 228
                A   G   +++ L+     S K +   + L  L G   G ++   + P D VK+R
Sbjct: 182 QAANQAVRLGCYNKIKTLIQDYTDSPKDKPLSSGLTFLVGAFSGIVTVYSTMPLDTVKTR 241

Query: 229 VQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVM 287
           +Q+         KY+ +    ATI+KEEG K  +KG  P++ RL   GGI+  ++  V+
Sbjct: 242 MQSLD-----STKYSSTMNCFATIFKEEGLKTFWKGATPRLGRLVLSGGIVFTIYEKVL 295

 Score = 29.3 bits (64), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 24/102 (23%), Positives = 43/102 (42%), Gaps = 9/102 (8%)

Query: 193 KASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATI 252
           KA+       +  LAG++ G   + ++ PF+  K+R+Q       + +    S   L  I
Sbjct: 4   KATKSDVDPLHSFLAGSLAGAAEACITYPFEFAKTRLQL------IDKASKASRNPLVLI 57

Query: 253 Y---KEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFFR 291
           Y   K +G  ++Y G    ++      GI  + F  + D  R
Sbjct: 58  YKTAKTQGIGSIYVGCPAFIIGNTAKAGIRFLGFDTIKDMLR 99

>AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W
           (AAC3) - SH] complement(978781..979698) [918 bp, 305 aa]
          Length = 305

 Score = 96.7 bits (239), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 80/294 (27%), Positives = 134/294 (45%), Gaps = 20/294 (6%)

Query: 1   MSDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQ----VSGGSGPQYKGVFDCL 56
           MSD K   F+  FM G V+         P++ VK ++Q Q      G    +Y G+ DC 
Sbjct: 1   MSDNKQSNFLINFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKQGSLDRRYNGIVDCF 60

Query: 57  KQIAAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIY---KDLFGAEKLTQPLSIL 113
           K+ AA EG    ++G ++ ++   P +A  FA  D+ + ++   K++ G  K     ++ 
Sbjct: 61  KRTAASEGVISFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFRKEVDGYAKWFAG-NLA 119

Query: 114 SGASAGICESFVVVPFELVKIRLQDVSS--------KFTSPIAVVKNIVEKEGILAMYNG 165
           SG +AG      V   +  + RL   S         +F   + V K  +  +GI  +Y G
Sbjct: 120 SGGAAGGLSLLFVYSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGIAGLYRG 179

Query: 166 LESTMWRHGIWNAGYFGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVV 225
              ++    ++   YFG+   ++ LL   + +S    + LL   V  T +S  S P D V
Sbjct: 180 FLPSVVGIVVYRGLYFGMYDSLKPLLLTGNLESSFIASFLLGWAV-TTGASTASYPLDTV 238

Query: 226 KSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGIL 279
           + R+  T+   G   KY+ ++ A   I   EG K+L+KG    +LR   G G++
Sbjct: 239 RRRMMMTS---GQAVKYDGAFDAFRKIVAAEGVKSLFKGCGANILRGVAGAGVI 289

>CAGL0D01606g complement(169066..169983) highly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, start by
           similarity
          Length = 305

 Score = 96.7 bits (239), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 80/294 (27%), Positives = 128/294 (43%), Gaps = 28/294 (9%)

Query: 10  VYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLY 69
           V   +AG   G++++L+  P D  K  +Q      S        + +K +   EGP   Y
Sbjct: 26  VKDLLAGTAGGIAQVLIGQPFDTTKVRLQTSKVPTSAA------EVVKNLLKNEGPKGFY 79

Query: 70  KGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLS--ILSGASAGICESFVVV 127
           KG  +P++      + +F  N+  ++ +         T  LS   L G + G+  SF+  
Sbjct: 80  KGTLTPLVGVGACVSIQFGVNEAMKRFFHARNVDHNATLSLSQYYLCGLTGGMTNSFLAS 139

Query: 128 PFELVKIRLQD-----VSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFG 182
           P E V+IRLQ        ++F  PI  +K +  ++G++    GL  TM R G     YF 
Sbjct: 140 PIEHVRIRLQTQTGSGAQAEFKGPIDCIKKLRSQKGLM---RGLIPTMLREGHGCGTYF- 195

Query: 183 IIFQVRALLPKASTKSEQTRNDL------LAGTVGGTLSSLLSTPFDVVKSRVQNTAVIP 236
           ++++  AL+ K   +  + R ++      L G + GT   L+  P DVVKS +Q   +  
Sbjct: 196 LVYE--ALVSKQINQGLK-RTEIPPWKLCLYGALSGTALWLMVYPIDVVKSVMQTDNL-- 250

Query: 237 GVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFF 290
             P+           +Y  EG KA +KGF P +LR  P  G     F   M   
Sbjct: 251 NKPQNGKNMIQVARNLYAREGLKAFFKGFGPTMLRAAPANGGTFATFELAMRLL 304

>KLLA0F03212g 302915..303832 highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w ACR1 succinate-fumarate
           transporter, start by similarity
          Length = 305

 Score = 96.3 bits (238), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 82/295 (27%), Positives = 138/295 (46%), Gaps = 18/295 (6%)

Query: 2   SDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSG-GSGPQYKGVFDCLKQIA 60
           S QK        +AG  AG+ E L  +PLD +K  MQ+  +  GSG +  G      +I 
Sbjct: 3   SKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIY 62

Query: 61  AKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGI 120
             EG    YKG+ + ++   PK A +F+  + ++ +  D     K++   + ++G  AGI
Sbjct: 63  RNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETG-KVSTGNTFIAGVGAGI 121

Query: 121 CESFVVVPFELV-KIRLQ-------DVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWR 172
            E+ VVV    V KIRLQ       + + K+ + +     IV++EG  A+Y G+  T  R
Sbjct: 122 TEAVVVVNPMEVVKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAAR 181

Query: 173 HGIWNAGYFGIIFQVRALLPKASTKSE-QTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQ- 230
                   F +  +++  L     +    +    L G + G +    + P D +K+R+Q 
Sbjct: 182 QATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQK 241

Query: 231 --NTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVF 283
             +T  + G+ R           + +EEGF+ALYKG  P+V+R+ PG  +    +
Sbjct: 242 DKSTKNMSGLKRITIIG----KQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAY 292

 Score = 60.5 bits (145), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 61/198 (30%), Positives = 90/198 (45%), Gaps = 11/198 (5%)

Query: 104 EKLTQP-LSILSGASAGICESFVVVPFELVKIRLQ----DVSSKFTSP--IAVVKNIVEK 156
           +K + P +++++G  AG+ E     P + +K+R+Q     V S   +P  I     I   
Sbjct: 5   QKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRN 64

Query: 157 EGILAMYNGLESTMWRHGIWNAGYFGIIFQVRALLPKASTKSEQTRNDLLAGTVGG-TLS 215
           EG LA Y GL + +       A  F      R LL    T    T N  +AG   G T +
Sbjct: 65  EGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGITEA 124

Query: 216 SLLSTPFDVVKSRVQNTAVIP--GVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLG 273
            ++  P +VVK R+Q   + P  G P KY  +  A  TI KEEGF ALY+G      R  
Sbjct: 125 VVVVNPMEVVKIRLQAQHLNPVEGAP-KYKNAVQACYTIVKEEGFSALYRGVSLTAARQA 183

Query: 274 PGGGILLVVFTGVMDFFR 291
              G    V++ + +F +
Sbjct: 184 TNQGANFTVYSKLKEFLQ 201

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 44/93 (47%)

Query: 3   DQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAK 62
           +Q+ LP     + G ++G        PLD +KT +Q   S  +    K +    KQ+  +
Sbjct: 205 NQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQE 264

Query: 63  EGPSRLYKGISSPILMEAPKRATKFACNDEFQK 95
           EG   LYKGI+  ++  AP +A  F   +  +K
Sbjct: 265 EGFRALYKGITPRVMRVAPGQAVTFTAYEFIRK 297

>Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement
          Length = 296

 Score = 95.9 bits (237), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 80/300 (26%), Positives = 135/300 (45%), Gaps = 21/300 (7%)

Query: 1   MSDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIA 60
           MS  K +     F+AG +AG  E  V YP +  KT +QL        +   V   +   A
Sbjct: 1   MSQSKQVDPSKSFIAGCLAGAVEASVTYPFEFAKTRLQLLDKASKASRNPLVL--IYNTA 58

Query: 61  AKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGI 120
             +G   +Y G  + I+    K   +F   D  + + +D    E L+ P  +++G  AG+
Sbjct: 59  KTQGIGSVYVGCPAFIVGNTAKAGVRFLGFDTIKNLLRDPKTGE-LSGPRGVIAGLGAGL 117

Query: 121 CESFV-VVPFELVKIRLQDVSSKFT-----SPIAVVKN---IVEKEGILAMYNGLESTMW 171
            ES V V PFE +K  L D     T     +   +++N   +V K+G+  +Y G+     
Sbjct: 118 LESVVAVTPFEAIKTALIDDKQSATPKYHNNGKGMLRNYTALVRKQGLSGLYRGVLPVSM 177

Query: 172 RHGIWNAGYFGIIFQVRALLPKAST----KSEQTRNDLLAGTVGGTLSSLLSTPFDVVKS 227
           R     A   G   +++ ++   +     K   +    + G   G ++   + P D VK+
Sbjct: 178 RQAANQAVRLGCYNKIKVMVQDYTNAPKDKPLSSGLTFVVGAFSGIVTVYTTMPIDTVKT 237

Query: 228 RVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVM 287
           R+Q+        ++Y+ +     TI+KEEG KA +KG  P++ RL   GGI+  V+  V+
Sbjct: 238 RMQSLD-----SKRYSSTINCFTTIFKEEGLKAFWKGATPRLGRLFLSGGIVFTVYEKVL 292

>YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses mitochondrial
           splicing defects [945 bp, 314 aa]
          Length = 314

 Score = 96.3 bits (238), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 76/294 (25%), Positives = 134/294 (45%), Gaps = 21/294 (7%)

Query: 8   PFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSR 67
           P  +Q +AGA AG+ E  VM+P+D +KT  ++Q +       K +   +  I+  EG   
Sbjct: 32  PLYHQLIAGAFAGIMEHSVMFPIDALKT--RIQSANAKSLSAKNMLSQISHISTSEGTLA 89

Query: 68  LYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESFVVV 127
           L+KG+ S IL   P  A  F   +  +K   D    +      + +SGA A      ++ 
Sbjct: 90  LWKGVQSVILGAGPAHAVYFGTYEFCKKNLIDSSDTQTHHPFKTAISGACATTASDALMN 149

Query: 128 PFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIFQV 187
           PF+ +K R+Q  +S   S     K I + EG+ A Y    +T+    + N  +    F  
Sbjct: 150 PFDTIKQRIQLNTS--ASVWQTTKQIYQSEGLAAFYYSYPTTL----VMNIPFAAFNF-- 201

Query: 188 RALLPKASTKSEQTRND------LLAGTVGGTLSSLLSTPFDVVKSRVQ---NTAVIPGV 238
             ++ ++STK     N+       L G++ G+  + ++TP D +K+ +Q   +  V   +
Sbjct: 202 --VIYESSTKFLNPSNEYNPLIHCLCGSISGSTCAAITTPLDCIKTVLQIRGSQTVSLEI 259

Query: 239 PRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFFRT 292
            RK +    A + IY+  G+K  ++G+ P+++   P   I    +     F  T
Sbjct: 260 MRKADTFSKAASAIYQVYGWKGFWRGWKPRIVANMPATAISWTAYECAKHFLMT 313

>Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement
          Length = 305

 Score = 95.9 bits (237), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 79/286 (27%), Positives = 128/286 (44%), Gaps = 28/286 (9%)

Query: 12  QFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKG 71
             +AG   GVS++L+  P D  K  ++LQ S  S P      D +K++   EG    YKG
Sbjct: 26  DLLAGTAGGVSQVLIGQPFDTTK--VRLQTS--SVPTT--ALDVVKKLVKNEGFRGFYKG 79

Query: 72  ISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSIL----SGASAGICESFVVV 127
             +P++      + +F  N+  ++ +    G     + L +L     G + G   SF+  
Sbjct: 80  TLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLAS 139

Query: 128 PFELVKIRLQD-----VSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWR--HGIWNAGY 180
           P E V+IRLQ       +++F  P+  +K +     ++    GL  TM R  HG    G 
Sbjct: 140 PIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLM---RGLTPTMLRESHG---CGV 193

Query: 181 FGIIFQ--VRALLPKASTKSE-QTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPG 237
           + + ++  +   L K  ++SE  T    L G   GT   L+  P DV+KS +Q  +++  
Sbjct: 194 YFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQ- 252

Query: 238 VPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVF 283
            P++         TIY   G  + +KGF P +LR  P  G     F
Sbjct: 253 -PKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATF 297

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 55/198 (27%), Positives = 91/198 (45%), Gaps = 11/198 (5%)

Query: 96  IYKDLFGAEKLTQPL-SILSGASAGICESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIV 154
           I  DL GA   T+    +L+G + G+ +  +  PF+  K+RLQ  SS  T+ + VVK +V
Sbjct: 10  IIDDLDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQ-TSSVPTTALDVVKKLV 68

Query: 155 EKEGILAMYNGLESTMWRHGIWNAGYFGIIFQVRALLPKASTKS--EQTRNDL---LAGT 209
           + EG    Y G  + +   G   +  FG+   ++      +  S   +T   L   L G 
Sbjct: 69  KNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGF 128

Query: 210 VGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKV 269
            GGT +S L++P + V+ R+Q      G      +  P L  I K     +L +G  P +
Sbjct: 129 AGGTANSFLASPIEHVRIRLQTQT---GTGAAAQFHGP-LDCIKKLTANNSLMRGLTPTM 184

Query: 270 LRLGPGGGILLVVFTGVM 287
           LR   G G+  + +  ++
Sbjct: 185 LRESHGCGVYFLTYEALI 202

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/184 (21%), Positives = 82/184 (44%), Gaps = 10/184 (5%)

Query: 4   QKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKE 63
            + L  +  ++ G   G +   +  P++ V+  +Q Q   G+  Q+ G  DC+K++ A  
Sbjct: 115 NETLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTAN- 173

Query: 64  GPSRLYKGISSPILMEAPKRATKFACNDEF--QKIYKDLFGAEKLTQPLSILSGASAGIC 121
             + L +G++  +L E+      F   +     +++K +  +E  T  L +  GA++G  
Sbjct: 174 --NSLMRGLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLF-GATSGTT 230

Query: 122 ESFVVVPFELVKIRLQDVS----SKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWN 177
              ++ P +++K  +Q  S     +  + + V K I    G+ + + G   TM R    N
Sbjct: 231 LWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPAN 290

Query: 178 AGYF 181
              F
Sbjct: 291 GATF 294

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 45/95 (47%), Gaps = 7/95 (7%)

Query: 198 SEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEG 257
           S +   DLLAGT GG    L+  PFD  K R+Q T+ +P        +   +  + K EG
Sbjct: 20  STRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQ-TSSVP------TTALDVVKKLVKNEG 72

Query: 258 FKALYKGFVPKVLRLGPGGGILLVVFTGVMDFFRT 292
           F+  YKG +  ++ +G    +   V   +  FF +
Sbjct: 73  FRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHS 107

>YBR104W (YMC2) [293] chr2 (449624..450613) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [990 bp, 329 aa]
          Length = 329

 Score = 96.3 bits (238), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 85/304 (27%), Positives = 133/304 (43%), Gaps = 45/304 (14%)

Query: 15  AGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGISS 74
           AG + G++++LV  P D  K  +Q   +           + L+ +   EG    YKG  +
Sbjct: 40  AGTIGGIAQVLVGQPFDTTKVRLQTATT------RTTTLEVLRNLVKNEGVFAFYKGALT 93

Query: 75  PILMEAPKRATKFACNDEFQKIYK-------------DLFGAEKLTQPLS--ILSGASAG 119
           P+L      + +F  N+  ++ ++             D+  +   T PLS   + G + G
Sbjct: 94  PLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGG 153

Query: 120 ICESFVVVPFELVKIRLQDVSS-----KFTSPIAVVKNIVEKEGILAMYNGLESTMWR-- 172
           +  SF+  P E ++IRLQ  +S     +F  P   +K +  + G++    GL  TM R  
Sbjct: 154 VVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGLM---RGLFPTMIRAG 210

Query: 173 HGIWNAGYFGIIFQVRALLPKASTKSEQTRNDL------LAGTVGGTLSSLLSTPFDVVK 226
           HG+      G  F V   L      +  TRN++      L G   GT+  L   P DVVK
Sbjct: 211 HGL------GTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDVVK 264

Query: 227 SRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGV 286
           S +QN  +    P+  N       TIY +EG +A +KGF P ++R  P  G   + F  V
Sbjct: 265 SIIQNDDLRK--PKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFELV 322

Query: 287 MDFF 290
           M F 
Sbjct: 323 MRFL 326

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 95/193 (49%), Gaps = 21/193 (10%)

Query: 111 SILSGASAGICESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTM 170
            I +G   GI +  V  PF+  K+RLQ  +++ T+ + V++N+V+ EG+ A Y G  + +
Sbjct: 37  DIFAGTIGGIAQVLVGQPFDTTKVRLQTATTRTTT-LEVLRNLVKNEGVFAFYKGALTPL 95

Query: 171 WRHGIWNAGYFGIIFQVRALL--------PKASTKS-EQTRNDLL-------AGTVGGTL 214
              GI  +  FG+   ++           P  S++  + +R++ L        G  GG +
Sbjct: 96  LGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGVV 155

Query: 215 SSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGP 274
           +S L++P + ++ R+Q T    G  R++   W  +  +  + G   L +G  P ++R G 
Sbjct: 156 NSFLASPIEQIRIRLQ-TQTSNGGDREFKGPWDCIKKLKAQGG---LMRGLFPTMIRAGH 211

Query: 275 GGGILLVVFTGVM 287
           G G   +V+  ++
Sbjct: 212 GLGTYFLVYEALV 224

 Score = 58.2 bits (139), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 53/193 (27%), Positives = 86/193 (44%), Gaps = 22/193 (11%)

Query: 1   MSDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIA 60
           +S    LP    ++ G   GV    +  P++ ++  +Q Q S G   ++KG +DC+K++ 
Sbjct: 134 LSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLK 193

Query: 61  AKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAE---KLTQ----PLSI- 112
           A+ G   L +G+   ++       T F        +Y+ L   E    LT+    P  + 
Sbjct: 194 AQGG---LMRGLFPTMIRAGHGLGTYFL-------VYEALVAREIGTGLTRNEIPPWKLC 243

Query: 113 LSGASAGICESFVVVPFELVKIRLQDVS---SKFTSPIA-VVKNIVEKEGILAMYNGLES 168
           L GA +G      V P ++VK  +Q+      K+ + I+ V K I  KEGI A + G   
Sbjct: 244 LFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGP 303

Query: 169 TMWRHGIWNAGYF 181
           TM R    N   F
Sbjct: 304 TMVRSAPVNGATF 316

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 35/81 (43%), Gaps = 7/81 (8%)

Query: 193 KASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATI 252
           K    S +   D+ AGT+GG    L+  PFD  K R+Q              +   L  +
Sbjct: 26  KRELSSNRVLKDIFAGTIGGIAQVLVGQPFDTTKVRLQTATTR-------TTTLEVLRNL 78

Query: 253 YKEEGFKALYKGFVPKVLRLG 273
            K EG  A YKG +  +L +G
Sbjct: 79  VKNEGVFAFYKGALTPLLGVG 99

>Sklu_2075.3 , Contig c2075 6414-7451 reverse complement
          Length = 345

 Score = 95.1 bits (235), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 73/270 (27%), Positives = 124/270 (45%), Gaps = 17/270 (6%)

Query: 13  FMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGI 72
           F++G  +G+++  V +P D +K  ++LQ S  S  ++KG  DC+ +   ++G    Y G 
Sbjct: 64  FVSGMFSGIAKNAVGHPFDTIK--VRLQTSQDS-TRFKGPLDCVYKTFTQQGIRGFYLGF 120

Query: 73  SSPILMEAPKRATKFACNDEFQKIYKDL--FGAEKLTQPLSILSGASAGICESFVVVPFE 130
           + P++      +    C   ++ + K    +  EKL     I+SG  AG   SF+  P E
Sbjct: 121 TPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAAPVE 180

Query: 131 LVKIRLQ----DVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIFQ 186
           L K +LQ      ++K+T P+ V+K +    G+  +Y GL ST+      N  ++   ++
Sbjct: 181 LAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRT--NFVFWWGSYE 238

Query: 187 VRALLPKASTKSEQTRNDLLAGTVGGTLSSLLST-PFDVVKSRVQNTAVIPGVPRKYNWS 245
           +     K  T    T  +  +G    +     +  P DV+K  V       G  R    S
Sbjct: 239 LLTRWFKEHTNMSDTAINFWSGGFSASFGFWTTAYPSDVIKQVVLCNDKYDGTFR----S 294

Query: 246 WP-ALATIYKEEGFKALYKGFVPKVLRLGP 274
           W  A   I++  G++  +KGFVP  LR  P
Sbjct: 295 WKLAAKDIWRTRGYRGFFKGFVPSFLRSFP 324

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 79/173 (45%), Gaps = 7/173 (4%)

Query: 103 AEKLTQPLSILSGASAGICESFVVVPFELVKIRLQDV--SSKFTSPIAVVKNIVEKEGIL 160
           +E  ++ +  +SG  +GI ++ V  PF+ +K+RLQ    S++F  P+  V     ++GI 
Sbjct: 55  SEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIR 114

Query: 161 AMYNGLESTMWRHGIWNAGYFGIIFQVRALLPKASTKSEQT---RNDLLAGTVGGTLSSL 217
             Y G    +    + ++   G +   R LL K    +E+       +++G + G   S 
Sbjct: 115 GFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSF 174

Query: 218 LSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVL 270
           ++ P ++ K+++Q          KY      +  +Y   G + LYKG    ++
Sbjct: 175 IAAPVELAKAKLQ--VQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLI 225

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 42/78 (53%), Gaps = 1/78 (1%)

Query: 3   DQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAK 62
           +++ LP     ++G +AG S   +  P+++ K  +Q+Q    +  +Y G  D +K++ + 
Sbjct: 152 NEEKLPLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKT-TKYTGPVDVIKKVYSS 210

Query: 63  EGPSRLYKGISSPILMEA 80
            G   LYKG++S ++   
Sbjct: 211 NGVRGLYKGLTSTLIFRT 228

>Scas_379.2
          Length = 301

 Score = 94.0 bits (232), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 84/297 (28%), Positives = 136/297 (45%), Gaps = 33/297 (11%)

Query: 8   PFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSR 67
           P  +Q +AGA AG+ E  VM+P+D +KT +Q      S      +   + +I+  EG   
Sbjct: 22  PLSHQLLAGAFAGIMEHSVMFPIDALKTRIQ----STSAKSTSNMLSQMAKISTAEGSLA 77

Query: 68  LYKGISSPILMEAPKRATKFACNDEFQKIY----KDLFGAEKLTQPL-SILSGASAGICE 122
           L+KG+ S IL   P  A  FA   E+ K Y    KD+    +  QPL + LSG  A I  
Sbjct: 78  LWKGVQSVILGAGPAHAVYFATY-EYTKKYLIDEKDM----QTHQPLKTALSGTVATIAA 132

Query: 123 SFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFG 182
             ++ PF+ +K R+Q  ++  T+   V K I + EG  A Y    +T+  +  + A  F 
Sbjct: 133 DALMNPFDTLKQRMQLNTN--TTVWNVTKQIYKNEGFSAFYYSYPTTLAMNIPFAAFNF- 189

Query: 183 IIFQVRALLPKASTKSEQTRND------LLAGTVGGTLSSLLSTPFDVVKSRVQ---NTA 233
                  ++ +++TK     ND       L+G + G   + ++TP D +K+ +Q   + +
Sbjct: 190 -------MIYESATKFFNPTNDYNPLVHCLSGGLSGATCAAITTPLDCIKTVLQVRGSES 242

Query: 234 VIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFF 290
           V   V ++ N    A   IY+  G K  ++G  P+V    P   I    +     F 
Sbjct: 243 VSLQVMKEANTFQKATKAIYQVHGAKGFWRGLQPRVFANMPATAIAWTAYECAKHFL 299

 Score = 37.4 bits (85), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 42/93 (45%), Gaps = 9/93 (9%)

Query: 191 LPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALA 250
           LP ++  S Q    LLAG   G +   +  P D +K+R+Q+T+      +  +     +A
Sbjct: 17  LPDSAPLSHQ----LLAGAFAGIMEHSVMFPIDALKTRIQSTSA-----KSTSNMLSQMA 67

Query: 251 TIYKEEGFKALYKGFVPKVLRLGPGGGILLVVF 283
            I   EG  AL+KG    +L  GP   +    +
Sbjct: 68  KISTAEGSLALWKGVQSVILGAGPAHAVYFATY 100

>Scas_667.22
          Length = 306

 Score = 93.6 bits (231), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 78/286 (27%), Positives = 134/286 (46%), Gaps = 25/286 (8%)

Query: 10  VYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLY 69
           +   +AG   G++++LV  P D  K  ++LQ S  S P      + ++++   EGP   Y
Sbjct: 26  IKDLLAGTAGGIAQVLVGQPFDTTK--VRLQTS--STPTT--AMEVIRKLLKNEGPKGFY 79

Query: 70  KGISSPILMEAPKRATKFACNDEFQKIYKDL---FGAEKLTQPLSILSGASAGICESFVV 126
           KG  +P++      + +F  N+  ++ +        ++ L+ P   + G + GI  SF+ 
Sbjct: 80  KGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLA 139

Query: 127 VPFELVKIRLQDVSS-----KFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYF 181
            P E V+IRLQ  +      +F  P+  ++ +  + G +    GL  TM R G     YF
Sbjct: 140 SPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFM---RGLTPTMLREGHGCGTYF 196

Query: 182 GIIFQ--VRALLPKASTKSEQTRNDL-LAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGV 238
            ++++  V   + K   ++E     L L G + GT   ++  P DV+KS +Q   +    
Sbjct: 197 -LVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNL---K 252

Query: 239 PRKYNWSWPALA-TIYKEEGFKALYKGFVPKVLRLGPGGGILLVVF 283
             KY  S  ++A T+Y + G  A +KGF P +LR  P  G     F
Sbjct: 253 SPKYGNSISSVAKTLYAKGGLGAFFKGFGPTMLRAAPANGATFATF 298

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 41/89 (46%), Gaps = 7/89 (7%)

Query: 204 DLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYK 263
           DLLAGT GG    L+  PFD  K R+Q T+  P        +   +  + K EG K  YK
Sbjct: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQ-TSSTP------TTAMEVIRKLLKNEGPKGFYK 80

Query: 264 GFVPKVLRLGPGGGILLVVFTGVMDFFRT 292
           G +  ++ +G    +   V   +  FF +
Sbjct: 81  GTLTPLIGVGACVSLQFGVNEAMKRFFHS 109

>Kwal_55.21335
          Length = 317

 Score = 94.0 bits (232), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 73/279 (26%), Positives = 126/279 (45%), Gaps = 26/279 (9%)

Query: 14  MAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSR-LYKGI 72
           + G++AG +  ++ YPLD +K  +Q Q        +   + C+K    KEG  +  Y+G+
Sbjct: 50  LYGSIAGAAGKVIEYPLDTIKVRLQTQ----PAHVFPTSWSCIKYTYQKEGFVKGFYQGV 105

Query: 73  SSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESFVVVPFELV 132
           +SP++  A + A  F   +  Q   +       L+Q  ++LSGA AG C S+V+ P EL+
Sbjct: 106 ASPLVGAALENAVLFVTFNRAQNFLQQYESVSPLSQ--TVLSGAFAGACTSYVLTPVELI 163

Query: 133 KIRLQ-----DVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIFQV 187
           K  LQ       +++ +     VK+IV+ +GI  ++ G  ST  R     A +F     +
Sbjct: 164 KCTLQVSNLEGATTRHSKIWPTVKHIVQHKGIGGLWQGQSSTFIRECAGGAVWFTTYESL 223

Query: 188 RALLPKASTKSEQTRNDLLA-GTVGGTLSSLLSTPFDVVKS--RVQNTAVIPGVPRKYNW 244
           ++ L +    +E    +LLA G   G   +    P D +KS  + Q+  ++    R    
Sbjct: 224 KSYLARRRNDTENHTWELLASGASAGVAFNASIFPADTIKSTAQTQHLGIVDATKR---- 279

Query: 245 SWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVF 283
                  I    G   LY+G    ++R  P   I+   +
Sbjct: 280 -------ILARSGPAGLYRGLGITLIRAAPANAIVFYTY 311

 Score = 56.2 bits (134), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 41/181 (22%), Positives = 84/181 (46%), Gaps = 4/181 (2%)

Query: 112 ILSGASAGICESFVVVPFELVKIRLQDVSSK-FTSPIAVVKNIVEKEGIL-AMYNGLEST 169
           IL G+ AG     +  P + +K+RLQ   +  F +  + +K   +KEG +   Y G+ S 
Sbjct: 49  ILYGSIAGAAGKVIEYPLDTIKVRLQTQPAHVFPTSWSCIKYTYQKEGFVKGFYQGVASP 108

Query: 170 MWRHGIWNAGYFGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRV 229
           +    + NA  F    + +  L +  + S  ++  +L+G   G  +S + TP +++K  +
Sbjct: 109 LVGAALENAVLFVTFNRAQNFLQQYESVSPLSQT-VLSGAFAGACTSYVLTPVELIKCTL 167

Query: 230 QNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDF 289
           Q  + + G   +++  WP +  I + +G   L++G     +R   GG +    +  +  +
Sbjct: 168 Q-VSNLEGATTRHSKIWPTVKHIVQHKGIGGLWQGQSSTFIRECAGGAVWFTTYESLKSY 226

Query: 290 F 290
            
Sbjct: 227 L 227

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 40/91 (43%), Gaps = 10/91 (10%)

Query: 204 DLLAGTVGGTLSSLLSTPFDVVKSRVQN--TAVIPGVPRKYNWSWPALATIYKEEGF-KA 260
           D+L G++ G    ++  P D +K R+Q     V P        SW  +   Y++EGF K 
Sbjct: 48  DILYGSIAGAAGKVIEYPLDTIKVRLQTQPAHVFPT-------SWSCIKYTYQKEGFVKG 100

Query: 261 LYKGFVPKVLRLGPGGGILLVVFTGVMDFFR 291
            Y+G    ++       +L V F    +F +
Sbjct: 101 FYQGVASPLVGAALENAVLFVTFNRAQNFLQ 131

>KLLA0A09383g complement(818752..819852) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 366

 Score = 94.4 bits (233), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 72/269 (26%), Positives = 128/269 (47%), Gaps = 32/269 (11%)

Query: 44  GSGPQYKGVFDCLKQIAAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGA 103
            S  ++   ++   +I+  EG + L++G+S  +LM  P     F+  + F+  +  +  +
Sbjct: 92  NSALRFNSTWEAFTKISEVEGLATLWRGLSITLLMAIPANVVYFSGYEMFRD-HSPMRDS 150

Query: 104 EKLTQPLSILSGASAGICESFVVVPFELVKIRLQDV--SSKFTSPIAVVKNIVEKE---- 157
                PL    GA+A +  +  V P EL+K RLQ +  S K T+   + K+++++     
Sbjct: 151 YPSLNPL--FCGATARMVAATTVAPLELIKTRLQSIPRSRKDTTTQMMFKDLLKETRNEI 208

Query: 158 ---GILAMYNGLESTMWRHGIWNAGYFG----------IIFQVRALLPKASTKSEQTRND 204
              G   ++ GLE T+WR   ++A Y+G          I F  + L    S   +   N 
Sbjct: 209 RSGGYKVLFKGLEITLWRDVPFSAIYWGSYEFYKKNFWIDFSEQCLRWNLSPNWDFFINS 268

Query: 205 LLAGTVGGTLSSLLSTPFDVVKSRVQ----------NTAVIPGVPRKYNWSWPALATIYK 254
            + G+V G+ ++LL+ PFDV K+R+Q          NT V P         +  L  I +
Sbjct: 269 FIGGSVSGSSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGMFKFLYNIKQ 328

Query: 255 EEGFKALYKGFVPKVLRLGPGGGILLVVF 283
            EG+ ALY G +P+V+++ P   I++  +
Sbjct: 329 TEGYGALYTGLIPRVMKIAPSCAIMISTY 357

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 40/87 (45%), Gaps = 11/87 (12%)

Query: 9   FVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQ-----------VSGGSGPQYKGVFDCLK 57
           F+  F+ G+V+G S  L+ +P D+ KT MQ+            VS       +G+F  L 
Sbjct: 265 FINSFIGGSVSGSSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGMFKFLY 324

Query: 58  QIAAKEGPSRLYKGISSPILMEAPKRA 84
            I   EG   LY G+   ++  AP  A
Sbjct: 325 NIKQTEGYGALYTGLIPRVMKIAPSCA 351

 Score = 35.4 bits (80), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 80/197 (40%), Gaps = 33/197 (16%)

Query: 3   DQKPL----PFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVF-DCLK 57
           D  P+    P +     GA A +     + PL+++KT +Q           + +F D LK
Sbjct: 143 DHSPMRDSYPSLNPLFCGATARMVAATTVAPLELIKTRLQSIPRSRKDTTTQMMFKDLLK 202

Query: 58  QIAAK---EGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPL---- 110
           +   +    G   L+KG+   +  + P  A  +   + ++K +   F  + L   L    
Sbjct: 203 ETRNEIRSGGYKVLFKGLEITLWRDVPFSAIYWGSYEFYKKNFWIDFSEQCLRWNLSPNW 262

Query: 111 -----SILSGASAGICESFVVVPFELVKIRLQ---DVSSK----FTSPIAVVK------- 151
                S + G+ +G   + +  PF++ K R+Q   D+ +K      SP   V        
Sbjct: 263 DFFINSFIGGSVSGSSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGMFKF 322

Query: 152 --NIVEKEGILAMYNGL 166
             NI + EG  A+Y GL
Sbjct: 323 LYNIKQTEGYGALYTGL 339

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 67/165 (40%), Gaps = 17/165 (10%)

Query: 134 IRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIFQVRALLPK 193
           I+ ++ + +F S       I E EG+  ++ GL  T+      N  YF      R   P 
Sbjct: 88  IQCKNSALRFNSTWEAFTKISEVEGLATLWRGLSITLLMAIPANVVYFSGYEMFRDHSPM 147

Query: 194 ASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIY 253
               S  + N L  G     +++    P +++K+R+Q+   IP   RK   +      + 
Sbjct: 148 RD--SYPSLNPLFCGATARMVAATTVAPLELIKTRLQS---IPR-SRKDTTTQMMFKDLL 201

Query: 254 KEE-------GFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFFR 291
           KE        G+K L+KG    + R  P   I    + G  +F++
Sbjct: 202 KETRNEIRSGGYKVLFKGLEITLWRDVPFSAI----YWGSYEFYK 242

 Score = 30.0 bits (66), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 20/35 (57%)

Query: 202 RNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIP 236
           +  +L+   G  L+S   TP DVV+ R+Q   ++P
Sbjct: 12  KERMLSACAGSFLTSFFLTPMDVVRIRLQQQVMLP 46

>KLLA0E02772g complement(261895..262749) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11 ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 284

 Score = 92.8 bits (229), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 76/288 (26%), Positives = 126/288 (43%), Gaps = 30/288 (10%)

Query: 16  GAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSR-LYKGISS 74
           G+VAG    ++ YP D VK  +Q Q        Y   + C++     EG  +  Y+GI+S
Sbjct: 14  GSVAGAIGKVIEYPFDTVKVRLQTQ----PAHLYPTTWSCIRSTYTDEGIWKGFYQGIAS 69

Query: 75  PILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESFVVVPFELVKI 134
           P+   A + A  F   ++      +    + LT+  +I SGA AG C SF++ P ELVK 
Sbjct: 70  PLFGAALENAVLFVSFNQCTNFLDEFTQLKPLTK--TIYSGAFAGACASFILTPVELVKC 127

Query: 135 RLQ--------DVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRH----GIWNAGYFG 182
           +LQ          +++ TS    +K++++++G+L ++ G  ST  R      +W   Y  
Sbjct: 128 KLQVSNISNSLSQTTRHTSVWPTIKSVIKEKGLLGLWQGQLSTFVRECLGGAVWFTTYEI 187

Query: 183 IIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKY 242
           +  +  +L P  + K   T   L++G   G L +    P D VKS  Q   V        
Sbjct: 188 MKMKFASLHP--AEKENHTWELLVSGASAGVLFNASVFPADTVKSVCQTEHV-----SIV 240

Query: 243 NWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFF 290
           N    AL  + +  G    Y+G    ++R  P    +   +  +   F
Sbjct: 241 N----ALKKVLRTHGITGFYRGLGITLIRAAPANATVFYTYETLKKMF 284

 Score = 56.6 bits (135), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 41/176 (23%), Positives = 83/176 (47%), Gaps = 5/176 (2%)

Query: 112 ILSGASAGICESFVVVPFELVKIRLQDVSSK-FTSPIAVVKNIVEKEGIL-AMYNGLEST 169
           I  G+ AG     +  PF+ VK+RLQ   +  + +  + +++    EGI    Y G+ S 
Sbjct: 11  IAYGSVAGAIGKVIEYPFDTVKVRLQTQPAHLYPTTWSCIRSTYTDEGIWKGFYQGIASP 70

Query: 170 MWRHGIWNAGYFGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRV 229
           ++   + NA  F    Q    L + +     T+  + +G   G  +S + TP ++VK ++
Sbjct: 71  LFGAALENAVLFVSFNQCTNFLDEFTQLKPLTKT-IYSGAFAGACASFILTPVELVKCKL 129

Query: 230 QNTAVIPGVPR--KYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVF 283
           Q + +   + +  ++   WP + ++ KE+G   L++G +   +R   GG +    +
Sbjct: 130 QVSNISNSLSQTTRHTSVWPTIKSVIKEKGLLGLWQGQLSTFVRECLGGAVWFTTY 185

 Score = 55.5 bits (132), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 79/178 (44%), Gaps = 7/178 (3%)

Query: 8   PFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQ---YKGVFDCLKQIAAKEG 64
           P      +GA AG     ++ P+++VK  +Q+     S  Q   +  V+  +K +  ++G
Sbjct: 100 PLTKTIYSGAFAGACASFILTPVELVKCKLQVSNISNSLSQTTRHTSVWPTIKSVIKEKG 159

Query: 65  PSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSIL-SGASAGICES 123
              L++G  S  + E    A  F   +  +  +  L  AEK      +L SGASAG+  +
Sbjct: 160 LLGLWQGQLSTFVRECLGGAVWFTTYEIMKMKFASLHPAEKENHTWELLVSGASAGVLFN 219

Query: 124 FVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYF 181
             V P + VK   Q   ++  S +  +K ++   GI   Y GL  T+ R    NA  F
Sbjct: 220 ASVFPADTVKSVCQ---TEHVSIVNALKKVLRTHGITGFYRGLGITLIRAAPANATVF 274

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 39/93 (41%), Gaps = 6/93 (6%)

Query: 199 EQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEG- 257
           E    D+  G+V G +  ++  PFD VK R+Q           Y  +W  + + Y +EG 
Sbjct: 5   ESALKDIAYGSVAGAIGKVIEYPFDTVKVRLQTQPA-----HLYPTTWSCIRSTYTDEGI 59

Query: 258 FKALYKGFVPKVLRLGPGGGILLVVFTGVMDFF 290
           +K  Y+G    +        +L V F    +F 
Sbjct: 60  WKGFYQGIASPLFGAALENAVLFVSFNQCTNFL 92

>Scas_645.9
          Length = 391

 Score = 93.6 bits (231), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 74/260 (28%), Positives = 129/260 (49%), Gaps = 27/260 (10%)

Query: 44  GSGPQYKGVFDCLKQIAAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGA 103
            S  ++ G  +   +I   EG + L++GIS  +LM  P     F    E+ +    L  +
Sbjct: 124 NSSVRFNGTLEAFNKIWKLEGITTLWRGISINLLMAIPANIVYFT-GYEYLRDNSPLATS 182

Query: 104 EKLTQPLSILSGASAGICESFVVVPFELVKIRLQDVS--SKFTSPIAVVKNIVEKE---- 157
                PL  + GA A I  +  V P EL+K +LQ +   SK T+   +VK ++++     
Sbjct: 183 SPTFNPL--MCGAIARILAASTVAPLELLKTKLQSIPRVSKSTTSWMMVKELLKETRQEM 240

Query: 158 ----GILAMYNGLESTMWRHGIWNAGYFGIIFQVRALLPKASTKSEQTR----NDLLAGT 209
                  A++ GLE T+WR   ++A Y+G     +  L   ++KS        N  + G+
Sbjct: 241 RISGASNALFKGLEITLWRDVPFSAIYWGSYEFCKTHLWMDTSKSHSNLTFFINSFIGGS 300

Query: 210 VGGTLSSLLSTPFDVVKSRVQ-------NTAVI--PGVPRKYNWSWPALATIYKEEGFKA 260
           + GT+++L++ PFDV K+R Q       + +V+  P + +  N  +  L  I+K EG+ A
Sbjct: 301 ISGTIAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTKN-MFKFLRNIWKLEGWGA 359

Query: 261 LYKGFVPKVLRLGPGGGILL 280
           LY G VP+++++ P   I++
Sbjct: 360 LYTGLVPRMVKIAPSCAIMI 379

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 46/104 (44%), Gaps = 13/104 (12%)

Query: 9   FVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSG---------PQYKGVFDCLKQI 59
           F+  F+ G+++G    LV +P D+ KT  Q+   G +           Q K +F  L+ I
Sbjct: 292 FINSFIGGSISGTIAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTKNMFKFLRNI 351

Query: 60  AAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGA 103
              EG   LY G+   ++  AP  A   +      ++ K LF A
Sbjct: 352 WKLEGWGALYTGLVPRMVKIAPSCAIMISS----YELSKRLFNA 391

 Score = 35.0 bits (79), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 49/208 (23%), Positives = 92/208 (44%), Gaps = 17/208 (8%)

Query: 1   MSDQKPL----PFVYQFMAGAVAGVSEILVMYPLDMVKTVMQ----LQVSGGSGPQYKGV 52
           + D  PL    P     M GA+A +     + PL+++KT +Q    +  S  S    K +
Sbjct: 173 LRDNSPLATSSPTFNPLMCGAIARILAASTVAPLELLKTKLQSIPRVSKSTTSWMMVKEL 232

Query: 53  FDCLKQIAAKEGPSR-LYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPL- 110
               +Q     G S  L+KG+   +  + P  A  +  + EF K +  +  ++  +    
Sbjct: 233 LKETRQEMRISGASNALFKGLEITLWRDVPFSAIYWG-SYEFCKTHLWMDTSKSHSNLTF 291

Query: 111 ---SILSGASAGICESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLE 167
              S + G+ +G   + V  PF++ K R Q +S    +  +VVK+  + E    M+  L 
Sbjct: 292 FINSFIGGSISGTIAALVTHPFDVGKTRWQ-ISFMGNNDKSVVKS-PDIEQTKNMFKFLR 349

Query: 168 STMWRHGIWNAGYFGIIFQVRALLPKAS 195
           + +W+   W A Y G++ ++  + P  +
Sbjct: 350 N-IWKLEGWGALYTGLVPRMVKIAPSCA 376

 Score = 31.6 bits (70), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 21/34 (61%)

Query: 205 LLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGV 238
           +L+ + G  L+SL  TP DVV+ R+Q   ++P  
Sbjct: 40  MLSASTGSLLTSLTLTPMDVVRIRLQQQELLPDC 73

>Sklu_2430.10 YKL120W, Contig c2430 18856-19830
          Length = 324

 Score = 92.4 bits (228), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 77/280 (27%), Positives = 125/280 (44%), Gaps = 20/280 (7%)

Query: 10  VYQFMAGAVAGVSEILVMYPLDMVKTVMQLQ--VSGGSGPQYKGVFDCLKQIAAKEGPSR 67
           V  F+AG +A    + V  P ++VKT MQLQ  +S  +   Y+  F  L  I   EG   
Sbjct: 24  VGSFIAGGLAACIAVTVTNPFELVKTRMQLQGEMSATNQRIYRNPFQALGVIFKNEGVKG 83

Query: 68  LYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPL-----SILSGASAGICE 122
           L +G+ S  + +     ++    +  + +    F  E     L     ++ +GA++GI  
Sbjct: 84  LQRGLVSAYVYQIGLNGSRLGFYEPIRTVLNKTFFPESDPHKLQNVAVNVTAGATSGIIG 143

Query: 123 SFVVVPFELVKIRLQDVS--------SKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHG 174
           + V  P  LVK R+Q  S        + +TS    +  I +KEG+L ++ G+++ + R G
Sbjct: 144 AIVGSPLFLVKTRMQSYSNAIKIGEQTHYTSMSNGLATIFKKEGVLGLFRGVDAAILRTG 203

Query: 175 IWNAGYFGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAV 234
             ++    I    +  L +     E T   LL+ TV G    ++  P+DVV +RV N   
Sbjct: 204 AGSSVQLPIYNTTKNFLLQNDIMKEGTALHLLSSTVTGLGVGIVMNPWDVVLTRVYNQK- 262

Query: 235 IPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGP 274
                  Y      +    K EG  ALYKGF  ++ R+ P
Sbjct: 263 ----GNTYKGPIDCMFKTIKIEGIGALYKGFGAQLFRIAP 298

 Score = 70.1 bits (170), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 94/203 (46%), Gaps = 15/203 (7%)

Query: 103 AEKLTQPLSILSGASAGICESFVVVPFELVKIRLQ---DVSSK----FTSPIAVVKNIVE 155
           A+K+++  S ++G  A      V  PFELVK R+Q   ++S+     + +P   +  I +
Sbjct: 18  AQKVSKVGSFIAGGLAACIAVTVTNPFELVKTRMQLQGEMSATNQRIYRNPFQALGVIFK 77

Query: 156 KEGILAMYNGLESTMWRHGIWNAGYFGIIFQVRALLPKA------STKSEQTRNDLLAGT 209
            EG+  +  GL S        N    G    +R +L K         K +    ++ AG 
Sbjct: 78  NEGVKGLQRGLVSAYVYQIGLNGSRLGFYEPIRTVLNKTFFPESDPHKLQNVAVNVTAGA 137

Query: 210 VGGTLSSLLSTPFDVVKSRVQN--TAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVP 267
             G + +++ +P  +VK+R+Q+   A+  G    Y      LATI+K+EG   L++G   
Sbjct: 138 TSGIIGAIVGSPLFLVKTRMQSYSNAIKIGEQTHYTSMSNGLATIFKKEGVLGLFRGVDA 197

Query: 268 KVLRLGPGGGILLVVFTGVMDFF 290
            +LR G G  + L ++    +F 
Sbjct: 198 AILRTGAGSSVQLPIYNTTKNFL 220

>CAGL0B03883g 383602..384522 weakly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, hypothetical
           start
          Length = 306

 Score = 92.0 bits (227), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 82/293 (27%), Positives = 131/293 (44%), Gaps = 27/293 (9%)

Query: 1   MSDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQL-QVSGGSGPQYKGVFDCLKQI 59
           M  ++    V  F+AG  +GV++  V +P D VK  +Q  QV  G+G Q+KG  DC+ + 
Sbjct: 1   MVSEETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKT 60

Query: 60  AAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLS--ILSGAS 117
              +G   LY G + P+       +        ++ +       E    PLS  I+SG  
Sbjct: 61  LKNQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVM 120

Query: 118 AGICESFVVVPFELVKIRLQ----DVSSKFTSPIAVVKNIVEK--------EGILAMYNG 165
           AG   SF+  P EL K +LQ      ++K+T PI VV+ + ++         G+ ++Y G
Sbjct: 121 AGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKG 180

Query: 166 LESTMWRHGIWNAGY---FGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLST-P 221
           L ST+    I+ + +   +G    +     K +  S    N   AG +  +     S  P
Sbjct: 181 LISTL----IFRSNFVFWWGSYELITQWFQKNTNLSAPAIN-FWAGGLSASFGFWTSAYP 235

Query: 222 FDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGP 274
            DVVK  V       G  + +     A++ IY++ G    +KGF+P  LR  P
Sbjct: 236 SDVVKQVVLCNDKYDGSFKSWR---TAVSDIYRQRGIHGFFKGFLPSFLRSFP 285

>KLLA0B08503g complement(753498..754409) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 303

 Score = 92.0 bits (227), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 80/279 (28%), Positives = 122/279 (43%), Gaps = 36/279 (12%)

Query: 10  VYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLY 69
           +   +AG   G++++LV  P D  K  ++LQ S  S    K + D +K     EGP   Y
Sbjct: 24  IKDLLAGTAGGIAQVLVGQPFDTTK--VRLQTSETSTNAVKVIKDLIKN----EGPMGFY 77

Query: 70  KGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILS----GASAGICESFV 125
           KG  +P++      + +F  N+  ++ +      E  +Q LS+L     G + G   SF+
Sbjct: 78  KGTLTPLVGVGACVSLQFGVNEAMKRFFHTF--DEAASQHLSLLQYYICGVAGGFTNSFL 135

Query: 126 VVPFELVKIRLQD-----VSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWR--HGIWNA 178
             P E ++IRLQ       +++F  PI  +K +     ++    GL  TM R  HG    
Sbjct: 136 ASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLM---RGLTPTMLRESHGC--- 189

Query: 179 GYFGIIFQVRALLPKASTKSEQTRNDL------LAGTVGGTLSSLLSTPFDVVKSRVQNT 232
              G+ F     L     KS   R D+      L G   GTL   +  P DV+KS +Q  
Sbjct: 190 ---GVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTD 246

Query: 233 AVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLR 271
            +    P+  N       TI   +G   L+KGF P +LR
Sbjct: 247 NL--KTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 37/178 (20%), Positives = 79/178 (44%), Gaps = 18/178 (10%)

Query: 5   KPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEG 64
           + L  +  ++ G   G +   +  P++ ++  +Q Q   G+  ++KG  DC+K++     
Sbjct: 114 QHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVN-- 171

Query: 65  PSRLYKGISSPILMEAPKRATKFACNDEF------QKIYKDLFGAEKLTQPLSILSGASA 118
             +L +G++  +L E+      F   +          I +    A KL      L GA++
Sbjct: 172 -GQLMRGLTPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKL-----CLFGAAS 225

Query: 119 GICESFVVVPFELVKIRLQDVSSKF----TSPIAVVKNIVEKEGILAMYNGLESTMWR 172
           G     +V P +++K  +Q  + K      + + V + I+ ++G+  ++ G   TM R
Sbjct: 226 GTLLWTMVYPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 45/110 (40%), Gaps = 9/110 (8%)

Query: 185 FQVRALLPKASTKSEQTR--NDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKY 242
           F    L+    +  + TR   DLLAGT GG    L+  PFD  K R+Q +       +  
Sbjct: 5   FPTPQLIDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVK-- 62

Query: 243 NWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFFRT 292
                 +  + K EG    YKG +  ++ +G    +   V   +  FF T
Sbjct: 63  -----VIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHT 107

 Score = 32.0 bits (71), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 39/74 (52%), Gaps = 1/74 (1%)

Query: 4   QKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKE 63
           +K +P     + GA +G     ++YPLD++K+VMQ   +  +      +    + I A++
Sbjct: 210 RKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTD-NLKTPKNGNNILTVGRTIIARQ 268

Query: 64  GPSRLYKGISSPIL 77
           G S L+KG +  +L
Sbjct: 269 GVSGLFKGFAPTML 282

>Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement
          Length = 278

 Score = 91.7 bits (226), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 77/280 (27%), Positives = 122/280 (43%), Gaps = 28/280 (10%)

Query: 14  MAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSR-LYKGI 72
           + G++AG    ++ YP D VK  +Q Q        +   + C+K     EG  R  Y+GI
Sbjct: 11  LYGSIAGAVGKVIEYPFDTVKVRLQTQ----PAHMFPTTWSCIKFTYDNEGLWRGFYQGI 66

Query: 73  SSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLS--ILSGASAGICESFVVVPFE 130
            SP+   A + A  F   ++     K L   E L  PLS  + +GA AG C SFV+ P E
Sbjct: 67  GSPLAGAALENAVLFVSFNQ----AKRLLDVESLLSPLSKTVWAGAFAGACASFVLTPVE 122

Query: 131 LVKIRLQ--DVSSKFTSPIAV---VKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIF 185
           L+K +LQ  ++S+  TS   +   +K+++ + G L ++ G   T  R     A +F    
Sbjct: 123 LIKCKLQVSNLSTTKTSHTKILPTIKSVLSERGFLGLWQGQSGTFIRESGGGAAWFTTYE 182

Query: 186 QVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLST-PFDVVKSRVQNTAV-IPGVPRKYN 243
            V+  L       + T  +LLA      L+   S  P D +KS +Q   + +    RK  
Sbjct: 183 VVKNYLASRRQAEQNTTWELLASGASAGLAFNASIFPADTIKSTMQTDHIDLSSATRK-- 240

Query: 244 WSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVF 283
                   IY  +G    Y+G    ++R  P    +   +
Sbjct: 241 --------IYARQGIAGFYRGLGITLIRAVPANAAIFYTY 272

 Score = 52.8 bits (125), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 81/181 (44%), Gaps = 4/181 (2%)

Query: 112 ILSGASAGICESFVVVPFELVKIRLQDVSSK-FTSPIAVVKNIVEKEGIL-AMYNGLEST 169
           IL G+ AG     +  PF+ VK+RLQ   +  F +  + +K   + EG+    Y G+ S 
Sbjct: 10  ILYGSIAGAVGKVIEYPFDTVKVRLQTQPAHMFPTTWSCIKFTYDNEGLWRGFYQGIGSP 69

Query: 170 MWRHGIWNAGYFGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRV 229
           +    + NA  F    Q + LL   S  S  ++  + AG   G  +S + TP +++K ++
Sbjct: 70  LAGAALENAVLFVSFNQAKRLLDVESLLSPLSKT-VWAGAFAGACASFVLTPVELIKCKL 128

Query: 230 QNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDF 289
           Q  + +      +    P + ++  E GF  L++G     +R   GG      +  V ++
Sbjct: 129 Q-VSNLSTTKTSHTKILPTIKSVLSERGFLGLWQGQSGTFIRESGGGAAWFTTYEVVKNY 187

Query: 290 F 290
            
Sbjct: 188 L 188

 Score = 35.8 bits (81), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 8/67 (11%)

Query: 199 EQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGF 258
           E+   D+L G++ G +  ++  PFD VK R+Q           +  +W  +   Y  EG 
Sbjct: 4   EEAAKDILYGSIAGAVGKVIEYPFDTVKVRLQTQPA-----HMFPTTWSCIKFTYDNEG- 57

Query: 259 KALYKGF 265
             L++GF
Sbjct: 58  --LWRGF 62

>ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C
           (MRS4) - SH] complement(823895..824830) [936 bp, 311 aa]
          Length = 311

 Score = 92.0 bits (227), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 81/286 (28%), Positives = 134/286 (46%), Gaps = 28/286 (9%)

Query: 8   PFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIA---AKEG 64
           P VYQ  AGA AG+ E  +M+P+D +KT MQ   + GS    +   + L QIA     EG
Sbjct: 16  PLVYQLAAGAFAGIMEHSIMFPIDAIKTRMQAVSTTGSSAATRLPSNMLAQIAKISTTEG 75

Query: 65  PSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAE--KLTQPL-SILSGASAGIC 121
              L+KG+ S +L   P  A  FA    ++     L   E  +  QPL + LSG  A + 
Sbjct: 76  SLALWKGVQSVVLGAGPAHAVYFA---TYEMCKSRLIDPEDRQTHQPLKTALSGTLATVA 132

Query: 122 ESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYF 181
              ++ PF+ +K RLQ   S   +  AV   + ++EGI A +    +T+      N  + 
Sbjct: 133 ADALMNPFDTIKQRLQLHPSDSMTKCAV--RMYQREGIAAFFYSYPTTI----AMNIPFA 186

Query: 182 GIIFQVRALLPKASTKSEQTRND------LLAGTVGGTLSSLLSTPFDVVKSRVQ---NT 232
            + F    ++ ++STK     N+       L G + G   + ++TP D VK+ +Q     
Sbjct: 187 ALNF----VIYESSTKIFNPSNNYNPWIHCLCGGISGATCAAITTPLDCVKTVLQIRGAD 242

Query: 233 AVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGI 278
           +V   + ++ +    A + I+K  G+   ++G  P+++   P   I
Sbjct: 243 SVQSQLFKEADTFRKAASAIHKTYGWSGFFRGLKPRIISNMPATAI 288

 Score = 32.0 bits (71), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 34/81 (41%), Gaps = 2/81 (2%)

Query: 205 LLAGTVGGTLSSLLSTPFDVVKSRVQ--NTAVIPGVPRKYNWSWPALATIYKEEGFKALY 262
           L AG   G +   +  P D +K+R+Q  +T       R  +     +A I   EG  AL+
Sbjct: 21  LAAGAFAGIMEHSIMFPIDAIKTRMQAVSTTGSSAATRLPSNMLAQIAKISTTEGSLALW 80

Query: 263 KGFVPKVLRLGPGGGILLVVF 283
           KG    VL  GP   +    +
Sbjct: 81  KGVQSVVLGAGPAHAVYFATY 101

>YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protein
           with similarity to human Grave's disease carrier protein
           and to bovine homolog of Grave's disease protein, member
           of the mitochondrial carrier family (MCF) of membrane
           transporters [981 bp, 326 aa]
          Length = 326

 Score = 92.0 bits (227), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 80/305 (26%), Positives = 137/305 (44%), Gaps = 30/305 (9%)

Query: 13  FMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGI 72
           F+AG VAG     V+ P + VK ++Q+Q S  S    +G+F  ++Q+  +EG   L++G 
Sbjct: 26  FLAGGVAGAVSRTVVSPFERVKILLQVQSSTTS--YNRGIFSSIRQVYHEEGTKGLFRGN 83

Query: 73  SSPILMEAPKRATKFACNDEFQKIYKDLF------GAEKLTQPLSILSGASAGICESFVV 126
               +   P  A +F     ++   K LF      G E+LT    + SGA  G C     
Sbjct: 84  GLNCIRIFPYSAVQFVV---YEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVAT 140

Query: 127 VPFELVKIRLQDVSSKFTS-PIAVVKNIVEKEGILAMYN----------GLESTMWRHGI 175
            P +L+K RL   ++  +S   +  K+I +  GI  + +          GL   +W   +
Sbjct: 141 YPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYRLEGGLRGLYRGVWPTSL 200

Query: 176 ----WNAGYFGIIFQVRALLPKASTKSEQTRNDLLAGTVG---GTLSSLLSTPFDVVKSR 228
               + A  F +  Q+R     +S      +++L   T+G   G ++  ++ PFD+++ R
Sbjct: 201 GVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRR 260

Query: 229 VQNTAVIPG-VPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVM 287
            Q  A+    +  +Y   W AL TI + EG    YKG    + ++ P   +  +V+  V 
Sbjct: 261 FQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYEVVC 320

Query: 288 DFFRT 292
           D  R 
Sbjct: 321 DSVRN 325

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 82/188 (43%), Gaps = 19/188 (10%)

Query: 4   QKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYK---------GVFD 54
           Q+ L    +  +GA+ G   ++  YPLD++KT + +Q +  S              G++ 
Sbjct: 117 QEQLTNTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQ 176

Query: 55  CLKQIAAKEGPSR-LYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKL--TQPLS 111
            L +    EG  R LY+G+    L   P  A  FA  ++ ++   +   A+    +    
Sbjct: 177 LLSETYRLEGGLRGLYRGVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYK 236

Query: 112 ILSGASAGICESFVVVPFELVKIRLQ-------DVSSKFTSPIAVVKNIVEKEGILAMYN 164
           +  GA +G     +  PF+L++ R Q       ++  ++TS    +  I   EG+   Y 
Sbjct: 237 LTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYK 296

Query: 165 GLESTMWR 172
           GL + +++
Sbjct: 297 GLAANLFK 304

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 89/202 (44%), Gaps = 18/202 (8%)

Query: 105 KLTQPLSILSGASAGICESFVVVPFELVKIRLQDVSSKFTSPIAV---VKNIVEKEGILA 161
           K    ++ L+G  AG     VV PFE VKI LQ  SS  +    +   ++ +  +EG   
Sbjct: 19  KQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKG 78

Query: 162 MYNGLESTMWRHGIWNAGYFGIIFQV---RALLPKASTKSEQTRND--LLAGTVGGTLSS 216
           ++ G      R   ++A  F ++++    +      +   EQ  N   L +G + G  S 
Sbjct: 79  LFRGNGLNCIRIFPYSAVQF-VVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSV 137

Query: 217 LLSTPFDVVKSRVQ-NTAVIPGVPRKYNWS-------WPALATIYK-EEGFKALYKGFVP 267
           + + P D++K+R+   TA +  + R    S       W  L+  Y+ E G + LY+G  P
Sbjct: 138 VATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYRLEGGLRGLYRGVWP 197

Query: 268 KVLRLGPGGGILLVVFTGVMDF 289
             L + P   +   V+  + +F
Sbjct: 198 TSLGVVPYVALNFAVYEQLREF 219

>AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH]
           complement(702404..703249) [846 bp, 281 aa]
          Length = 281

 Score = 90.1 bits (222), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 77/280 (27%), Positives = 127/280 (45%), Gaps = 23/280 (8%)

Query: 12  QFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSR-LYK 70
             + G VAG    LV YP D VK  +Q Q    S   +   + C+     +EG  R  Y+
Sbjct: 11  DLLYGGVAGSLGKLVEYPFDTVKVRLQTQ----SAALFPTTWSCVSHTYKQEGLWRGFYQ 66

Query: 71  GISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESFVVVPFE 130
           G++SP+     + A  F   +  Q + ++ +    L +   + +GA AG C S+V+ P E
Sbjct: 67  GMASPVFGAFLEHAVLFVSFNRAQAVLENCYSCGPLEK--VVFAGAIAGACTSYVLTPVE 124

Query: 131 LVKIRLQ-----DVSS-KFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGII 184
           LVK +LQ      VS  ++T+ +  ++ IV++ G+  ++ G   T  R     A +F   
Sbjct: 125 LVKCKLQVSNLTGVSGPRYTAVLPTLRAIVKQNGLGGLWQGQSGTFIRESAGGAVWFTAY 184

Query: 185 FQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLST-PFDVVKSRVQNTAVIPGVPRKYN 243
             ++  L +    +E T  +LLA   G   +   S  P D VKS +Q   +  G      
Sbjct: 185 EVLKGWLARRRGSTENTVWELLASGAGAGAAFHASIFPADTVKSTMQTEHLGLG------ 238

Query: 244 WSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVF 283
              PA+ T+ K+ G    Y+G    +LR  P   ++  V+
Sbjct: 239 ---PAVRTVLKKHGPTGFYRGVGITLLRALPANAVIFYVY 275

 Score = 57.0 bits (136), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 49/196 (25%), Positives = 88/196 (44%), Gaps = 15/196 (7%)

Query: 90  NDEFQKIYKDLFGAEKLTQPLSILSGASAGICESFVVVPFELVKIRLQDVSSK-FTSPIA 148
           +++  K YKDL            L G  AG     V  PF+ VK+RLQ  S+  F +  +
Sbjct: 2   SEDADKAYKDL------------LYGGVAGSLGKLVEYPFDTVKVRLQTQSAALFPTTWS 49

Query: 149 VVKNIVEKEGIL-AMYNGLESTMWRHGIWNAGYFGIIFQVRALLPKASTKSEQTRNDLLA 207
            V +  ++EG+    Y G+ S ++   + +A  F    + +A+L    +     +  + A
Sbjct: 50  CVSHTYKQEGLWRGFYQGMASPVFGAFLEHAVLFVSFNRAQAVLENCYSCGPLEK-VVFA 108

Query: 208 GTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVP 267
           G + G  +S + TP ++VK ++Q + +      +Y    P L  I K+ G   L++G   
Sbjct: 109 GAIAGACTSYVLTPVELVKCKLQVSNLTGVSGPRYTAVLPTLRAIVKQNGLGGLWQGQSG 168

Query: 268 KVLRLGPGGGILLVVF 283
             +R   GG +    +
Sbjct: 169 TFIRESAGGAVWFTAY 184

>AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033)
           [1035 bp, 344 aa]
          Length = 344

 Score = 90.9 bits (224), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 69/267 (25%), Positives = 124/267 (46%), Gaps = 27/267 (10%)

Query: 48  QYKGVFDCLKQIAAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLT 107
           + +G  + L++IA  EG   L++G+   ++M  P     F+    ++ +  +   A +L 
Sbjct: 79  RLQGTLEGLRKIAQLEGLPTLWRGLGITLVMAVPANVVYFS---GYEALRDNSPLASRLP 135

Query: 108 QPLSILSGASAGICESFVVVPFELVKIRLQDVSSKFTSPIAV---------VKNIVEKEG 158
               ++ GA A I  +  + P EL++ RLQ V     +   +         +++ V   G
Sbjct: 136 VANPLVCGAFARILAATTIAPLELLRTRLQSVPRARDTERTIYLIGDLLREMRHEVSVMG 195

Query: 159 ILAMYNGLESTMWRHGIWNAGYFGII------FQVRALLPKASTKSEQTRNDLLAGTVGG 212
             A++ GLE T+WR   ++A Y+G        F  R      ++  +        G++GG
Sbjct: 196 YRALFKGLEITLWRDVPFSAIYWGTYEFCKTQFWARHAATHNASNWDHFIGSFACGSMGG 255

Query: 213 TLSSLLSTPFDVVKSRVQNTAVIP------GVPRKYNWS---WPALATIYKEEGFKALYK 263
            +++LL+ PFDV K+R+Q     P      G   K + S   +  L  I K EG +ALY 
Sbjct: 256 AVAALLTHPFDVGKTRMQIAIASPQQLTVGGKATKTDDSRGMFSFLNAIRKSEGIRALYT 315

Query: 264 GFVPKVLRLGPGGGILLVVFTGVMDFF 290
           G +P+V+++ P   I++  +     FF
Sbjct: 316 GLLPRVMKIAPSCAIMISTYELSKKFF 342

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 45/99 (45%), Gaps = 10/99 (10%)

Query: 9   FVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVS-------GGSGPQY---KGVFDCLKQ 58
           F+  F  G++ G    L+ +P D+ KT MQ+ ++       GG   +    +G+F  L  
Sbjct: 244 FIGSFACGSMGGAVAALLTHPFDVGKTRMQIAIASPQQLTVGGKATKTDDSRGMFSFLNA 303

Query: 59  IAAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIY 97
           I   EG   LY G+   ++  AP  A   +  +  +K +
Sbjct: 304 IRKSEGIRALYTGLLPRVMKIAPSCAIMISTYELSKKFF 342

 Score = 35.4 bits (80), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 33/68 (48%)

Query: 191 LPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALA 250
           + K + K    +  +++ + G  ++SL  TP DVV+ R+    ++P        S PA  
Sbjct: 1   MSKETRKEGSAKERMVSASAGSLVTSLFLTPLDVVRVRLHQQEMLPSCTCTGQLSKPAGK 60

Query: 251 TIYKEEGF 258
             +++E F
Sbjct: 61  VFWQDECF 68

>KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaYMC2
           Candida albicans Carnitine/acylcarnitine translocase (by
           homology), start by similarity
          Length = 307

 Score = 89.4 bits (220), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 72/271 (26%), Positives = 126/271 (46%), Gaps = 19/271 (7%)

Query: 13  FMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGI 72
           F+AG  +GV++  V +P D +K  +Q   +  +  ++KG  DC+ +    +G    Y G 
Sbjct: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQ---TSQNETRFKGPLDCVYKTFRNQGIRGFYLGF 83

Query: 73  SSPILMEAPKRATKFACNDEFQKI-YKDLF-GAEKLTQPLSILSGASAGICESFVVVPFE 130
           + P++      +    C   ++ + +K ++   EKL     I+SG  AG   SF+  P E
Sbjct: 84  TPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIE 143

Query: 131 LVKIRLQ----DVSSKFTSPIAVVKNIVEKEGILAMYNGLESTM--WRHGIWNAGYFGII 184
           L K +LQ      ++++  P+ V+K I   +GI  +Y GL ST+    H ++  G + ++
Sbjct: 144 LAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHFVYWWGSYELL 203

Query: 185 FQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLST-PFDVVKSRVQNTAVIPGVPRKYN 243
            +      + +TK  +   +  AG    +     +  P DVVK  V       G  + + 
Sbjct: 204 TR----WFRENTKMSEAAINFWAGGFSASFGFWTTAYPSDVVKQVVLCNDKYDGSFKSWR 259

Query: 244 WSWPALATIYKEEGFKALYKGFVPKVLRLGP 274
               A+  IY+ +G    +KGFVP  LR  P
Sbjct: 260 ---TAVKDIYQSKGINGFFKGFVPSFLRSFP 287

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/178 (20%), Positives = 79/178 (44%), Gaps = 7/178 (3%)

Query: 98  KDLFGAEKLTQPLSILSGASAGICESFVVVPFELVKIRLQDV--SSKFTSPIAVVKNIVE 155
             L   E  ++ +  ++G  +G+ ++ V  PF+ +K+RLQ     ++F  P+  V     
Sbjct: 13  NSLISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFR 72

Query: 156 KEGILAMYNGLESTMWRHGIWNAGYFGIIFQVRALLPKASTKSEQT---RNDLLAGTVGG 212
            +GI   Y G    +    + ++   G +   R L+ K    +++       +++G + G
Sbjct: 73  NQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAG 132

Query: 213 TLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVL 270
              S ++ P ++ K+++Q          +Y      +  IY  +G + LYKG +  ++
Sbjct: 133 WSVSFIAPPIELAKAKLQ--VQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLI 188

 Score = 40.4 bits (93), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 44/79 (55%), Gaps = 2/79 (2%)

Query: 2   SDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAA 61
           +D+K LP     ++G +AG S   +  P+++ K  +Q+Q    +  +YKG  D +K+I +
Sbjct: 115 NDEK-LPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYD-KTTTRYKGPLDVIKKIYS 172

Query: 62  KEGPSRLYKGISSPILMEA 80
            +G   LYKG+ S ++   
Sbjct: 173 AQGIRGLYKGLISTLIFRT 191

>Sklu_2398.4 , Contig c2398 9476-10405
          Length = 309

 Score = 89.0 bits (219), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 76/301 (25%), Positives = 134/301 (44%), Gaps = 36/301 (11%)

Query: 10  VYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLY 69
           +   ++G   G++++LV  P D+ K  +++Q S GS        D +  +   EG    Y
Sbjct: 24  IKDILSGTAGGIAQVLVGQPFDITK--VRMQTSAGSAT----AVDVVTSLIKNEGILGFY 77

Query: 70  KGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSI----LSGASAGICESFV 125
           KG  +P++      + +F  N+  ++ ++ + G    ++PLS+    + G ++G   +F+
Sbjct: 78  KGTLAPLVGVGACVSCQFGVNEAMKRRFRRMNGDP--SKPLSLKQYYVCGVASGCANAFL 135

Query: 126 VVPFELVKIRLQD-----VSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWR--HGIWNA 178
             P E V+IRLQ       ++++   +  ++ ++ K+G  A+  G  +T+ R  HG    
Sbjct: 136 ATPIEHVRIRLQLQTKSLANAEYQGSLDCMRKLL-KQG--ALMRGFTATLMRTCHG---- 188

Query: 179 GYFGIIFQVRALLPKASTKSEQTRNDL------LAGTVGGTLSSLLSTPFDVVKSRVQNT 232
             FGI F     L     K    R D+      + G   G     ++ P DVVKS +Q+ 
Sbjct: 189 --FGIYFSTYEALIANQHKKGIPRKDIAPWKVCIFGAFSGACYWAMAYPIDVVKSIMQSD 246

Query: 233 AVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFFRT 292
            ++   P      W    +IY   G +A  KGF+P +LR  P  G     F   M     
Sbjct: 247 RLVS--PVHGTNVWQVAKSIYTTRGKRAFIKGFMPAMLRSLPVNGATFATFEMTMRLLER 304

Query: 293 V 293
           V
Sbjct: 305 V 305

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 44/196 (22%), Positives = 79/196 (40%), Gaps = 12/196 (6%)

Query: 5   KPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEG 64
           KPL     ++ G  +G +   +  P++ V+  +QLQ    +  +Y+G  DC++++  K+G
Sbjct: 114 KPLSLKQYYVCGVASGCANAFLATPIEHVRIRLQLQTKSLANAEYQGSLDCMRKL-LKQG 172

Query: 65  PSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSI-LSGASAGICES 123
              L +G ++ ++         F+  +             K   P  + + GA +G C  
Sbjct: 173 A--LMRGFTATLMRTCHGFGIYFSTYEALIANQHKKGIPRKDIAPWKVCIFGAFSGACYW 230

Query: 124 FVVVPFELVKIRLQDVSSKFTSPIA------VVKNIVEKEGILAMYNGLESTMWRHGIWN 177
            +  P ++VK  +Q  S +  SP+       V K+I    G  A   G    M R    N
Sbjct: 231 AMAYPIDVVKSIMQ--SDRLVSPVHGTNVWQVAKSIYTTRGKRAFIKGFMPAMLRSLPVN 288

Query: 178 AGYFGIIFQVRALLPK 193
              F        LL +
Sbjct: 289 GATFATFEMTMRLLER 304

>Kwal_26.7653
          Length = 325

 Score = 89.0 bits (219), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 74/277 (26%), Positives = 122/277 (44%), Gaps = 20/277 (7%)

Query: 13  FMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQ--YKGVFDCLKQIAAKEGPSRLYK 70
           F+AG +A    + V  P+++VKT MQLQ    +  Q  YK     LK I   EG   L K
Sbjct: 28  FIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQK 87

Query: 71  GISSPILMEAPKRATKFACNDEFQKIYKDLF----GAEKLTQ-PLSILSGASAGICESFV 125
           G+S   + +     ++    +  + +    F       K+    ++++SGA++GI  + +
Sbjct: 88  GLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIM 147

Query: 126 VVPFELVKIRLQDVS--------SKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWN 177
             P  L+K R+Q  S        + +TS    + +I   EG   +Y G+++ + R G  +
Sbjct: 148 GSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGS 207

Query: 178 AGYFGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPG 237
           +    I    +  L K     E T   L+A TV G    ++  P+DV+ +RV N      
Sbjct: 208 SVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRVYNQK---- 263

Query: 238 VPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGP 274
               Y           + EG  ALYKGF  ++ R+ P
Sbjct: 264 -GNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAP 299

 Score = 84.3 bits (207), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 94/203 (46%), Gaps = 15/203 (7%)

Query: 103 AEKLTQPLSILSGASAGICESFVVVPFELVKIRLQ-------DVSSKFTSPIAVVKNIVE 155
           A+K+++  S ++G  A      V  P ELVK R+Q       D    + +P+  +K I +
Sbjct: 19  AQKVSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFK 78

Query: 156 KEGILAMYNGLESTMWRHGIWNAGYFGIIFQVRALLPKA------STKSEQTRNDLLAGT 209
            EGI  +  GL          N    G    +R++L K         K +    ++++G 
Sbjct: 79  NEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGA 138

Query: 210 VGGTLSSLLSTPFDVVKSRVQN--TAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVP 267
             G + +++ +P  ++K+R+Q+   A+  G    Y   W  L++IY+ EGFK LY+G   
Sbjct: 139 TSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDA 198

Query: 268 KVLRLGPGGGILLVVFTGVMDFF 290
            +LR G G  + L ++     F 
Sbjct: 199 AILRTGAGSSVQLPIYNTAKHFL 221

 Score = 33.5 bits (75), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 36/73 (49%), Gaps = 2/73 (2%)

Query: 194 ASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQ-NTAVIPGVPRKYNWSWPALATI 252
           A+ K  +T    +AG +   ++  ++ P ++VK+R+Q    +     R Y     AL  I
Sbjct: 18  AAQKVSKT-GSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVI 76

Query: 253 YKEEGFKALYKGF 265
           +K EG + L KG 
Sbjct: 77  FKNEGIRGLQKGL 89

>KLLA0E18810g 1663220..1664353 some similarities with sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), hypothetical start
          Length = 377

 Score = 88.6 bits (218), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 80/302 (26%), Positives = 133/302 (44%), Gaps = 24/302 (7%)

Query: 1   MSDQKPL--PFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQ 58
           MS  KP   PF + F+AG++AG  E  + YP +  KT +QL        +   V   +  
Sbjct: 81  MSSNKPAVDPF-HSFLAGSIAGAIEASITYPFEFAKTRLQLVDKASKASRNPLVL--IYN 137

Query: 59  IAAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASA 118
                G S +Y G  + I+    K   +F   D  + + +D    E L+    +++G  A
Sbjct: 138 TGKNYGISSIYVGCPAFIVGNTAKAGIRFLGFDTIKNLLRDKKTGE-LSGFRGVVAGLGA 196

Query: 119 GICESFV-VVPFELVKIRLQD-----VSSKFTSPIAVVKN---IVEKEGILAMYNGLEST 169
           G+ ES V V PFE +K  L D     V     +   +V N   ++  +G   +Y G+   
Sbjct: 197 GLLESVVAVTPFEAIKTALIDDKQAAVPKYQNNGKGMVSNYAKLLSDQGFSGLYRGVLPV 256

Query: 170 MWRHGIWNAGYFGIIFQVRALLPKAST----KSEQTRNDLLAGTVGGTLSSLLSTPFDVV 225
             R     A   G   +++ L+   +     K   +    + G   G ++   + P D V
Sbjct: 257 SMRQAANQAVRLGCYNKIKTLVQDYTNVPKDKPLSSGLTFIVGAFSGIVTVYTTMPIDTV 316

Query: 226 KSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTG 285
           K+R+Q+         +Y+ +    ATI+KEEG K  +KG  P++ RL   GGI+  ++  
Sbjct: 317 KTRMQSLNA-----GQYSSTINCFATIFKEEGLKTFWKGATPRLGRLILSGGIVFTIYEK 371

Query: 286 VM 287
           V+
Sbjct: 372 VL 373

>CAGL0L05742g complement(630844..631761) similar to sp|P10566
           Saccharomyces cerevisiae YJL133w MRS3 or sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4, start by
           similarity
          Length = 305

 Score = 87.4 bits (215), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 78/279 (27%), Positives = 128/279 (45%), Gaps = 13/279 (4%)

Query: 8   PFVYQFMAGAVAGVSEILVMYPLDMVKTVMQ----LQVSGGSGPQYKGVFDCLKQIAAKE 63
           P  +Q MAGA AG++E  V++PLD +KT +Q    +  +GG  P    +   L  I+A+E
Sbjct: 17  PLAHQLMAGAFAGIAEHSVIFPLDALKTRLQAMHAISTTGGQ-PIPSTMLRQLSSISAQE 75

Query: 64  GPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKD-LFGAEKLTQPLSILSGASAGICE 122
           G   L+KG+ S +L   P  A  FA  +  +    D      K     +  SGA+A I  
Sbjct: 76  GSMVLWKGVQSVLLGAGPAHAVYFATYEMVKSFLIDEATSTSKYHFFKTAFSGATATIAA 135

Query: 123 SFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFG 182
             ++ PF+++K R+Q  ++   S     K I  KEG  A Y+   +T+  +  + A  FG
Sbjct: 136 DALMNPFDVIKQRIQLNTN--ISVWDTAKRIYSKEGFQAFYSSYPTTLAINIPFAAFNFG 193

Query: 183 IIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQ---NTAVIPGVP 239
           I          +   +       L G + G   + L+TP D +K+ +Q   +  V   V 
Sbjct: 194 IYDTATRYFNPSGVYNPFIH--CLCGGISGAACAGLTTPLDCIKTALQVRGSEKVSMEVF 251

Query: 240 RKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGI 278
           ++ +    A   IY+  G++  + G  P++L   P   I
Sbjct: 252 KQADTFKKATRAIYQVYGWRGFWSGVKPRILANMPATAI 290

 Score = 30.4 bits (67), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 37/90 (41%), Gaps = 4/90 (4%)

Query: 203 NDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIP---GVPRKYNWSWPALATIYKEEGFK 259
           + L+AG   G     +  P D +K+R+Q    I    G P         L++I  +EG  
Sbjct: 20  HQLMAGAFAGIAEHSVIFPLDALKTRLQAMHAISTTGGQPIPST-MLRQLSSISAQEGSM 78

Query: 260 ALYKGFVPKVLRLGPGGGILLVVFTGVMDF 289
            L+KG    +L  GP   +    +  V  F
Sbjct: 79  VLWKGVQSVLLGAGPAHAVYFATYEMVKSF 108

>Sklu_2363.2 YPR011C, Contig c2363 11969-12940
          Length = 323

 Score = 87.0 bits (214), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 76/299 (25%), Positives = 129/299 (43%), Gaps = 23/299 (7%)

Query: 13  FMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGI 72
           F+AG +AG     V+ P + VK ++Q+Q S  +  Q  G+   ++Q+  +EG   L++G 
Sbjct: 26  FLAGGLAGAVSRTVVSPFERVKILLQVQNSTTAYNQ--GIVGAVRQVYREEGTPGLFRGN 83

Query: 73  SSPILMEAPKRATKF----ACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESFVVVP 128
               +   P  A +F    AC   F  +     G E+L     + SGA  G C      P
Sbjct: 84  GLNCIRIFPYSAVQFVVYEACKKHFFHV-DGSKGREQLQNWQRLFSGALCGGCSVLATYP 142

Query: 129 FELVKIRLQDVSSKFTS-----------PIAV----VKNIVEKEGILAMYNGLESTMWRH 173
            +LV+ RL   ++  T            P  V     +   E+ GI  +Y G+  T    
Sbjct: 143 LDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGV 202

Query: 174 GIWNAGYFGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTA 233
             + A  F +  Q +  +P+ +  +      L  G + G ++  ++ PFD+++ R Q  A
Sbjct: 203 VPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLA 262

Query: 234 VIPG-VPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFFR 291
           +    +  +Y     AL TI K EGF+  YKG    + ++ P   +  +V+  V D   
Sbjct: 263 MGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLMH 321

 Score = 53.9 bits (128), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 83/179 (46%), Gaps = 20/179 (11%)

Query: 12  QFMAGAVAGVSEILVMYPLDMVKTVMQLQVS---------GGSGPQYKGVFDCLKQIAAK 62
           +  +GA+ G   +L  YPLD+V+T + +Q +           +  +  GV+D L +   +
Sbjct: 125 RLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKE 184

Query: 63  EGPSR-LYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILS-GASAGI 120
           EG  + LY+G+    L   P  A  FA  ++F++   +  G +        LS GA +G 
Sbjct: 185 EGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPE--GTDNTLANFYKLSIGALSGG 242

Query: 121 CESFVVVPFELVKIRLQ-------DVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWR 172
               V  PF+L++ R Q       ++  ++ S +  +  I + EG    Y GL + +++
Sbjct: 243 VAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFK 301

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 56/197 (28%), Positives = 90/197 (45%), Gaps = 18/197 (9%)

Query: 110 LSILSGASAGICESFVVVPFELVKIRL--QDVSSKFTSPI-AVVKNIVEKEGILAMYNGL 166
           ++ L+G  AG     VV PFE VKI L  Q+ ++ +   I   V+ +  +EG   ++ G 
Sbjct: 24  VAFLAGGLAGAVSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGN 83

Query: 167 ESTMWRHGIWNAGYFGIIFQV---RALLPKASTKSEQTRN--DLLAGTVGGTLSSLLSTP 221
                R   ++A  F ++++           S   EQ +N   L +G + G  S L + P
Sbjct: 84  GLNCIRIFPYSAVQF-VVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYP 142

Query: 222 FDVVKSRVQ-NTAVIPGV--PRKYNWS-----WPALATIYKEE-GFKALYKGFVPKVLRL 272
            D+V++R+   TA +  +   R +N S     W  L   YKEE G K LY+G  P  L +
Sbjct: 143 LDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGV 202

Query: 273 GPGGGILLVVFTGVMDF 289
            P   +   V+    +F
Sbjct: 203 VPYVALNFAVYEQFKEF 219

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 39/79 (49%), Gaps = 2/79 (2%)

Query: 11  YQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGS--GPQYKGVFDCLKQIAAKEGPSRL 68
           Y+   GA++G     V YP D+++   Q+   GG+  G +YK V D L  I   EG    
Sbjct: 232 YKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGY 291

Query: 69  YKGISSPILMEAPKRATKF 87
           YKG+++ +    P  A  +
Sbjct: 292 YKGLTANLFKVIPSTAVSW 310

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 53/113 (46%), Gaps = 15/113 (13%)

Query: 186 QVRALLPKASTKSEQTRND----LLAGTVGGTLSSLLSTPFDVVKS--RVQN--TAVIPG 237
           ++  +LP+ S      +ND     LAG + G +S  + +PF+ VK   +VQN  TA   G
Sbjct: 3   ELAQVLPQPSYVKSILKNDSNVAFLAGGLAGAVSRTVVSPFERVKILLQVQNSTTAYNQG 62

Query: 238 VPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFF 290
           +         A+  +Y+EEG   L++G     +R+ P   +  VV+      F
Sbjct: 63  IV-------GAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHF 108

>YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [1101 bp, 366 aa]
          Length = 366

 Score = 87.0 bits (214), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 70/260 (26%), Positives = 123/260 (47%), Gaps = 23/260 (8%)

Query: 44  GSGPQYKGVFDCLKQIAAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGA 103
            S  ++ G  +   +IA+ EG + L++GIS  +LM  P     F+   E+ +    +   
Sbjct: 97  NSSLKFNGTLEAFTKIASVEGITSLWRGISLTLLMAIPANMVYFS-GYEYIRDVSPIAST 155

Query: 104 EKLTQPLSILSGASAGICESFVVVPFELVKIRLQDV--SSKFTSPIAVVKNIVEKEG--- 158
                PL    GA A +  +  + P ELVK +LQ +  SSK T    +VK+++ +     
Sbjct: 156 YPTLNPL--FCGAIARVFAATSIAPLELVKTKLQSIPRSSKSTKTWMMVKDLLNETRQEM 213

Query: 159 -----ILAMYNGLESTMWRHGIWNAGYFGI--IFQVRALLPKASTKSEQTR-----NDLL 206
                  A++ GLE T+WR   ++A Y+    + + R  L      S+        N   
Sbjct: 214 KMVGPSRALFKGLEITLWRDVPFSAIYWSSYELCKERLWLDSTRFASKDANWVHFINSFA 273

Query: 207 AGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWS---WPALATIYKEEGFKALYK 263
           +G + G ++++ + PFDV K+R Q + +    P+  N S   +  L TI++ EG  ALY 
Sbjct: 274 SGCISGMIAAICTHPFDVGKTRWQISMMNNSDPKGGNRSRNMFKFLETIWRTEGLAALYT 333

Query: 264 GFVPKVLRLGPGGGILLVVF 283
           G   +V+++ P   I++  +
Sbjct: 334 GLAARVIKIRPSCAIMISSY 353

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 53/110 (48%), Gaps = 9/110 (8%)

Query: 3   DQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGP----QYKGVFDCLKQ 58
           D   + F+  F +G ++G+   +  +P D+ KT  Q+ +   S P    + + +F  L+ 
Sbjct: 262 DANWVHFINSFASGCISGMIAAICTHPFDVGKTRWQISMMNNSDPKGGNRSRNMFKFLET 321

Query: 59  IAAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQ 108
           I   EG + LY G+++ ++   P  A   +  +    I K +FG  KL Q
Sbjct: 322 IWRTEGLAALYTGLAARVIKIRPSCAIMISSYE----ISKKVFG-NKLHQ 366

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 49/190 (25%), Positives = 74/190 (38%), Gaps = 42/190 (22%)

Query: 8   PFVYQFMAGAVAGVSEILVMYPLDMVKTVMQ-LQVSGGSGPQYKGVFDCL---KQIAAKE 63
           P +     GA+A V     + PL++VKT +Q +  S  S   +  V D L   +Q     
Sbjct: 157 PTLNPLFCGAIARVFAATSIAPLELVKTKLQSIPRSSKSTKTWMMVKDLLNETRQEMKMV 216

Query: 64  GPSR-LYKGISSPILMEAPKRA-----------------TKFACNDEFQKIYKDLFGAEK 105
           GPSR L+KG+   +  + P  A                 T+FA  D     + + F +  
Sbjct: 217 GPSRALFKGLEITLWRDVPFSAIYWSSYELCKERLWLDSTRFASKDANWVHFINSFAS-- 274

Query: 106 LTQPLSILSGASAGICESFVVVPFELVKIRLQDVSSKFTSP---------IAVVKNIVEK 156
                  +SG  A IC      PF++ K R Q      + P            ++ I   
Sbjct: 275 -----GCISGMIAAICTH----PFDVGKTRWQISMMNNSDPKGGNRSRNMFKFLETIWRT 325

Query: 157 EGILAMYNGL 166
           EG+ A+Y GL
Sbjct: 326 EGLAALYTGL 335

 Score = 35.8 bits (81), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 37/156 (23%), Positives = 65/156 (41%), Gaps = 18/156 (11%)

Query: 133 KIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIFQVRALLP 192
           ++  ++ S KF   +     I   EGI +++ G+  T+      N  YF     +R + P
Sbjct: 92  ELHCKNSSLKFNGTLEAFTKIASVEGITSLWRGISLTLLMAIPANMVYFSGYEYIRDVSP 151

Query: 193 KASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPR--KYNWSWPALA 250
            AST    T N L  G +    ++    P ++VK+++Q+      +PR  K   +W  + 
Sbjct: 152 IAST--YPTLNPLFCGAIARVFAATSIAPLELVKTKLQS------IPRSSKSTKTWMMVK 203

Query: 251 TIYKEEG--------FKALYKGFVPKVLRLGPGGGI 278
            +  E           +AL+KG    + R  P   I
Sbjct: 204 DLLNETRQEMKMVGPSRALFKGLEITLWRDVPFSAI 239

 Score = 33.1 bits (74), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 26/44 (59%)

Query: 193 KASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIP 236
           + ++ S   +  +L+   G  L+SL+ TP DVV+ R+Q   +IP
Sbjct: 4   RNTSNSLTLKERMLSAGAGSVLTSLILTPMDVVRIRLQQQQMIP 47

>YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1008 bp, 335 aa]
          Length = 335

 Score = 86.3 bits (212), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 74/290 (25%), Positives = 126/290 (43%), Gaps = 29/290 (10%)

Query: 14  MAGAVAGVSEILVMYPLDMVKTVMQ---LQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYK 70
           ++GA++G    +++ P D+ KT +Q   LQ        YKG F     I   EG + LYK
Sbjct: 43  ISGALSGALSAMLVCPFDVAKTRLQAQGLQNMTHQSQHYKGFFGTFATIFKDEGAAGLYK 102

Query: 71  GISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESFVVVPFE 130
           G+   +L   P     F+  D  +K   D+F         S  S  +AG   +    P  
Sbjct: 103 GLQPTVLGYIPTLMIYFSVYDFCRKYSVDIFPHSPFLSNAS--SAITAGAISTVATNPIW 160

Query: 131 LVKIRLQ------DVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGII 184
           +VK RL         S+ +   I   + I+++EG  A+Y GL   +   G+ N     I 
Sbjct: 161 VVKTRLMLQTGIGKYSTHYKGTIDTFRKIIQQEGAKALYAGLVPALL--GMLNV---AIQ 215

Query: 185 FQVRALLPKASTKSEQT-----------RNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTA 233
           F +   L      SE T           +  +LA  +   ++S ++ P +++++R+Q  +
Sbjct: 216 FPLYENLKIRFGYSESTDVSTDVTSSNFQKLILASMLSKMVASTVTYPHEILRTRMQLKS 275

Query: 234 VIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVF 283
            +P   +++    P +   Y++EGF   Y GF   ++R  P   + LV F
Sbjct: 276 DLPNTVQRH--LLPLIKITYRQEGFAGFYSGFATNLVRTVPAAVVTLVSF 323

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 51/97 (52%), Gaps = 6/97 (6%)

Query: 197 KSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAV--IPGVPRKYNWSWPALATIYK 254
           K+   R   ++G + G LS++L  PFDV K+R+Q   +  +    + Y   +   ATI+K
Sbjct: 34  KNADPRVAAISGALSGALSAMLVCPFDVAKTRLQAQGLQNMTHQSQHYKGFFGTFATIFK 93

Query: 255 EEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFFR 291
           +EG   LYKG  P VL   P     L+++  V DF R
Sbjct: 94  DEGAAGLYKGLQPTVLGYIP----TLMIYFSVYDFCR 126

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 73/173 (42%), Gaps = 17/173 (9%)

Query: 110 LSILSGASAGICESFVVVPFELVKIRLQ--------DVSSKFTSPIAVVKNIVEKEGILA 161
           ++ +SGA +G   + +V PF++ K RLQ          S  +         I + EG   
Sbjct: 40  VAAISGALSGALSAMLVCPFDVAKTRLQAQGLQNMTHQSQHYKGFFGTFATIFKDEGAAG 99

Query: 162 MYNGLESTMWRHGIWNAGYFGIIFQVRA----LLPKASTKSEQTRNDLLAGTVGGTLSSL 217
           +Y GL+ T+  +      YF +    R     + P +   S  +     +    G +S++
Sbjct: 100 LYKGLQPTVLGYIPTLMIYFSVYDFCRKYSVDIFPHSPFLSNAS-----SAITAGAISTV 154

Query: 218 LSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVL 270
            + P  VVK+R+     I      Y  +      I ++EG KALY G VP +L
Sbjct: 155 ATNPIWVVKTRLMLQTGIGKYSTHYKGTIDTFRKIIQQEGAKALYAGLVPALL 207

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 75/180 (41%), Gaps = 20/180 (11%)

Query: 8   PFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVS-GGSGPQYKGVFDCLKQIAAKEGPS 66
           PF+    +   AG    +   P+ +VKT + LQ   G     YKG  D  ++I  +EG  
Sbjct: 137 PFLSNASSAITAGAISTVATNPIWVVKTRLMLQTGIGKYSTHYKGTIDTFRKIIQQEGAK 196

Query: 67  RLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLS----------ILSGA 116
            LY G+  P L+     A +F   +      K  FG  + T   +          IL+  
Sbjct: 197 ALYAGL-VPALLGMLNVAIQFPLYENL----KIRFGYSESTDVSTDVTSSNFQKLILASM 251

Query: 117 SAGICESFVVVPFELVKIRLQ---DVSSKFTSPIA-VVKNIVEKEGILAMYNGLESTMWR 172
            + +  S V  P E+++ R+Q   D+ +     +  ++K    +EG    Y+G  + + R
Sbjct: 252 LSKMVASTVTYPHEILRTRMQLKSDLPNTVQRHLLPLIKITYRQEGFAGFYSGFATNLVR 311

>Kwal_27.12481
          Length = 304

 Score = 85.5 bits (210), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 79/297 (26%), Positives = 131/297 (44%), Gaps = 26/297 (8%)

Query: 1   MSD-QKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQ----VSGGSGPQYKGVFDC 55
           M+D +K   F   F+ G V+         P++ VK ++Q Q      G    +Y G+ +C
Sbjct: 1   MADSKKQSNFAVDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGSLDRRYTGIGEC 60

Query: 56  LKQIAAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQ-----PL 110
            K+ AA EG +  ++G ++ ++   P +A  FA  D+     K +FG +K          
Sbjct: 61  FKRTAANEGIASFWRGNTANVIRYFPTQALNFAFKDKI----KAMFGFKKEEGYAKWFAG 116

Query: 111 SILSGASAGICESFVVVPFELVKIRLQDVSS--------KFTSPIAVVKNIVEKEGILAM 162
           ++ SG +AG      V   +  + RL   S         +F   + V K  +  +GI  +
Sbjct: 117 NLASGGAAGGLSLMFVYSLDYARTRLAADSKGAKKGGERQFNGLVDVYKKTLASDGIAGL 176

Query: 163 YNGLESTMWRHGIWNAGYFGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPF 222
           Y G   ++    ++   YFG    ++ LL   S +     + LL   V  T +S  S P 
Sbjct: 177 YRGFLPSVVGIVVYRGLYFGGYDSLKPLLLTGSLEGSFLASFLLGWAV-TTGASTASYPL 235

Query: 223 DVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGIL 279
           D V+ R+  T+   G   KYN ++ A   I   EG K+L+KG    +LR   G G++
Sbjct: 236 DTVRRRMMMTS---GQAVKYNGAFDAFRKIVAAEGIKSLFKGCGANILRGVAGAGVI 289

>CAGL0F08305g complement(827705..828829) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 374

 Score = 85.5 bits (210), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 71/258 (27%), Positives = 114/258 (44%), Gaps = 28/258 (10%)

Query: 48  QYKGVFDCLKQIAAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLT 107
           ++ G  +  ++IA  EG + L++GIS  +LM  P     F    E+ +    L G     
Sbjct: 109 KFNGTLEAFEKIAKFEGVTTLWRGISITLLMAIPANVVYFT-GYEYVRDRSPLNGLYPTI 167

Query: 108 QPLSILSGASAGICESFVVVPFELVKIRLQDVSSK---------FTSPIAVVKNIVEKEG 158
            PL  + GA A    +  V P EL+K +LQ + S          +      +K+ +   G
Sbjct: 168 NPL--ICGAFARTLAATSVAPLELIKTKLQSIPSSSMKNGSVIMYRDLFNEIKSEIAMRG 225

Query: 159 IL-AMYNGLESTMWRH----GIWNAGYFGIIFQVRALLPKASTKSEQT----RNDLLAGT 209
           +   M+ GLE T+WR      I+ A Y     +V  L P    K+        N  L G 
Sbjct: 226 VAQTMFKGLEITLWRDVPFSAIYWASYEFYKTKVAYLSPSTFDKNSSNWFHFTNSFLGGF 285

Query: 210 VGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIY-------KEEGFKALY 262
           + G+L+++ + PFDV K+R Q + V        N  + +  T++       K EG  ALY
Sbjct: 286 ISGSLAAICTHPFDVGKTRQQISLVTDKKLANSNLKYGSSNTMFGFLNYIRKTEGIGALY 345

Query: 263 KGFVPKVLRLGPGGGILL 280
            G  P+V ++ P   I++
Sbjct: 346 TGLAPRVAKIAPSCAIMI 363

 Score = 34.7 bits (78), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 48/198 (24%), Positives = 81/198 (40%), Gaps = 39/198 (19%)

Query: 3   DQKPL----PFVYQFMAGAVAGVSEILVMYPLDMVKTVMQ----LQVSGGSGPQYKGVFD 54
           D+ PL    P +   + GA A       + PL+++KT +Q      +  GS   Y+ +F+
Sbjct: 156 DRSPLNGLYPTINPLICGAFARTLAATSVAPLELIKTKLQSIPSSSMKNGSVIMYRDLFN 215

Query: 55  CLK-QIAAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLS-- 111
            +K +IA +     ++KG+   +  + P  A  +A + EF K            +  S  
Sbjct: 216 EIKSEIAMRGVAQTMFKGLEITLWRDVPFSAIYWA-SYEFYKTKVAYLSPSTFDKNSSNW 274

Query: 112 ----------ILSGASAGICESFVVVPFELVKIRLQ----------DVSSKFTSP---IA 148
                      +SG+ A IC      PF++ K R Q          + + K+ S      
Sbjct: 275 FHFTNSFLGGFISGSLAAICTH----PFDVGKTRQQISLVTDKKLANSNLKYGSSNTMFG 330

Query: 149 VVKNIVEKEGILAMYNGL 166
            +  I + EGI A+Y GL
Sbjct: 331 FLNYIRKTEGIGALYTGL 348

 Score = 30.0 bits (66), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 22/31 (70%)

Query: 205 LLAGTVGGTLSSLLSTPFDVVKSRVQNTAVI 235
           +++ TVG  L+S++ TP DVV+ R+Q   ++
Sbjct: 15  MMSATVGSLLTSVILTPMDVVRIRLQQQQML 45

 Score = 28.5 bits (62), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 41/92 (44%), Gaps = 2/92 (2%)

Query: 140 SSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIFQVRALLPKASTKSE 199
           + KF   +   + I + EG+  ++ G+  T+      N  YF     VR   P       
Sbjct: 107 NQKFNGTLEAFEKIAKFEGVTTLWRGISITLLMAIPANVVYFTGYEYVRDRSPLNGLYP- 165

Query: 200 QTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQN 231
            T N L+ G    TL++    P +++K+++Q+
Sbjct: 166 -TINPLICGAFARTLAATSVAPLELIKTKLQS 196

 Score = 28.5 bits (62), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 35/84 (41%), Gaps = 8/84 (9%)

Query: 9   FVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVS-----GGSGPQY---KGVFDCLKQIA 60
           F   F+ G ++G    +  +P D+ KT  Q+ +        S  +Y     +F  L  I 
Sbjct: 277 FTNSFLGGFISGSLAAICTHPFDVGKTRQQISLVTDKKLANSNLKYGSSNTMFGFLNYIR 336

Query: 61  AKEGPSRLYKGISSPILMEAPKRA 84
             EG   LY G++  +   AP  A
Sbjct: 337 KTEGIGALYTGLAPRVAKIAPSCA 360

>Kwal_33.14050
          Length = 314

 Score = 84.7 bits (208), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 76/283 (26%), Positives = 126/283 (44%), Gaps = 18/283 (6%)

Query: 8   PFVYQFMAGAVAGVSEILVMYPLDMVKTVMQ-LQVSGGSGPQY----KGVFDCLKQIAAK 62
           P  +Q  AGA AG+ E  +M+P+D +KT MQ L  + GS          +   + +I+  
Sbjct: 15  PLTHQLAAGAFAGIMEHSIMFPIDAIKTRMQALSATIGSANAAAKLPSNIVQQIARISTT 74

Query: 63  EGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPL-SILSGASAGIC 121
           EG   L+KG+ S IL   P  A  FA   E  K Y       +  QPL +  SG +A + 
Sbjct: 75  EGSMALWKGVQSVILGAGPAHAVYFA-TYEMCKSYLIDPQDFQTHQPLKTAASGIAATVA 133

Query: 122 ESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYF 181
              ++ PF+ +K R+Q  +       +V   I   EG+ A +    +T+  +  + A  F
Sbjct: 134 ADLLMNPFDTIKQRMQLRTFSKDRMWSVASRIYRNEGLAAFFYSYPTTIAMNIPFAAFNF 193

Query: 182 GIIFQVRALLPKASTKSEQTRNDL---LAGTVGGTLSSLLSTPFDVVKSRVQ---NTAVI 235
            I               E T N L   L G + G   + ++TP D +K+ +Q   + +V+
Sbjct: 194 AIYESATKFF-----NPENTYNPLIHCLCGGISGATCAAITTPLDCIKTVLQVRGSESVV 248

Query: 236 PGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGI 278
             + R+ +    A + I K  G+   ++G  P+++   P   I
Sbjct: 249 DPLFRQADTFSRAASAISKVYGWSGFWRGLKPRIISNMPATAI 291

 Score = 63.2 bits (152), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 89/206 (43%), Gaps = 19/206 (9%)

Query: 97  YKDLFGAEKLTQPLSILSGASAGICESFVVVPFELVKIRLQDVSSKFTSPIAVVK---NI 153
           Y+ L     LT  L+  +GA AGI E  ++ P + +K R+Q +S+   S  A  K   NI
Sbjct: 7   YESLPTNAPLTHQLA--AGAFAGIMEHSIMFPIDAIKTRMQALSATIGSANAAAKLPSNI 64

Query: 154 VEK-------EGILAMYNGLESTMWRHGIWNAGYFGIIFQVRA-LLPKASTKSEQTRNDL 205
           V++       EG +A++ G++S +   G  +A YF      ++ L+     ++ Q     
Sbjct: 65  VQQIARISTTEGSMALWKGVQSVILGAGPAHAVYFATYEMCKSYLIDPQDFQTHQPLKTA 124

Query: 206 LAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGF 265
            +G      + LL  PFD +K R+Q    +    +   WS    + IY+ EG  A +  +
Sbjct: 125 ASGIAATVAADLLMNPFDTIKQRMQ----LRTFSKDRMWS--VASRIYRNEGLAAFFYSY 178

Query: 266 VPKVLRLGPGGGILLVVFTGVMDFFR 291
              +    P       ++     FF 
Sbjct: 179 PTTIAMNIPFAAFNFAIYESATKFFN 204

>KLLA0F17864g complement(1634241..1635164) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 307

 Score = 84.3 bits (207), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 75/295 (25%), Positives = 132/295 (44%), Gaps = 35/295 (11%)

Query: 15  AGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGISS 74
           +G V GV+++LV  P D++K  ++LQ   G+   ++ + D +K     EG    YKG  +
Sbjct: 30  SGTVGGVAQVLVGQPFDIIK--VRLQTMPGNATAWEAITDLVKY----EGFMGFYKGTMA 83

Query: 75  PILMEAPKRATKFACNDEFQKIYKDLFGAEKL-TQPLSI----LSGASAGICESFVVVPF 129
           P++      + +F  N+  ++ ++DL  +  +    LS+      G  +G   + +  P 
Sbjct: 84  PLVGVGACVSCQFGINEAMKRYFRDLNRSRGIYDNTLSLGQYYTCGFVSGSANALLATPI 143

Query: 130 ELVKIRLQD-----VSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWR--HGIWNAGYFG 182
           E V+IRLQ       ++++ S +   + ++++  ++    G  +T+ R  HG      FG
Sbjct: 144 EHVRIRLQLQKEALANAEYKSTLDCTEKLLKQGSLM---RGFTATLMRTSHG------FG 194

Query: 183 IIFQVRALLPKASTKSEQTRNDLLA------GTVGGTLSSLLSTPFDVVKSRVQNTAVIP 236
           I F     L  +       R D+ A      G + G     ++ PFDVVKS +Q   ++ 
Sbjct: 195 IYFLTYETLIASQLAHGFRREDISAWKACMFGALSGAFFWAMTYPFDVVKSVMQADKLVN 254

Query: 237 GVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFFR 291
             P            IY+E G +A  KGF+P +LR  P  G     F   M   +
Sbjct: 255 --PAYGTNVVQVAKNIYRERGLRAFTKGFMPTMLRSLPVNGATFAAFEVTMQMLK 307

 Score = 49.7 bits (117), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 86/193 (44%), Gaps = 17/193 (8%)

Query: 99  DLFGAEKLTQPLSILSGASAGICESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEG 158
           DL G  K  +   + SG   G+ +  V  PF+++K+RLQ +    T+  A+  ++V+ EG
Sbjct: 17  DLHGFRKTLK--DVFSGTVGGVAQVLVGQPFDIIKVRLQTMPGNATAWEAIT-DLVKYEG 73

Query: 159 ILAMYNGLESTMWRHGIWNAGYFGIIFQVRALLPKASTKSEQTRNDL------LAGTVGG 212
            +  Y G  + +   G   +  FGI   ++      +       N L        G V G
Sbjct: 74  FMGFYKGTMAPLVGVGACVSCQFGINEAMKRYFRDLNRSRGIYDNTLSLGQYYTCGFVSG 133

Query: 213 TLSSLLSTPFDVVKSR--VQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVL 270
           + ++LL+TP + V+ R  +Q  A+      +Y  +      + K+    +L +GF   ++
Sbjct: 134 SANALLATPIEHVRIRLQLQKEALANA---EYKSTLDCTEKLLKQ---GSLMRGFTATLM 187

Query: 271 RLGPGGGILLVVF 283
           R   G GI  + +
Sbjct: 188 RTSHGFGIYFLTY 200

 Score = 47.0 bits (110), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 77/169 (45%), Gaps = 16/169 (9%)

Query: 13  FMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGI 72
           +  G V+G +  L+  P++ V+  +QLQ    +  +YK   DC +++  K+G   L +G 
Sbjct: 126 YTCGFVSGSANALLATPIEHVRIRLQLQKEALANAEYKSTLDCTEKL-LKQGS--LMRGF 182

Query: 73  SSPILMEAPKRATKFACNDEFQKIYKDL---FGAEKLTQPLSILSGASAGICESFVVVPF 129
           ++ ++  +      F   +    I   L   F  E ++   + + GA +G     +  PF
Sbjct: 183 TATLMRTSHGFGIYFLTYETL--IASQLAHGFRREDISAWKACMFGALSGAFFWAMTYPF 240

Query: 130 ELVKIRLQDVSSKFTSP------IAVVKNIVEKEGILAMYNGLESTMWR 172
           ++VK  +Q  + K  +P      + V KNI  + G+ A   G   TM R
Sbjct: 241 DVVKSVMQ--ADKLVNPAYGTNVVQVAKNIYRERGLRAFTKGFMPTMLR 287

>YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1122 bp, 373 aa]
          Length = 373

 Score = 85.1 bits (209), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 70/293 (23%), Positives = 131/293 (44%), Gaps = 25/293 (8%)

Query: 14  MAGAVAGVSEILVMYPLDMVKTVMQLQ--VSGGSGPQYKGVFDCLKQIAAKEGPSRLYKG 71
           ++GA AG    + + PLD+ KT +Q Q   +    P Y+G+   L  I   EGP  LYKG
Sbjct: 82  LSGAFAGFLSGVAVCPLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTIVRDEGPRGLYKG 141

Query: 72  ISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESFVVVPFEL 131
           +   +L   P     F+  +  +K +  +F            +  +AG   + +  P  +
Sbjct: 142 LVPIVLGYFPTWMIYFSVYEFSKKFFHGIFPQFDFVA--QSCAAITAGAASTTLTNPIWV 199

Query: 132 VKIRLQ------DVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAG-----Y 180
           VK RL       +  + +       + +  +EG  A+Y GL  ++   G+++       Y
Sbjct: 200 VKTRLMLQSNLGEHPTHYKGTFDAFRKLFYQEGFKALYAGLVPSLL--GLFHVAIHFPIY 257

Query: 181 FGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIP-GVP 239
             +  +      + +T S   +  ++A +V   ++S ++ P +++++R+Q  + IP  + 
Sbjct: 258 EDLKVRFHCYSRENNTNSINLQRLIMASSVSKMIASAVTYPHEILRTRMQLKSDIPDSIQ 317

Query: 240 RKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFFRT 292
           R+    +P +   Y +EG K  Y GF   ++R  P   I LV F    ++FR 
Sbjct: 318 RRL---FPLIKATYAQEGLKGFYSGFTTNLVRTIPASAITLVSF----EYFRN 363

 Score = 61.6 bits (148), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 52/181 (28%), Positives = 80/181 (44%), Gaps = 30/181 (16%)

Query: 110 LSILSGASAGICESFVVVPFELVKIRLQD--VSSKFTSP-----IAVVKNIVEKEGILAM 162
           ++ LSGA AG      V P ++ K RLQ   + ++F +P     +  +  IV  EG   +
Sbjct: 79  ITALSGAFAGFLSGVAVCPLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTIVRDEGPRGL 138

Query: 163 YNGLESTMWRHGIWNAGYFG---IIFQV--------RALLPKASTKSEQTRNDLLAGTVG 211
           Y GL   +        GYF    I F V          + P+    ++       A    
Sbjct: 139 YKGLVPIVL-------GYFPTWMIYFSVYEFSKKFFHGIFPQFDFVAQSC-----AAITA 186

Query: 212 GTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLR 271
           G  S+ L+ P  VVK+R+   + +   P  Y  ++ A   ++ +EGFKALY G VP +L 
Sbjct: 187 GAASTTLTNPIWVVKTRLMLQSNLGEHPTHYKGTFDAFRKLFYQEGFKALYAGLVPSLLG 246

Query: 272 L 272
           L
Sbjct: 247 L 247

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 41/89 (46%), Gaps = 1/89 (1%)

Query: 206 LAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWS-WPALATIYKEEGFKALYKG 264
           L+G   G LS +   P DV K+R+Q   +       Y       L+TI ++EG + LYKG
Sbjct: 82  LSGAFAGFLSGVAVCPLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTIVRDEGPRGLYKG 141

Query: 265 FVPKVLRLGPGGGILLVVFTGVMDFFRTV 293
            VP VL   P   I   V+     FF  +
Sbjct: 142 LVPIVLGYFPTWMIYFSVYEFSKKFFHGI 170

>YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 84.3 bits (207), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 77/295 (26%), Positives = 128/295 (43%), Gaps = 25/295 (8%)

Query: 2   SDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQ----VSGGSGPQYKGVFDCLK 57
           + Q+   F   F+ G V+         P++ VK ++Q Q      G    +Y G+ DC K
Sbjct: 5   AKQQETNFAINFLMGGVSAAIAKTAASPIERVKILIQNQDEMIKQGTLDKKYSGIVDCFK 64

Query: 58  QIAAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQ-----PLSI 112
           + A +EG    ++G ++ ++   P +A  FA  D+     K +FG +K          ++
Sbjct: 65  RTAKQEGLISFWRGNTANVIRYFPTQALNFAFKDKI----KLMFGFKKEEGYGKWFAGNL 120

Query: 113 LSGASAGICESFVVVPFELVKIRL-QDVSS-------KFTSPIAVVKNIVEKEGILAMYN 164
            SG +AG      V   +  + RL  D  S       +F     V K  ++ +GI  +Y 
Sbjct: 121 ASGGAAGALSLLFVYSLDFARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGIAGLYR 180

Query: 165 GLESTMWRHGIWNAGYFGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDV 224
           G   ++    ++   YFG+   ++ L+   S       + LL G V  T +S  S P D 
Sbjct: 181 GFMPSVVGIVVYRGLYFGMFDSLKPLVLTGSLDGSFLASFLL-GWVVTTGASTCSYPLDT 239

Query: 225 VKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGIL 279
           V+ R+  T+   G   KYN +   L  I   EG  +L+KG    +LR   G G++
Sbjct: 240 VRRRMMMTS---GQAVKYNGAIDCLKKIVASEGVGSLFKGCGANILRSVAGAGVI 291

>YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [957 bp, 318 aa]
          Length = 318

 Score = 84.0 bits (206), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 75/288 (26%), Positives = 128/288 (44%), Gaps = 25/288 (8%)

Query: 9   FVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQ----VSGGSGPQYKGVFDCLKQIAAKEG 64
           F+  F+ G V+         P++ VK ++Q Q      G    +Y G+ DC K+ A +EG
Sbjct: 23  FLIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMLKQGTLDRKYAGILDCFKRTATQEG 82

Query: 65  PSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQ-----PLSILSGASAG 119
               ++G ++ ++   P +A  FA  D+     K +FG +K          ++ SG +AG
Sbjct: 83  VISFWRGNTANVIRYFPTQALNFAFKDKI----KAMFGFKKEEGYAKWFAGNLASGGAAG 138

Query: 120 ICESFVVVPFELVKIRLQDVSS--------KFTSPIAVVKNIVEKEGILAMYNGLESTMW 171
                 V   +  + RL   S         +F   I V K  ++ +G+  +Y G   ++ 
Sbjct: 139 ALSLLFVYSLDYARTRLAADSKSSKKGGARQFNGLIDVYKKTLKSDGVAGLYRGFLPSVV 198

Query: 172 RHGIWNAGYFGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQN 231
              ++   YFG+   ++ LL   S +     + LL G V  T +S  S P D V+ R+  
Sbjct: 199 GIVVYRGLYFGMYDSLKPLLLTGSLEGSFLASFLL-GWVVTTGASTCSYPLDTVRRRMMM 257

Query: 232 TAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGIL 279
           T+   G   KY+ ++  L  I   EG  +L+KG    +LR   G G++
Sbjct: 258 TS---GQAVKYDGAFDCLRKIVAAEGVGSLFKGCGANILRGVAGAGVI 302

>YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of
           the mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses defects in
           splicing of mitochondrial introns [915 bp, 304 aa]
          Length = 304

 Score = 83.6 bits (205), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 81/293 (27%), Positives = 130/293 (44%), Gaps = 23/293 (7%)

Query: 8   PFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSR 67
           P   Q +AGA AG+ E  +M+P+D +KT  ++Q +G +     G+   + +I+  EG   
Sbjct: 22  PLHSQLLAGAFAGIMEHSLMFPIDALKT--RVQAAGLNKAASTGMISQISKISTMEGSMA 79

Query: 68  LYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKL--TQPL-SILSGASAGICESF 124
           L+KG+ S IL   P  A  F    EF K    L   E +   QP+ + LSG  A I    
Sbjct: 80  LWKGVQSVILGAGPAHAVYFG-TYEFCK--ARLISPEDMQTHQPMKTALSGTIATIAADA 136

Query: 125 VVVPFELVKIRLQ-DVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGI 183
           ++ PF+ VK RLQ D + +  +   V K I + EG  A Y    +T+  +  + A  F I
Sbjct: 137 LMNPFDTVKQRLQLDTNLRVWN---VTKQIYQNEGFAAFYYSYPTTLAMNIPFAAFNFMI 193

Query: 184 IFQVRALLPKASTKSEQTRNDL---LAGTVGGTLSSLLSTPFDVVKSRVQ---NTAVIPG 237
                          + + N L   L G + G   + L+TP D +K+ +Q   +  V   
Sbjct: 194 YESASKFF-----NPQNSYNPLIHCLCGGISGATCAALTTPLDCIKTVLQVRGSETVSIE 248

Query: 238 VPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFF 290
           + +  N    A   I +  G+K  ++G  P+++   P   I    +     F 
Sbjct: 249 IMKDANTFGRASRAILEVHGWKGFWRGLKPRIVANIPATAISWTAYECAKHFL 301

>YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein of
           the mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to Mrs4p and Mrs3p [855 bp,
           284 aa]
          Length = 284

 Score = 83.2 bits (204), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 78/300 (26%), Positives = 138/300 (46%), Gaps = 49/300 (16%)

Query: 9   FVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGG--SGPQYKGVFDCLKQIAAKEGPS 66
           F    ++GA AG S  LV +P+D +KT  +LQ  GG  +   YKG+              
Sbjct: 4   FFLSLLSGAAAGTSTDLVFFPIDTIKT--RLQAKGGFFANGGYKGI-------------- 47

Query: 67  RLYKGISSPILMEAPKRATKFACNDEFQ--------KIYKDLFGAEKLTQPLSILSGASA 118
             Y+G+ S ++  AP  +  F   D  +        K+Y    G+E+L    + +  +S 
Sbjct: 48  --YRGLGSAVVASAPGASLFFISYDYMKVKSRPYISKLYSQ--GSEQLIDTTTHMLSSSI 103

Query: 119 G-ICESFVVVPFELVKIRLQ--DVSSKFTSPIAVVKNIVEKEGILA-MYNGLESTMWRHG 174
           G IC   V VP E+VK R Q    +S + +  ++++N   KEG+   +Y G  +T+ R  
Sbjct: 104 GEICACLVRVPAEVVKQRTQVHSTNSSWQTLQSILRN-DNKEGLRKNLYRGWSTTIMREI 162

Query: 175 IWNAGYFGIIFQVRALLPKASTKSE-QTRNDLLAGTVGGTLSSLLSTPFDVVKSRV---Q 230
            +    F +   ++    KA+ +S+ +     + G++ G +++  +TP D +K+R+   +
Sbjct: 163 PFTCIQFPLYEYLKKTWAKANGQSQVEPWKGAICGSIAGGIAAATTTPLDFLKTRLMLNK 222

Query: 231 NTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFF 290
            TA +  V          +  IY+EEG    + G  P+ + +  GG I L ++  V    
Sbjct: 223 TTASLGSV----------IIRIYREEGPAVFFSGVGPRTMWISAGGAIFLGMYETVHSLL 272

>Scas_718.24
          Length = 337

 Score = 83.6 bits (205), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 76/297 (25%), Positives = 132/297 (44%), Gaps = 26/297 (8%)

Query: 1   MSDQKPLP-FVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVS----GGSGPQYKGVFDC 55
           MS +KP   F   F+ G V+         P++ VK ++Q Q      G    +YKG+ DC
Sbjct: 33  MSTEKPQSNFAIDFLMGGVSAAVAKTAASPIERVKLLIQNQNEMLKQGTLDTKYKGIVDC 92

Query: 56  LKQIAAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQ-----PL 110
            ++ A +EG    ++G ++ ++   P +A  FA  D+     K +FG +K          
Sbjct: 93  FRRTAQQEGIISFWRGNTANVIRYFPTQALNFAFKDKI----KLMFGFKKEDGYGKWFAG 148

Query: 111 SILSGASAGICESFVVVPFELVKIRL--------QDVSSKFTSPIAVVKNIVEKEGILAM 162
           ++ SG +AG      V   +  + RL        +  S +F   I V K  ++ +G+  +
Sbjct: 149 NLASGGAAGGLSLLFVYSLDFARTRLAADSKSSKKGGSRQFNGLIDVYKKTLKSDGVAGL 208

Query: 163 YNGLESTMWRHGIWNAGYFGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPF 222
           Y G   ++    ++   YFG+   ++ +L   S +     + LL G V  T +S  S P 
Sbjct: 209 YRGFLPSVVGIIVYRGLYFGLYDSIKPVLLTGSLEGSFLASFLL-GWVVTTGASTCSYPL 267

Query: 223 DVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGIL 279
           D V+ ++  T+   G   KY  ++     I   EG  +L+KG    +LR   G G++
Sbjct: 268 DTVRRKMMMTS---GQAVKYKGAFDCFKKIVAAEGVASLFKGCGANILRGVAGAGVI 321

>CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces
           cerevisiae YIL006w or sp|P39953 Saccharomyces cerevisiae
           YEL006w, hypothetical start
          Length = 361

 Score = 83.6 bits (205), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 73/300 (24%), Positives = 128/300 (42%), Gaps = 31/300 (10%)

Query: 14  MAGAVAGVSEILVMYPLDMVKTVMQ---LQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYK 70
           ++GA+AG+   +V+ PLD+ KT +Q   LQ        Y+G    +  I   EG   LYK
Sbjct: 73  ISGALAGLLSGIVVCPLDVAKTRLQAQGLQTRTTENLYYRGSIGTMTTIVRDEGVRGLYK 132

Query: 71  GISSPILMEAPKRATKFA----CNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESFVV 126
           G+   I+   P     F+    C D  +        +   +      S  +AG   + V 
Sbjct: 133 GLVPIIMGYFPTWMIYFSVYEFCKDNLRT------NSSNWSFVSHSFSAITAGAVSTVVT 186

Query: 127 VPFELVKIRLQ------DVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGY 180
            P  +VK RL         ++ +       K I+ +EG+ A+Y GL  ++   G+ +   
Sbjct: 187 NPIWVVKTRLMLQTHIGSNTTHYQGTYDAFKKIINQEGVKALYAGLVPSLL--GLLHVAI 244

Query: 181 FGIIFQVRALLPKASTKSEQTRND-------LLAGTVGGTLSSLLSTPFDVVKSRVQNTA 233
              +++   +  K   + E +          +LA +V   ++S+LS P +++++R+Q  +
Sbjct: 245 HFPVYERLKVSFKCYQRDESSNESKINLKRLILASSVSKMVASVLSYPHEILRTRLQLKS 304

Query: 234 VIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFFRTV 293
            +P   R+     P +   Y +EG    Y GF   + R  P   I LV F  V +F   +
Sbjct: 305 DLPSHQRRL---IPLIKITYIQEGIFGFYSGFGTNLFRTLPASAITLVSFEYVRNFLNKI 361

 Score = 62.8 bits (151), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 52/189 (27%), Positives = 82/189 (43%), Gaps = 9/189 (4%)

Query: 92  EFQKIYKDLFGAEKLTQPLSILSGASAGICESFVVVPFELVKIRLQDVSSK--------F 143
           E  ++   LFG       ++ +SGA AG+    VV P ++ K RLQ    +        +
Sbjct: 52  EVPRVRNTLFGFTLNDNRINAISGALAGLLSGIVVCPLDVAKTRLQAQGLQTRTTENLYY 111

Query: 144 TSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIFQVRALLPKASTKSEQTRN 203
              I  +  IV  EG+  +Y GL   +  +      YF +    +  L   S+      +
Sbjct: 112 RGSIGTMTTIVRDEGVRGLYKGLVPIIMGYFPTWMIYFSVYEFCKDNLRTNSSNWSFVSH 171

Query: 204 DLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYK 263
              A T G  +S++++ P  VVK+R+     I      Y  ++ A   I  +EG KALY 
Sbjct: 172 SFSAITAGA-VSTVVTNPIWVVKTRLMLQTHIGSNTTHYQGTYDAFKKIINQEGVKALYA 230

Query: 264 GFVPKVLRL 272
           G VP +L L
Sbjct: 231 GLVPSLLGL 239

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 45/96 (46%), Gaps = 2/96 (2%)

Query: 199 EQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRK--YNWSWPALATIYKEE 256
              R + ++G + G LS ++  P DV K+R+Q   +         Y  S   + TI ++E
Sbjct: 66  NDNRINAISGALAGLLSGIVVCPLDVAKTRLQAQGLQTRTTENLYYRGSIGTMTTIVRDE 125

Query: 257 GFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFFRT 292
           G + LYKG VP ++   P   I   V+    D  RT
Sbjct: 126 GVRGLYKGLVPIIMGYFPTWMIYFSVYEFCKDNLRT 161

>Kwal_14.2210
          Length = 315

 Score = 82.8 bits (203), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 80/298 (26%), Positives = 130/298 (43%), Gaps = 24/298 (8%)

Query: 13  FMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGI 72
           F AG +AG     V+ P + VK ++Q+Q S  +     G+F  +KQ+  +EG   L +G 
Sbjct: 21  FCAGGIAGAVSRTVVSPFERVKILLQVQSS--THAYNHGLFRAVKQVYLEEGVPGLLRGN 78

Query: 73  SSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLS---ILSGASAGICESFVVVPF 129
               +   P  A +F    EF K  K  F     T  L+   ++SGA  G C      P 
Sbjct: 79  GLNCIRIFPYSAVQFLVY-EFCK--KQWFQQNPDTVVLNWHRLVSGALCGGCSVLATYPL 135

Query: 130 ELVKIRLQDVSSKFTS-----------PIAV----VKNIVEKEGILAMYNGLESTMWRHG 174
           +LV+ RL   ++               P  V     K   ++ GI  +Y G+  T     
Sbjct: 136 DLVRTRLSIQTANLARLHKAKAASAAKPPGVWELLRKTYTQEGGIFGLYRGVWPTSIGVV 195

Query: 175 IWNAGYFGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAV 234
            + A  F +  Q+R  +P +   +  +   L  G + G ++  ++ PFD+++ R Q  A+
Sbjct: 196 PYVALNFAVYEQLREYIPASFDPASASLYKLSIGAISGGVAQTITYPFDLLRRRFQVLAM 255

Query: 235 IPGVPRKYNWSWP-ALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFFR 291
                  +  S P AL TI + EGFK  YKG    + ++ P   +  VV+  V D+ +
Sbjct: 256 GQSELGFHYKSVPDALITIGRTEGFKGYYKGLTANLFKVVPSTAVSWVVYETVRDYMQ 313

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 80/180 (44%), Gaps = 20/180 (11%)

Query: 11  YQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYK---------GVFDCLKQIAA 61
           ++ ++GA+ G   +L  YPLD+V+T + +Q +  +              GV++ L++   
Sbjct: 116 HRLVSGALCGGCSVLATYPLDLVRTRLSIQTANLARLHKAKAASAAKPPGVWELLRKTYT 175

Query: 62  KEGPS-RLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFG-AEKLTQPLSILSGASAG 119
           +EG    LY+G+    +   P  A  FA  ++ ++     F  A      LSI  GA +G
Sbjct: 176 QEGGIFGLYRGVWPTSIGVVPYVALNFAVYEQLREYIPASFDPASASLYKLSI--GAISG 233

Query: 120 ICESFVVVPFELVKIRLQ-------DVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWR 172
                +  PF+L++ R Q       ++   + S    +  I   EG    Y GL + +++
Sbjct: 234 GVAQTITYPFDLLRRRFQVLAMGQSELGFHYKSVPDALITIGRTEGFKGYYKGLTANLFK 293

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 38/80 (47%), Gaps = 2/80 (2%)

Query: 10  VYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGS--GPQYKGVFDCLKQIAAKEGPSR 67
           +Y+   GA++G     + YP D+++   Q+   G S  G  YK V D L  I   EG   
Sbjct: 223 LYKLSIGAISGGVAQTITYPFDLLRRRFQVLAMGQSELGFHYKSVPDALITIGRTEGFKG 282

Query: 68  LYKGISSPILMEAPKRATKF 87
            YKG+++ +    P  A  +
Sbjct: 283 YYKGLTANLFKVVPSTAVSW 302

 Score = 37.0 bits (84), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 49/200 (24%), Positives = 81/200 (40%), Gaps = 27/200 (13%)

Query: 110 LSILSGASAGICESFVVVPFELVKIRLQDVSSKFTSPIAV---VKNIVEKEGILAMYNGL 166
           ++  +G  AG     VV PFE VKI LQ  SS       +   VK +  +EG+  +  G 
Sbjct: 19  IAFCAGGIAGAVSRTVVSPFERVKILLQVQSSTHAYNHGLFRAVKQVYLEEGVPGLLRGN 78

Query: 167 ESTMWRHGIWNAGYFGII-FQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVV 225
                R   ++A  F +  F  +    +         + L++G + G  S L + P D+V
Sbjct: 79  GLNCIRIFPYSAVQFLVYEFCKKQWFQQNPDTVVLNWHRLVSGALCGGCSVLATYPLDLV 138

Query: 226 KSRVQ----NTAVI-----------PGVPRKYNWSWPALATIYKEE-GFKALYKGFVPKV 269
           ++R+     N A +           PGV       W  L   Y +E G   LY+G  P  
Sbjct: 139 RTRLSIQTANLARLHKAKAASAAKPPGV-------WELLRKTYTQEGGIFGLYRGVWPTS 191

Query: 270 LRLGPGGGILLVVFTGVMDF 289
           + + P   +   V+  + ++
Sbjct: 192 IGVVPYVALNFAVYEQLREY 211

>Sklu_1119.1 YJR077C, Contig c1119 366-1289
          Length = 307

 Score = 82.4 bits (202), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 70/270 (25%), Positives = 126/270 (46%), Gaps = 20/270 (7%)

Query: 14  MAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGIS 73
           +AGA+   +    M P+D+VKT +QL+ +       KG+    KQI + EG   L  G  
Sbjct: 18  LAGAIGCGTTHSAMVPIDVVKTRIQLEPT----VYNKGMISSFKQIISSEGAGALLTGFG 73

Query: 74  SPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESF---VVVPFE 130
             +L  + + + KF   + F+K++ D+ G ++     + +   SA I E F    + P E
Sbjct: 74  PTLLGYSLQGSFKFGGYEVFKKLFIDVLGYDQAVNYKNSIYIGSAAIAEFFADIALCPLE 133

Query: 131 LVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIFQVRAL 190
             +IRL    +     +     I+++EG  + YNG    +++   +N   F ++F+  A 
Sbjct: 134 ATRIRLVSQPTFANGLVGGFSRILKEEGAGSFYNGFTPILFKQIPYNIAKF-LVFERAAE 192

Query: 191 L------PKASTKSEQTRN-DLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYN 243
           +      PK S  +  T   +LL+G   G  ++++S P D + S+V  T   PG      
Sbjct: 193 VYFGMAGPKESLSTASTTGINLLSGLTAGLAAAIVSQPADTLLSKVNKTKKAPG-----Q 247

Query: 244 WSWPALATIYKEEGFKALYKGFVPKVLRLG 273
            +   LA + K+ GF   + G   +++ +G
Sbjct: 248 STIGLLAQLAKQLGFVGSFAGLPTRLVMVG 277

>YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF) of membrane transporters [879 bp, 292 aa]
          Length = 292

 Score = 82.0 bits (201), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 70/288 (24%), Positives = 120/288 (41%), Gaps = 29/288 (10%)

Query: 10  VYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSR-L 68
           +   + G++AG    ++ +P D VK  +Q Q S      +   + C+K     EG +R  
Sbjct: 14  ILDIINGSIAGACGKVIEFPFDTVKVRLQTQASN----VFPTTWSCIKFTYQNEGIARGF 69

Query: 69  YKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESFVVVP 128
           ++GI+SP++    + AT F   ++  K  +       L Q L  +SG  AG C S V+ P
Sbjct: 70  FQGIASPLVGACLENATLFVSYNQCSKFLEKHTNVFPLGQIL--ISGGVAGSCASLVLTP 127

Query: 129 FELVKIRLQ-------DVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYF 181
            ELVK +LQ          +K T  +  +K I+ + G+  ++ G   T  R       +F
Sbjct: 128 VELVKCKLQVANLQVASAKTKHTKVLPTIKAIITERGLAGLWQGQSGTFIRESFGGVAWF 187

Query: 182 GIIFQVRALLPKASTKSEQTRND------LLAGTVGGTLSSLLSTPFDVVKSRVQNTAVI 235
                V+  L    +  +  R++      L++G   G   +    P D VKS +Q   + 
Sbjct: 188 ATYEIVKKSLKDRHSLDDPKRDESKIWELLISGGSAGLAFNASIFPADTVKSVMQTEHIS 247

Query: 236 PGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVF 283
                       A+  I+ + G K  Y+G    + R  P    +  +F
Sbjct: 248 LT---------NAVKKIFGKFGLKGFYRGLGITLFRAVPANAAVFYIF 286

>Scas_632.9
          Length = 292

 Score = 82.0 bits (201), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 77/281 (27%), Positives = 124/281 (44%), Gaps = 31/281 (11%)

Query: 16  GAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSR-LYKGISS 74
           G++AG    ++ YP D VK  +Q Q S      +   + C+K     EG  R  ++GI S
Sbjct: 24  GSIAGAFGKIIEYPFDTVKVRLQTQGS----HIFPTTWSCIKYTYHNEGVWRGFFQGIGS 79

Query: 75  PILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESFVVVPFELVKI 134
           P+   A + AT F   ++   + +       L+  L  LSGA AG C SFV+ P EL+K 
Sbjct: 80  PLFGAALENATLFVSYNQCSNVLEKFTNVSPLSNIL--LSGAFAGSCASFVLTPVELIKC 137

Query: 135 RLQDVSS---------KFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIF 185
           +LQ VS+         K T  I  +  ++ ++GIL ++ G  ST  R  +    +F    
Sbjct: 138 KLQ-VSNLQTAVEGQIKHTKIIPTLMYVLREKGILGLWQGQSSTFIRESLGGVAWFATYE 196

Query: 186 QVRALLPKASTKSEQTRNDLL-AGTVGGTLSSLLSTPFDVVKSRVQ--NTAVIPGVPRKY 242
            ++  L      +E    +LL +G   G   +    P D VKS +Q  +  +I  V +  
Sbjct: 197 VMKQGLKDRRKDTENKTWELLVSGASAGLAFNASIFPADTVKSMMQTEHITLINAVKK-- 254

Query: 243 NWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVF 283
                 + T Y   GF   Y+G    ++R  P    +  ++
Sbjct: 255 ------VLTTYGITGF---YRGLGITLIRAVPANATVFYMY 286

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 82/169 (48%), Gaps = 5/169 (2%)

Query: 112 ILSGASAGICESFVVVPFELVKIRLQDVSSK-FTSPIAVVKNIVEKEGIL-AMYNGLEST 169
           I++G+ AG     +  PF+ VK+RLQ   S  F +  + +K     EG+    + G+ S 
Sbjct: 21  IVNGSIAGAFGKIIEYPFDTVKVRLQTQGSHIFPTTWSCIKYTYHNEGVWRGFFQGIGSP 80

Query: 170 MWRHGIWNAGYFGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRV 229
           ++   + NA  F    Q   +L K +  S  + N LL+G   G+ +S + TP +++K ++
Sbjct: 81  LFGAALENATLFVSYNQCSNVLEKFTNVSPLS-NILLSGAFAGSCASFVLTPVELIKCKL 139

Query: 230 QNTAVIPGVPR--KYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGG 276
           Q + +   V    K+    P L  + +E+G   L++G     +R   GG
Sbjct: 140 QVSNLQTAVEGQIKHTKIIPTLMYVLREKGILGLWQGQSSTFIRESLGG 188

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 35/76 (46%), Gaps = 12/76 (15%)

Query: 192 PKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQN--TAVIPGVPRKYNWSWPAL 249
           P   +  +   +D++ G++ G    ++  PFD VK R+Q   + + P        +W  +
Sbjct: 8   PIEKSSVQNALSDIVNGSIAGAFGKIIEYPFDTVKVRLQTQGSHIFPT-------TWSCI 60

Query: 250 ATIYKEEGFKALYKGF 265
              Y  EG   +++GF
Sbjct: 61  KYTYHNEG---VWRGF 73

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 19/84 (22%), Positives = 41/84 (48%), Gaps = 8/84 (9%)

Query: 13  FMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGI 72
            ++GA AG++    ++P D VK++MQ         ++  + + +K++    G +  Y+G+
Sbjct: 217 LVSGASAGLAFNASIFPADTVKSMMQ--------TEHITLINAVKKVLTTYGITGFYRGL 268

Query: 73  SSPILMEAPKRATKFACNDEFQKI 96
              ++   P  AT F   +   K+
Sbjct: 269 GITLIRAVPANATVFYMYETLSKM 292

>KLLA0E12353g complement(1092303..1093220)
           gi|1351895|sp|P49382|ADT_KLULA Kluyveromyces lactis ADP,
           ATP carrier protein (ADP/ATP translocase) (Adenine
           nucleotide translocator) (ANT), start by similarity
          Length = 305

 Score = 81.6 bits (200), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 75/295 (25%), Positives = 129/295 (43%), Gaps = 25/295 (8%)

Query: 2   SDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQ----VSGGSGPQYKGVFDCLK 57
           +D+K   F   F+ G V+         P++ VK ++Q Q      G    +Y G+ +C K
Sbjct: 3   TDKKQSNFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGSLDRRYTGIVECFK 62

Query: 58  QIAAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSG-- 115
           + AA EG +  ++G ++ ++   P +A  FA  D+     K +FG +K        +G  
Sbjct: 63  RTAADEGVASFWRGNTANVIRYFPTQALNFAFKDKI----KAMFGFKKEEGYAKWFAGNL 118

Query: 116 ---ASAGICESFVVVPFELVKIRLQDVSS--------KFTSPIAVVKNIVEKEGILAMYN 164
                AG      V   +  + RL   S         +F   + V K  +  +G+  +Y 
Sbjct: 119 ASGGLAGGLSLLFVYSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGVAGLYR 178

Query: 165 GLESTMWRHGIWNAGYFGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDV 224
           G   ++    ++   YFG+   ++ LL   S ++    + LL   V  T +S  S P D 
Sbjct: 179 GFLPSVVGIVVYRGLYFGLYDSLKPLLLTGSLENSFLASFLLGWAV-TTGASTASYPLDT 237

Query: 225 VKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGIL 279
           V+ R+  T+   G   KY+ ++ A   I   EG K+L+KG    +LR   G G++
Sbjct: 238 VRRRMMMTS---GQAVKYDGAFDAFRKIVAAEGIKSLFKGCGANILRGVAGAGVI 289

>YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member of
           the mitochondrial carrier (MCF) protein family of
           membrane transporters [1107 bp, 368 aa]
          Length = 368

 Score = 82.4 bits (202), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 76/316 (24%), Positives = 138/316 (43%), Gaps = 41/316 (12%)

Query: 2   SDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAA 61
           SD+   P  +  ++G + G      M+ LD VKT  Q      +  +Y+ +    + I  
Sbjct: 46  SDEDLSPIWHCVVSGGIGGKIGDSAMHSLDTVKTRQQ---GAPNVKKYRNMISAYRTIWL 102

Query: 62  KEGPSR-LYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAG- 119
           +EG  R LY G  + +L   P  A  F     ++   + +    ++   ++ LS    G 
Sbjct: 103 EEGVRRGLYGGYMAAMLGSFPSAAIFFGT---YEYTKRTMIEDWQINDTITHLSAGFLGD 159

Query: 120 ICESFVVVPFELVKIRLQDVSSKFTSPI-----------AVVKNIVEKEGILAMYNGLES 168
              SFV VP E++K RLQ +  +F +P              +K ++++EG  +++ G ++
Sbjct: 160 FISSFVYVPSEVLKTRLQ-LQGRFNNPFFQSGYNYSNLRNAIKTVIKEEGFRSLFFGYKA 218

Query: 169 TMWRHGIWNAGYFGIIFQVRALLPKASTKSEQTR-----NDLLAGTVGGTLSSLLSTPFD 223
           T+ R   ++A  F    + R L  K   K  +       N++L G   G L+ +++TP D
Sbjct: 219 TLARDLPFSALQFAFYEKFRQLAFKIEQKDGRDGELSIPNEILTGACAGGLAGIITTPMD 278

Query: 224 VVKSRVQNTAVIPGVPRKYNWSWP----------------ALATIYKEEGFKALYKGFVP 267
           VVK+RVQ         + Y+ + P                +L T+Y+ EG    + G  P
Sbjct: 279 VVKTRVQTQQPPSQSNKSYSVTHPHVTNGRPAALSNSISLSLRTVYQSEGVLGFFSGVGP 338

Query: 268 KVLRLGPGGGILLVVF 283
           + +       I+L+++
Sbjct: 339 RFVWTSVQSSIMLLLY 354

>YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial
           oxaloacetate transporter, member of the mitochondrial
           carrier (MCF) family of membrane transporters [975 bp,
           324 aa]
          Length = 324

 Score = 81.3 bits (199), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 67/277 (24%), Positives = 122/277 (44%), Gaps = 20/277 (7%)

Query: 13  FMAGAVAGVSEILVMYPLDMVKTVMQLQ--VSGGSGPQYKGVFDCLKQIAAKEGPSRLYK 70
           F+AG +A    + V  P++++K  MQLQ  +S  +   YK     +  I   EG   L K
Sbjct: 26  FVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQK 85

Query: 71  GISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPL-----SILSGASAGICESFV 125
           G+++  + +     ++    +  +     LF  ++    +     ++ SGA++GI  + +
Sbjct: 86  GLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFSGAASGIIGAVI 145

Query: 126 VVPFELVKIRLQDVS--------SKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWN 177
             P  LVK RLQ  S        + +T     +  I + EG+  ++ G+++ + R G  +
Sbjct: 146 GSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGS 205

Query: 178 AGYFGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPG 237
           +    I    + +L K     +     L A T+ G   +++  P+DV+ +R+ N      
Sbjct: 206 SVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYNQK---- 261

Query: 238 VPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGP 274
               Y      L    + EG  ALYKGF  +V R+ P
Sbjct: 262 -GDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAP 297

 Score = 69.3 bits (168), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 90/197 (45%), Gaps = 15/197 (7%)

Query: 103 AEKLTQPLSILSGASAGICESFVVVPFELVKIRLQ-------DVSSKFTSPIAVVKNIVE 155
           A+K+++  S ++G  A      V  P EL+KIR+Q         +  + +PI  +  I +
Sbjct: 17  AQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFK 76

Query: 156 KEGILAMYNGLESTMWRHGIWNAGYFGIIFQVRALL------PKASTKSEQTRNDLLAGT 209
            EGI  +  GL +        N    G    +R+ L       +   K +    ++ +G 
Sbjct: 77  NEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFSGA 136

Query: 210 VGGTLSSLLSTPFDVVKSRVQNTA--VIPGVPRKYNWSWPALATIYKEEGFKALYKGFVP 267
             G + +++ +P  +VK+R+Q+ +  +  G    Y   W  L TI+K EG K L++G   
Sbjct: 137 ASGIIGAVIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDA 196

Query: 268 KVLRLGPGGGILLVVFT 284
            +LR G G  + L ++ 
Sbjct: 197 AILRTGAGSSVQLPIYN 213

>Kwal_27.12599
          Length = 304

 Score = 81.3 bits (199), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 79/304 (25%), Positives = 128/304 (42%), Gaps = 31/304 (10%)

Query: 3   DQKPLP---FVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQI 59
           DQ+P      +   +AG   G++++LV  P D  K  +Q   +  +        + +K++
Sbjct: 15  DQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTT------AVEVVKKL 68

Query: 60  AAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFG--AEKLTQPLSILSGAS 117
              EG    YKG  +P++      + +F  N+  ++ ++       + LT P   + G  
Sbjct: 69  VKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFV 128

Query: 118 AGICESFVVVPFELVKIRLQDVSS-----KFTSPIAVVKNIVEKEGILAMYNGLESTMWR 172
            G+  SF+  P E V+IRLQ  ++     +F  P+  + N +   G  A+  GL  T+ R
Sbjct: 129 GGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCI-NKLRANG--ALMRGLSPTILR 185

Query: 173 HGIWNAGYFGIIFQVRALLPKASTKSEQTRNDL------LAGTVGGTLSSLLSTPFDVVK 226
                A YF       AL+     K    R+D+      L G V G    L   P DV+K
Sbjct: 186 EAQGCATYF---LTYEALVANQIGKG-IARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIK 241

Query: 227 SRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGV 286
           S +Q   +   V  K       L  +  + G+K+ +KGF P +LR  P  G     F   
Sbjct: 242 SLMQTDNLKNPVRGKNIIQVARL--VNAKYGWKSFFKGFGPTMLRAAPANGATFATFELA 299

Query: 287 MDFF 290
           M F 
Sbjct: 300 MRFL 303

 Score = 40.4 bits (93), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 42/94 (44%), Gaps = 7/94 (7%)

Query: 198 SEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEG 257
           S +   DLLAGT GG    L+  PFD  K R+Q T+  P        +   +  + K EG
Sbjct: 21  SGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQ-TSTTP------TTAVEVVKKLVKNEG 73

Query: 258 FKALYKGFVPKVLRLGPGGGILLVVFTGVMDFFR 291
            +  YKG +  ++ +G        V   +  FFR
Sbjct: 74  LRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFR 107

>CAGL0F04213g 419473..420393 highly similar to sp|P18239
           Saccharomyces cerevisiae YBL030c AAC2 ADP/ATP carrier
           protein, hypothetical start
          Length = 306

 Score = 80.5 bits (197), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 75/288 (26%), Positives = 124/288 (43%), Gaps = 25/288 (8%)

Query: 9   FVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQ----VSGGSGPQYKGVFDCLKQIAAKEG 64
           F   F+ G V+         P++ VK ++Q Q      G    +YKG+ DC ++ A +EG
Sbjct: 11  FAIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDHRYKGIVDCFQRTARQEG 70

Query: 65  PSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQ-----PLSILSGASAG 119
               ++G ++ ++   P +A  FA  D+     K +FG +K          ++ SG  AG
Sbjct: 71  IISFWRGNTANVIRYFPTQALNFAFKDQI----KAMFGFKKEEGYAKWFAGNLASGGIAG 126

Query: 120 ICESFVVVPFELVKIRL-QDVSS-------KFTSPIAVVKNIVEKEGILAMYNGLESTMW 171
                 V   +  + RL  D  S       +F   + V K  +  +G+  +Y G   ++ 
Sbjct: 127 GLSLMFVYSLDYARTRLAADAKSSKKGGERQFNGLVDVYKKTIASDGVAGLYRGFLPSVI 186

Query: 172 RHGIWNAGYFGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQN 231
              ++   YFG+    + LL   S +     + LL G V  T +S  S P D V+ R+  
Sbjct: 187 GIVVYRGLYFGLYDSCKPLLLTGSLEGSFIASFLL-GWVVTTGASTASYPLDTVRRRMMM 245

Query: 232 TAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGIL 279
           T+   G   KY  +   L  I   EG  +L+KG    +LR   G G++
Sbjct: 246 TS---GQAVKYKGAMDCLQKIVAAEGVSSLFKGCGANILRGVAGAGVI 290

>Sklu_1275.1 , Contig c1275 314-1249
          Length = 311

 Score = 80.5 bits (197), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 75/301 (24%), Positives = 133/301 (44%), Gaps = 36/301 (11%)

Query: 10  VYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLY 69
           +   ++G   G++++LV  P D+ K  +++Q S GS        + +K +   EG    Y
Sbjct: 24  IKDIISGTSGGIAQVLVGQPFDITK--VRMQTSSGS----PTAIEVIKNLVKNEGLLAFY 77

Query: 70  KGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSIL----SGASAGICESFV 125
           KG   P++      + +F  N+  ++ +  + G +   Q LS+L     G  +G   +F+
Sbjct: 78  KGTLVPLIGVGACVSCQFGVNEAMKRYFLRVNGYKD--QHLSLLQYYTCGFVSGSANAFL 135

Query: 126 VVPFELVKIRLQ-----DVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWR--HGIWNA 178
             P E V+IRLQ        +++   +  +K +++++   A+  G  +T+ R  HG    
Sbjct: 136 ATPIEHVRIRLQLQTKALAKAEYRGSLDCMKKLLKQK---ALMRGFTATLMRTSHG---- 188

Query: 179 GYFGIIFQVRALLPKASTKSEQTRNDL------LAGTVGGTLSSLLSTPFDVVKSRVQNT 232
             FG+ F     L     K+   R D+      + G   G     ++ PFDVVKS +Q  
Sbjct: 189 --FGVYFLTYEALIMNQNKNGVLRKDIPPWKVCVFGAFSGAFFWAMTYPFDVVKSIMQAD 246

Query: 233 AVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFFRT 292
            ++  V  K    +    +I+   G+ A  KGFVP +LR  P  G     F   M    +
Sbjct: 247 RLVSPVHGKN--VFQVAKSIHATRGWGAFVKGFVPTMLRSLPVNGATFATFEVTMRLLES 304

Query: 293 V 293
           +
Sbjct: 305 L 305

 Score = 70.5 bits (171), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 97/200 (48%), Gaps = 22/200 (11%)

Query: 92  EFQKIYKDLFGAEKLTQPLSILSGASAGICESFVVVPFELVKIRLQDVSSKFTSPIAVVK 151
           EF+K  KD            I+SG S GI +  V  PF++ K+R+Q  SS   + I V+K
Sbjct: 19  EFRKAIKD------------IISGTSGGIAQVLVGQPFDITKVRMQ-TSSGSPTAIEVIK 65

Query: 152 NIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIFQVRALLPKASTKSEQTRNDL---LAG 208
           N+V+ EG+LA Y G    +   G   +  FG+   ++    + +   +Q  + L     G
Sbjct: 66  NLVKNEGLLAFYKGTLVPLIGVGACVSCQFGVNEAMKRYFLRVNGYKDQHLSLLQYYTCG 125

Query: 209 TVGGTLSSLLSTPFDVVKSRVQ-NTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVP 267
            V G+ ++ L+TP + V+ R+Q  T  +     +Y  S   +  + K+   KAL +GF  
Sbjct: 126 FVSGSANAFLATPIEHVRIRLQLQTKALAKA--EYRGSLDCMKKLLKQ---KALMRGFTA 180

Query: 268 KVLRLGPGGGILLVVFTGVM 287
            ++R   G G+  + +  ++
Sbjct: 181 TLMRTSHGFGVYFLTYEALI 200

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/187 (22%), Positives = 77/187 (41%), Gaps = 13/187 (6%)

Query: 3   DQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAK 62
           DQ  L  +  +  G V+G +   +  P++ V+  +QLQ    +  +Y+G  DC+K++  +
Sbjct: 113 DQH-LSLLQYYTCGFVSGSANAFLATPIEHVRIRLQLQTKALAKAEYRGSLDCMKKLLKQ 171

Query: 63  EGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSI-LSGASAGIC 121
           +    L +G ++ ++  +      F   +             K   P  + + GA +G  
Sbjct: 172 KA---LMRGFTATLMRTSHGFGVYFLTYEALIMNQNKNGVLRKDIPPWKVCVFGAFSGAF 228

Query: 122 ESFVVVPFELVKIRLQDVSSKFTSPIA------VVKNIVEKEGILAMYNGLESTMWRHGI 175
              +  PF++VK  +Q  + +  SP+       V K+I    G  A   G   TM R   
Sbjct: 229 FWAMTYPFDVVKSIMQ--ADRLVSPVHGKNVFQVAKSIHATRGWGAFVKGFVPTMLRSLP 286

Query: 176 WNAGYFG 182
            N   F 
Sbjct: 287 VNGATFA 293

>CAGL0H03839g 359987..360835 highly similar to sp|P38921
           Saccharomyces cerevisiae YNL003c PET8, start by
           similarity
          Length = 282

 Score = 79.7 bits (195), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 76/300 (25%), Positives = 135/300 (45%), Gaps = 47/300 (15%)

Query: 9   FVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGG--SGPQYKGVFDCLKQIAAKEGPS 66
           F+   ++GA AG S  LV +P+D +KT  +LQ  GG      Y+GV              
Sbjct: 5   FLISLLSGAAAGTSTDLVFFPIDTLKT--RLQAKGGFFRNGGYRGV-------------- 48

Query: 67  RLYKGISSPILMEAPKRATKF----ACNDEFQKIYKDLFGAEKLTQPLSILSGASAG-IC 121
             Y+G+ S ++  AP  +  F     C  E +  ++ L  +  +   ++ +  +S G I 
Sbjct: 49  --YRGLGSAVVASAPGASLFFITYDTCKAETRGFFRGLLPSSNVADVVTHMFSSSMGEIA 106

Query: 122 ESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKE---GIL-AMYNGLESTMWRHGIWN 177
              V VP E+VK R Q  +S   S    ++ I++ E   G+   +Y G  +T+ R     
Sbjct: 107 ACMVRVPAEVVKQRSQTHASH--SSWETLREILKNENGEGVRRNLYRGWSTTIMRE---- 160

Query: 178 AGYFGIIFQVRALLPKASTKSEQTRN-----DLLAGTVGGTLSSLLSTPFDVVKSRVQNT 232
             +  I F +   + K   + +++         + G++ G +++  +TP D +K+R+   
Sbjct: 161 IPFTCIQFPLYEYMKKVWAELDESDRVEPWKGAVCGSIAGGIAAATTTPLDFLKTRLM-- 218

Query: 233 AVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFFRT 292
                + +K       ++TIYKEEGFK  + G  P+ + +  GG I L ++  V     T
Sbjct: 219 -----LCKKSIPLGTLVSTIYKEEGFKVFFSGVGPRTMWISAGGAIFLGIYETVHSLLST 273

>CAGL0K11616g complement(1121834..1122796) highly similar to
           sp|P32332 Saccharomyces cerevisiae YKL120w, hypothetical
           start
          Length = 320

 Score = 80.1 bits (196), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 67/277 (24%), Positives = 120/277 (43%), Gaps = 20/277 (7%)

Query: 13  FMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQ--YKGVFDCLKQIAAKEGPSRLYK 70
           F AG +A    + V  P+++VK  MQLQ    +  Q  Y   F  +  +   EG   L K
Sbjct: 22  FTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQK 81

Query: 71  GISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQP-----LSILSGASAGICESFV 125
           G+ +  + +     ++    +  + +    F  ++ +       +++ +GA++GI  + +
Sbjct: 82  GLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVM 141

Query: 126 VVPFELVKIRLQDVS--------SKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWN 177
             P  LVK RLQ  S        + +T     +K I   EG+  ++ G+++ + R G  +
Sbjct: 142 GSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGS 201

Query: 178 AGYFGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPG 237
           +    I    +  L +     +     L A T+ G   +++  P+DV+ +R+ N      
Sbjct: 202 SVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILTRIYNQK---- 257

Query: 238 VPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGP 274
               Y      L    K EG  ALYKGF  +V R+GP
Sbjct: 258 -GDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGP 293

 Score = 75.1 bits (183), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 90/203 (44%), Gaps = 15/203 (7%)

Query: 103 AEKLTQPLSILSGASAGICESFVVVPFELVKIRLQ-------DVSSKFTSPIAVVKNIVE 155
           A+K+++  S  +G  A      V  P E+VKIR+Q            +T+P   +  +  
Sbjct: 13  AQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFR 72

Query: 156 KEGILAMYNGLESTMWRHGIWNAGYFGIIFQVRALLPKA------STKSEQTRNDLLAGT 209
            EGI  +  GL +        N    G    +RA++ K       S K +    ++ AG 
Sbjct: 73  NEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGA 132

Query: 210 VGGTLSSLLSTPFDVVKSRVQN--TAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVP 267
             G + +++ +P  +VK+R+Q+   A+  G    Y   W  L TIY  EG K L++G   
Sbjct: 133 ASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDA 192

Query: 268 KVLRLGPGGGILLVVFTGVMDFF 290
            +LR G G  + L ++    +F 
Sbjct: 193 AILRTGAGSSVQLPIYNTAKNFL 215

>ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH]
           complement(693078..694217) [1140 bp, 379 aa]
          Length = 379

 Score = 80.1 bits (196), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 72/296 (24%), Positives = 142/296 (47%), Gaps = 34/296 (11%)

Query: 14  MAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGIS 73
           ++GA+AG    +++ PLD+ KT +Q Q +G     Y+G+   L  I   EG + LYKG++
Sbjct: 89  VSGALAGFVSGIMVCPLDVAKTRLQAQGAGSGERYYRGIVGTLSAILRDEGVAGLYKGLA 148

Query: 74  SPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESFVVVPFELVK 133
             +L   P     F+  ++ ++ Y        ++   S L   +AG   + +  P  +VK
Sbjct: 149 PIVLGYFPTWMLYFSVYEKCKQRYPSYLPGGFVSHAASAL---TAGAISTALTNPIWVVK 205

Query: 134 IRL---QDV---SSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWN-AGYFGIIFQ 186
            RL    DV   S+ + S +   + +   EG+   Y+GL  +++  G+++ A +F +  +
Sbjct: 206 TRLMIQSDVSRDSTNYRSTLDAFRKMYRSEGLKVFYSGLVPSLF--GLFHVAIHFPVYEK 263

Query: 187 VRALLPKASTKSEQTRND---------LLAGTVGGTLSSLLSTPFDVVKSRVQ--NTAVI 235
           ++  L + +  ++  R D         ++A  +   ++S+++ P +++++R+Q  ++ V 
Sbjct: 264 LKIWLHRNTPAADGQRLDHNKLQLDRLIVASCLSKVVASVITYPHEILRTRMQVRHSGVP 323

Query: 236 PGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFFR 291
           P +          L  I   EG+   Y GF   ++R  P   I LV F    ++FR
Sbjct: 324 PSL-------LNLLGRIRASEGYVGFYSGFATNLVRTVPASVITLVSF----EYFR 368

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 71/168 (42%), Gaps = 7/168 (4%)

Query: 110 LSILSGASAGICESFVVVPFELVKIRLQDVSS-----KFTSPIAVVKNIVEKEGILAMYN 164
           ++ +SGA AG     +V P ++ K RLQ   +      +   +  +  I+  EG+  +Y 
Sbjct: 86  VTAVSGALAGFVSGIMVCPLDVAKTRLQAQGAGSGERYYRGIVGTLSAILRDEGVAGLYK 145

Query: 165 GLESTMWRHGIWNAGYFGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDV 224
           GL   +  +      YF +  + +   P  S       +   +    G +S+ L+ P  V
Sbjct: 146 GLAPIVLGYFPTWMLYFSVYEKCKQRYP--SYLPGGFVSHAASALTAGAISTALTNPIWV 203

Query: 225 VKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRL 272
           VK+R+   + +      Y  +  A   +Y+ EG K  Y G VP +  L
Sbjct: 204 VKTRLMIQSDVSRDSTNYRSTLDAFRKMYRSEGLKVFYSGLVPSLFGL 251

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 1/72 (1%)

Query: 199 EQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGF 258
           + T+   ++G + G +S ++  P DV K+R+Q      G  R Y      L+ I ++EG 
Sbjct: 82  DDTQVTAVSGALAGFVSGIMVCPLDVAKTRLQAQGAGSG-ERYYRGIVGTLSAILRDEGV 140

Query: 259 KALYKGFVPKVL 270
             LYKG  P VL
Sbjct: 141 AGLYKGLAPIVL 152

 Score = 32.3 bits (72), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 21/93 (22%), Positives = 41/93 (44%), Gaps = 4/93 (4%)

Query: 3   DQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAK 62
           D   L      +A  ++ V   ++ YP ++++T MQ++ SG        + + L +I A 
Sbjct: 281 DHNKLQLDRLIVASCLSKVVASVITYPHEILRTRMQVRHSGVP----PSLLNLLGRIRAS 336

Query: 63  EGPSRLYKGISSPILMEAPKRATKFACNDEFQK 95
           EG    Y G ++ ++   P         + F+K
Sbjct: 337 EGYVGFYSGFATNLVRTVPASVITLVSFEYFRK 369

>KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, start by similarity
          Length = 317

 Score = 79.7 bits (195), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 76/291 (26%), Positives = 129/291 (44%), Gaps = 20/291 (6%)

Query: 14  MAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGIS 73
           +AG+V+GV   +   P+D VK   QLQ       +YKG+   ++ I  +EG   L+KG  
Sbjct: 23  IAGSVSGVFARMATAPMDTVKIRYQLQPV--QEDKYKGIASTVRTIMKEEGLRALWKGNI 80

Query: 74  SPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILS-GASAGICESFVVVPFELV 132
               M     A +F     F  ++   F   + +Q    L+ GA AG+  S V  P +L+
Sbjct: 81  PATAMYVVYGAVQFGSYSWFNNVWSAKF--PRFSQQGQTLTVGALAGMTSSVVSYPLDLL 138

Query: 133 KIRL-QDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIFQVRALL 191
           + RL  + +S  TS     + +   EG+   + G+ + M    +  A  F + ++   ++
Sbjct: 139 RTRLIANRTSHRTSVAEECRQMWLNEGVRGFFTGISTAMTTVTLSTAIMF-LTYETVNIV 197

Query: 192 PKASTKSEQTRN-DLLAGTVGGTLSSLLSTPFDVVKSRVQ--------NTAVIPGVPRKY 242
            +   K   +R     +G + G +S  +  P D ++ R+Q        +    P V  +Y
Sbjct: 198 CENHEKEFWSRPVSASSGIIAGFVSKTMVFPIDTLRRRMQVMNSKRTVHFTKFPAVYHEY 257

Query: 243 NWSWPALATIYK---EEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFF 290
            +   + A IYK   +EG  ALY+G    + +  P   I L V+   MD F
Sbjct: 258 RYK-SSTAIIYKILRQEGVSALYRGLTMGLCKSVPTTAISLFVYERTMDLF 307

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 36/65 (55%), Gaps = 3/65 (4%)

Query: 203 NDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALY 262
           N ++AG+V G  + + + P D VK R Q   + P    KY      + TI KEEG +AL+
Sbjct: 20  NSVIAGSVSGVFARMATAPMDTVKIRYQ---LQPVQEDKYKGIASTVRTIMKEEGLRALW 76

Query: 263 KGFVP 267
           KG +P
Sbjct: 77  KGNIP 81

>Scas_709.9
          Length = 365

 Score = 79.7 bits (195), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 72/296 (24%), Positives = 136/296 (45%), Gaps = 28/296 (9%)

Query: 14  MAGAVAGVSEILVMYPLDMVKTVMQLQ-VSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGI 72
           ++GA+AG    +++ PLD+ KT +Q Q +     P Y+GV   +  I   EG   LYKG+
Sbjct: 69  LSGALAGFLSGIIVCPLDVTKTRLQAQGIQSIENPYYRGVLGTMSTIVVDEGVRGLYKGL 128

Query: 73  SSPILMEAPKRATKFACNDEFQKIY-KDLFGAEKLTQPLSILSGASAGICESFVVVPFEL 131
              IL   P     F+  +  + +Y + L  ++ ++   S ++   AG   + +  P  +
Sbjct: 129 IPIILGYFPTWMIYFSVYEFAKDLYPRVLPNSDFISHSCSAIT---AGAASTVLTNPIWV 185

Query: 132 VKIRLQ------DVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWN-AGYFGII 184
           VK RL       +  + +   I   K I+ +EG+  +Y GL  +M+  G+ + A +F + 
Sbjct: 186 VKTRLMLQTPLGESRTHYRGTIDAFKKIITQEGVRTLYTGLVPSMF--GLLHVAIHFPVY 243

Query: 185 FQVRALLP--------KASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIP 236
            +++  L          +   S      ++A +    L+S+L+ P +++++R+Q  +   
Sbjct: 244 EKLKNRLHCDTITGGHNSQEHSLHLTRLIIASSASKMLASILTYPHEILRTRMQLKSDKL 303

Query: 237 GVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFFRT 292
            + +  +     +   Y+ EG    Y GF   +LR  P   I LV F    ++FR 
Sbjct: 304 LISK--HKLLDLIKRTYRYEGLLGFYSGFATNLLRTVPASAITLVSF----EYFRN 353

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 76/175 (43%), Gaps = 8/175 (4%)

Query: 105 KLTQP-LSILSGASAGICESFVVVPFELVKIRLQDVSSK------FTSPIAVVKNIVEKE 157
            L+ P ++ LSGA AG     +V P ++ K RLQ    +      +   +  +  IV  E
Sbjct: 60  HLSDPKITALSGALAGFLSGIIVCPLDVTKTRLQAQGIQSIENPYYRGVLGTMSTIVVDE 119

Query: 158 GILAMYNGLESTMWRHGIWNAGYFGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSL 217
           G+  +Y GL   +  +      YF +    + L P+    S+   +   A T G   S++
Sbjct: 120 GVRGLYKGLIPIILGYFPTWMIYFSVYEFAKDLYPRVLPNSDFISHSCSAITAGAA-STV 178

Query: 218 LSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRL 272
           L+ P  VVK+R+     +      Y  +  A   I  +EG + LY G VP +  L
Sbjct: 179 LTNPIWVVKTRLMLQTPLGESRTHYRGTIDAFKKIITQEGVRTLYTGLVPSMFGL 233

>Sklu_2431.5 YBR192W, Contig c2431 8526-9638
          Length = 370

 Score = 79.7 bits (195), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 80/320 (25%), Positives = 145/320 (45%), Gaps = 59/320 (18%)

Query: 8   PFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGS--------GP-----------Q 48
           P+V+ F+AG + G++  +V  P D+VKT +Q  V   +        GP            
Sbjct: 52  PWVH-FVAGGIGGMAGAVVTCPFDVVKTRLQSDVFQAAYKSHAKSIGPNQANVIAQGVRH 110

Query: 49  YKGVFDCLKQIAAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQ 108
           +K  F  +  +   EG   L+KG+   ++   P R+  F      ++IY       +   
Sbjct: 111 FKETFGIISNVYRNEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKEIYSKTLNNGQEAV 170

Query: 109 PLSILSGASAGICESFVVVPFELVKIRLQ----DVSSKFTSPIAVVKNIVEKEGILAMYN 164
            + +++ A+AG   S    P  LVK RLQ      + K+ +    +KN+V+KEGIL +Y 
Sbjct: 171 WIHLMAAATAGWATSTATNPIWLVKTRLQLDKAGTTKKYKNSWDCLKNVVQKEGILGLYK 230

Query: 165 GLESTMWRHGIWNAGYFG---------IIFQVRALLPKAS-------TKSEQTRNDLL-- 206
           GL          +A Y G         +  Q++ ++ + S       ++ E++ +D +  
Sbjct: 231 GL----------SASYLGSVEGILQWVLYEQMKHIIKQRSMEKFGNISEVEKSTSDKIKE 280

Query: 207 ----AGTVGGT--LSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKA 260
               +G+ G    ++S+++ P +VV++R++   +  G   KY     ++  I KEEG  +
Sbjct: 281 WCQRSGSAGLAKFVASIITYPHEVVRTRLRQAPLENG-KLKYTGLVQSIRVIIKEEGLAS 339

Query: 261 LYKGFVPKVLRLGPGGGILL 280
           +Y G  P +LR  P   I+ 
Sbjct: 340 MYGGLTPHLLRTVPNSIIMF 359

>YLR348C (DIC1) [3731] chr12 complement(826976..827872)
           Mitochondrial dicarboxylate transport protein, member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [897 bp, 298 aa]
          Length = 298

 Score = 78.6 bits (192), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 73/279 (26%), Positives = 130/279 (46%), Gaps = 34/279 (12%)

Query: 11  YQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYK 70
           Y +  G  AG+   +V +PLD+ K  ++LQ +    P    +F  L+ I A EG   LY 
Sbjct: 15  YPWWYGGAAGIFATMVTHPLDLAK--VRLQAAPMPKPT---LFRMLESILANEGVVGLYS 69

Query: 71  GISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQ-----PLSILSGASAGICESFV 125
           G+S+ +L +      +F   D  +   +++   E+LT      P S+ SGA  G+  +F 
Sbjct: 70  GLSAAVLRQCTYTTVRFGAYDLLK---ENVIPREQLTNMAYLLPCSMFSGAIGGLAGNFA 126

Query: 126 VVPFELVKIRLQDVSS-------KFTSPIAVVKNIVEKEGIL-AMYNGLESTMWRHGIWN 177
               ++V IR+Q+ S+        + + I  V  I   EG L  ++ G +  M R GI  
Sbjct: 127 ----DVVNIRMQNDSALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMVR-GILM 181

Query: 178 AGYFGIIFQV--RALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVI 235
                + + V    L+ K    + +    L A  + G +++ + +P DV+K+R+ N +  
Sbjct: 182 TASQVVTYDVFKNYLVTKLDFDASKNYTHLTASLLAGLVATTVCSPADVMKTRIMNGS-- 239

Query: 236 PGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGP 274
                 +  +   LA   ++EG   +++G++P   RLGP
Sbjct: 240 ----GDHQPALKILADAVRKEGPSFMFRGWLPSFTRLGP 274

 Score = 30.8 bits (68), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 41/179 (22%), Positives = 75/179 (41%), Gaps = 11/179 (6%)

Query: 15  AGAVAGVSEILVMYPLDMVKTVMQLQ--VSGGSGPQYKGVFDCLKQIAAKEGPSR-LYKG 71
           +GA+ G++        D+V   MQ    +       YK   D + +I   EG  + L+ G
Sbjct: 115 SGAIGGLAGNFA----DVVNIRMQNDSALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTG 170

Query: 72  ISSPILMEAPKRATKFACNDEFQK--IYKDLFGAEKLTQPLSILSGASAGICESFVVVPF 129
               ++      A++    D F+   + K  F A K    L+  +   AG+  + V  P 
Sbjct: 171 WKPNMVRGILMTASQVVTYDVFKNYLVTKLDFDASKNYTHLT--ASLLAGLVATTVCSPA 228

Query: 130 ELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIFQVR 188
           +++K R+ + S      + ++ + V KEG   M+ G   +  R G +    F  I Q++
Sbjct: 229 DVMKTRIMNGSGDHQPALKILADAVRKEGPSFMFRGWLPSFTRLGPFTMLIFFAIEQLK 287

>Kwal_55.20868
          Length = 380

 Score = 79.0 bits (193), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 75/298 (25%), Positives = 130/298 (43%), Gaps = 29/298 (9%)

Query: 14  MAGAVAGVSEILVMYPLDMVKTVMQLQ-VSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGI 72
           ++GA+AG    + + PLD+ KT +Q Q +       YKG+   L  I   EG   LYKG+
Sbjct: 80  LSGAMAGFLAGVTVCPLDVAKTRLQAQGLHSNPSNYYKGILGTLTTIIRDEGARGLYKGL 139

Query: 73  SSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESFVVVPFELV 132
              I+   P     F+  +  +K+Y  +F +       +  S  +AG   + +  P  +V
Sbjct: 140 VPIIMGYFPTWMIYFSVYERSKKLYPRIFPSFDFISHSA--SALTAGTVSTILTNPVWVV 197

Query: 133 KIRL------QDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWN-AGYFGIIF 185
           K RL         S+ +TS       +   EG+   Y GL  ++   G+++ A +F I  
Sbjct: 198 KTRLMLQTHVNKNSTHYTSTFDAFHKMYTTEGLRTFYAGLLPSLL--GLFHVAIHFPIYE 255

Query: 186 QVRALLPKASTKSEQTRNDL------LAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVP 239
           +++  L    + S    ++L      +A +    ++S L+ P +++++R+Q  A  P  P
Sbjct: 256 KLKVWLHCTPSMSRTEDHNLNLARLIIASSASKMVASTLTYPHEILRTRMQLKAY-PTDP 314

Query: 240 ------RKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFFR 291
                    +     +   YK EG +  Y GF   + R  P   I LV F    ++FR
Sbjct: 315 LAALQKTSRHGLIRLIKHTYKSEGLRGFYSGFTANLARTLPASAITLVSF----EYFR 368

 Score = 58.9 bits (141), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 76/169 (44%), Gaps = 7/169 (4%)

Query: 110 LSILSGASAGICESFVVVPFELVKIRLQ------DVSSKFTSPIAVVKNIVEKEGILAMY 163
           ++ LSGA AG      V P ++ K RLQ      + S+ +   +  +  I+  EG   +Y
Sbjct: 77  ITALSGAMAGFLAGVTVCPLDVAKTRLQAQGLHSNPSNYYKGILGTLTTIIRDEGARGLY 136

Query: 164 NGLESTMWRHGIWNAGYFGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFD 223
            GL   +  +      YF +  + + L P+     +   +   A T  GT+S++L+ P  
Sbjct: 137 KGLVPIIMGYFPTWMIYFSVYERSKKLYPRIFPSFDFISHSASALT-AGTVSTILTNPVW 195

Query: 224 VVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRL 272
           VVK+R+     +      Y  ++ A   +Y  EG +  Y G +P +L L
Sbjct: 196 VVKTRLMLQTHVNKNSTHYTSTFDAFHKMYTTEGLRTFYAGLLPSLLGL 244

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 43/93 (46%)

Query: 191 LPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALA 250
           +P  +   + T    L+G + G L+ +   P DV K+R+Q   +       Y      L 
Sbjct: 65  IPFVNRSFDDTEITALSGAMAGFLAGVTVCPLDVAKTRLQAQGLHSNPSNYYKGILGTLT 124

Query: 251 TIYKEEGFKALYKGFVPKVLRLGPGGGILLVVF 283
           TI ++EG + LYKG VP ++   P   I   V+
Sbjct: 125 TIIRDEGARGLYKGLVPIIMGYFPTWMIYFSVY 157

>Kwal_56.23011
          Length = 303

 Score = 78.2 bits (191), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 79/292 (27%), Positives = 123/292 (42%), Gaps = 38/292 (13%)

Query: 14  MAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGIS 73
             G V GV+++LV  P D+ K  +Q      + P        +K +   EG    YKG  
Sbjct: 28  FCGTVGGVAQVLVGQPFDITKVRLQ------TSPVPTTAAQVIKSLVKNEGLLAFYKGTL 81

Query: 74  SPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSI----LSGASAGICESFVVVPF 129
           +P+       + +F  N+  +K ++   G     QPL++      G  +G   +F+  P 
Sbjct: 82  APLAGVGACVSCQFGVNEALKKWFRKKDG--NFDQPLALRQYYACGFVSGTANAFLATPI 139

Query: 130 ELVKIRLQ-----DVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWR--HGIWNAGYFG 182
           E V+IRLQ       ++++   +   + ++ K+G  A+  G  +T  R  HG      FG
Sbjct: 140 EHVRIRLQLQTASSSAAEYHGSLDCARKLL-KQG--ALMRGFTATTLRTSHG------FG 190

Query: 183 IIFQVRALLPKASTKSEQTRNDLLA------GTVGGTLSSLLSTPFDVVKSRVQNTAVIP 236
           I F     L          R ++ A      G   G     ++ PFDVVKS +Q   +  
Sbjct: 191 IYFLTYETLIANQAHHGVLRENIPAWKVCVYGAFSGAFFWAMTYPFDVVKSVMQADKLKN 250

Query: 237 GVPRKYNWSWPALA-TIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVM 287
            V   Y  +  A+A  IY+E G +A  KGF P +LR  P  G     F   M
Sbjct: 251 PV---YGRNPLAVAKAIYRERGPRAFTKGFTPTMLRSLPVNGATFAAFEITM 299

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 54/194 (27%), Positives = 88/194 (45%), Gaps = 11/194 (5%)

Query: 95  KIYKDLFGAEKLTQPL-SILSGASAGICESFVVVPFELVKIRLQDVSSKFTSPIAVVKNI 153
           ++  DL       Q L  +  G   G+ +  V  PF++ K+RLQ  S   T+   V+K++
Sbjct: 9   QVVDDLVDTHDFKQALKDVFCGTVGGVAQVLVGQPFDITKVRLQ-TSPVPTTAAQVIKSL 67

Query: 154 VEKEGILAMYNGLESTMWRHGIWNAGYFGIIFQVRALLPKASTKSEQ---TRNDLLAGTV 210
           V+ EG+LA Y G  + +   G   +  FG+   ++    K     +Q    R     G V
Sbjct: 68  VKNEGLLAFYKGTLAPLAGVGACVSCQFGVNEALKKWFRKKDGNFDQPLALRQYYACGFV 127

Query: 211 GGTLSSLLSTPFDVVKSRVQ-NTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKV 269
            GT ++ L+TP + V+ R+Q  TA       +Y+ S      + K+    AL +GF    
Sbjct: 128 SGTANAFLATPIEHVRIRLQLQTASSSAA--EYHGSLDCARKLLKQ---GALMRGFTATT 182

Query: 270 LRLGPGGGILLVVF 283
           LR   G GI  + +
Sbjct: 183 LRTSHGFGIYFLTY 196

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 76/179 (42%), Gaps = 18/179 (10%)

Query: 4   QKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKE 63
            +PL     +  G V+G +   +  P++ V+  +QLQ +  S  +Y G  DC +++  K+
Sbjct: 113 DQPLALRQYYACGFVSGTANAFLATPIEHVRIRLQLQTASSSAAEYHGSLDCARKL-LKQ 171

Query: 64  GPSRLYKGISSPILMEAPKRATKF------ACNDEFQKIYKDLFGAEKLTQPLSILSGAS 117
           G   L +G ++  L  +      F        N     + ++   A K+      + GA 
Sbjct: 172 GA--LMRGFTATTLRTSHGFGIYFLTYETLIANQAHHGVLRENIPAWKV-----CVYGAF 224

Query: 118 AGICESFVVVPFELVKIRLQDVSSKF----TSPIAVVKNIVEKEGILAMYNGLESTMWR 172
           +G     +  PF++VK  +Q    K      +P+AV K I  + G  A   G   TM R
Sbjct: 225 SGAFFWAMTYPFDVVKSVMQADKLKNPVYGRNPLAVAKAIYRERGPRAFTKGFTPTMLR 283

>CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11, start by
           similarity
          Length = 301

 Score = 77.8 bits (190), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 70/293 (23%), Positives = 121/293 (41%), Gaps = 38/293 (12%)

Query: 14  MAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSR-LYKGI 72
           + G++AG    ++ YP D VK  +Q Q        +   + C+      EG  +  ++GI
Sbjct: 18  LYGSIAGALGKVIEYPFDTVKVRLQTQ----GRHVFPDTWSCITYTYKNEGIIKGFFQGI 73

Query: 73  SSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESFVVVPFELV 132
           +SP+   A + A  F   ++  K  +       LT  L  +SGA AG C SFV+ P EL+
Sbjct: 74  ASPLAGAAIENAALFLSYNQCSKFLQHYTNVSDLTNIL--ISGAFAGSCASFVLTPVELI 131

Query: 133 KIRLQ---------------DVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWN 177
           K +LQ                V+ + T  I  ++ +++  G + ++ G   T  R     
Sbjct: 132 KCKLQVSNLQSLPLGVAGGNTVTERHTRIIPTIQAVIKNRGFIGLWQGQSGTFIRESFGG 191

Query: 178 AGYFGI------IFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLST-PFDVVKSRVQ 230
             +F          + R  +   S  ++    +LLA      L+   S  P D VKS +Q
Sbjct: 192 VAWFATYELMKKYLKSRHNIEDPSLPNDNKTWELLASGASAGLAFNASIFPADTVKSMMQ 251

Query: 231 NTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVF 283
              +  G+         A+  I+ E+G +  Y+G    ++R  P    +  V+
Sbjct: 252 TEHL--GLK-------TAIKKIFVEKGLRGFYRGLGITLIRAIPANATVFYVY 295

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 53/191 (27%), Positives = 86/191 (45%), Gaps = 18/191 (9%)

Query: 102 GAEKLTQPLS-----ILSGASAGICESFVVVPFELVKIRLQDVSSK-FTSPIAVVKNIVE 155
           GAE+ TQ L+     IL G+ AG     +  PF+ VK+RLQ      F    + +    +
Sbjct: 3   GAEE-TQWLAAAFRDILYGSIAGALGKVIEYPFDTVKVRLQTQGRHVFPDTWSCITYTYK 61

Query: 156 KEGIL-AMYNGLESTMWRHGIWNAGYFGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTL 214
            EGI+   + G+ S +    I NA  F    Q    L   +  S+ T N L++G   G+ 
Sbjct: 62  NEGIIKGFFQGIASPLAGAAIENAALFLSYNQCSKFLQHYTNVSDLT-NILISGAFAGSC 120

Query: 215 SSLLSTPFDVVKSRVQ--NTAVIP-------GVPRKYNWSWPALATIYKEEGFKALYKGF 265
           +S + TP +++K ++Q  N   +P        V  ++    P +  + K  GF  L++G 
Sbjct: 121 ASFVLTPVELIKCKLQVSNLQSLPLGVAGGNTVTERHTRIIPTIQAVIKNRGFIGLWQGQ 180

Query: 266 VPKVLRLGPGG 276
               +R   GG
Sbjct: 181 SGTFIRESFGG 191

 Score = 35.4 bits (80), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 41/82 (50%), Gaps = 8/82 (9%)

Query: 15  AGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGISS 74
           +GA AG++    ++P D VK++MQ         ++ G+   +K+I  ++G    Y+G+  
Sbjct: 228 SGASAGLAFNASIFPADTVKSMMQ--------TEHLGLKTAIKKIFVEKGLRGFYRGLGI 279

Query: 75  PILMEAPKRATKFACNDEFQKI 96
            ++   P  AT F   +   K+
Sbjct: 280 TLIRAIPANATVFYVYETLSKL 301

>Kwal_33.12988
          Length = 303

 Score = 77.4 bits (189), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 77/288 (26%), Positives = 124/288 (43%), Gaps = 32/288 (11%)

Query: 15  AGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGISS 74
           AG   G++++LV  P D+ K  ++LQ S       + V D +K     EG    YKG + 
Sbjct: 29  AGTTGGIAQVLVGQPFDITK--VRLQTSSTPTTALRVVQDLVKN----EGLRGFYKGTTL 82

Query: 75  PILMEAPKRATKFACNDEFQKIY--KDLFGAEKLTQPLSILSGASAGICESFVVVPFELV 132
           P++      +++F  N+  ++ +  ++ F +  L  P     G  +G   +F+  P E V
Sbjct: 83  PLIGVGLCVSSQFGTNEAMKRYFHKRNNFQSTSLRLPEYYACGFVSGCANAFLATPIEHV 142

Query: 133 KIRLQ-----DVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWR--HGIWNAGYFGIIF 185
           +I LQ        +++   +  +K ++ KEG L    G   T+ R  HG      FG+ F
Sbjct: 143 RILLQVQTKSRADAEYQGAMDCIKKLL-KEGKLM--RGFTPTILRTSHG------FGVYF 193

Query: 186 QVRALLPKASTKSEQTRNDL------LAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVP 239
                +  +  +    R D+      L G   G+L   +  PFDV+KS +Q+  +    P
Sbjct: 194 TSYEAMICSEQRKGIARKDIPAWKLCLYGAFSGSLLWAMVYPFDVIKSVMQSDKL--RTP 251

Query: 240 RKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVM 287
                 +     IY E G KA  KGF P +LR  P  G     F   M
Sbjct: 252 VYGTNVFQVAKNIYNERGPKAFVKGFGPTMLRSLPVNGATFTAFEMAM 299

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 49/197 (24%), Positives = 89/197 (45%), Gaps = 9/197 (4%)

Query: 95  KIYKDLFGAEKLTQPL-SILSGASAGICESFVVVPFELVKIRLQDVSSKFTSPIAVVKNI 153
           ++  DL     + + L  I +G + GI +  V  PF++ K+RLQ  SS  T+ + VV+++
Sbjct: 9   QVVDDLTDKSDIRRTLKDITAGTTGGIAQVLVGQPFDITKVRLQ-TSSTPTTALRVVQDL 67

Query: 154 VEKEGILAMYNGLESTMWRHGIWNAGYFGIIFQVRALLPKAST-KSEQTR--NDLLAGTV 210
           V+ EG+   Y G    +   G+  +  FG    ++    K +  +S   R       G V
Sbjct: 68  VKNEGLRGFYKGTTLPLIGVGLCVSSQFGTNEAMKRYFHKRNNFQSTSLRLPEYYACGFV 127

Query: 211 GGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVL 270
            G  ++ L+TP + V+  +Q          +Y  +   +  + KE     L +GF P +L
Sbjct: 128 SGCANAFLATPIEHVRILLQ-VQTKSRADAEYQGAMDCIKKLLKE---GKLMRGFTPTIL 183

Query: 271 RLGPGGGILLVVFTGVM 287
           R   G G+    +  ++
Sbjct: 184 RTSHGFGVYFTSYEAMI 200

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 83/181 (45%), Gaps = 22/181 (12%)

Query: 13  FMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGI 72
           +  G V+G +   +  P++ V+ ++Q+Q    +  +Y+G  DC+K++  KEG  +L +G 
Sbjct: 122 YACGFVSGCANAFLATPIEHVRILLQVQTKSRADAEYQGAMDCIKKL-LKEG--KLMRGF 178

Query: 73  SSPILMEAPKRATKFA------CNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESFVV 126
           +  IL  +      F       C+++ + I +    A KL      L GA +G     +V
Sbjct: 179 TPTILRTSHGFGVYFTSYEAMICSEQRKGIARKDIPAWKL-----CLYGAFSGSLLWAMV 233

Query: 127 VPFELVKIRLQDVSSKFTSPI------AVVKNIVEKEGILAMYNGLESTMWRHGIWNAGY 180
            PF+++K  +Q  S K  +P+       V KNI  + G  A   G   TM R    N   
Sbjct: 234 YPFDVIKSVMQ--SDKLRTPVYGTNVFQVAKNIYNERGPKAFVKGFGPTMLRSLPVNGAT 291

Query: 181 F 181
           F
Sbjct: 292 F 292

 Score = 32.3 bits (72), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 36/86 (41%), Gaps = 3/86 (3%)

Query: 4   QKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQY-KGVFDCLKQIAAK 62
           +K +P     + GA +G     ++YP D++K+VM  Q      P Y   VF   K I  +
Sbjct: 210 RKDIPAWKLCLYGAFSGSLLWAMVYPFDVIKSVM--QSDKLRTPVYGTNVFQVAKNIYNE 267

Query: 63  EGPSRLYKGISSPILMEAPKRATKFA 88
            GP    KG    +L   P     F 
Sbjct: 268 RGPKAFVKGFGPTMLRSLPVNGATFT 293

>CAGL0J09790g complement(957759..958661) highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1, start by
           similarity
          Length = 300

 Score = 77.4 bits (189), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 74/281 (26%), Positives = 122/281 (43%), Gaps = 29/281 (10%)

Query: 10  VYQFMAGAVAGVSEILVMYPLDMV-KTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSR- 67
           V + +  A AG+ EI V +P+D + K +M       SG Q   V    +  AA+    R 
Sbjct: 11  VARLLGSASAGILEIGVFHPVDTISKRLMSNHTKITSGAQLNSV--IFRDHAAEAFGKRV 68

Query: 68  --LYKGISSPILMEAPKRATKFA--------CNDEFQKIYKDLFGAEKLTQPLSILSGAS 117
             L+ G+    + +  +R  K+          N  F+K +   FG +      S  +G+ 
Sbjct: 69  FTLFPGLGYAAVYKILQRVYKYGGQPFANEFLNKHFKKDFDSAFGDKTGKALRSATAGSL 128

Query: 118 AGICESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWN 177
            GI E  V++P +++KI+ Q     F     +   I++ EGI  +Y G   T  R+   +
Sbjct: 129 IGIGE-IVLLPLDVLKIKRQTNPEAFKGRGFL--KILKDEGIFNLYRGWGWTAARNAPGS 185

Query: 178 AGYFG-IIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIP 236
              FG   F    +L            + ++  VG + S ++S P DV+K+R+QN     
Sbjct: 186 FALFGGNAFAKEYILGLQDYSQATWSQNFISSIVGASASLIVSAPLDVIKTRIQN----- 240

Query: 237 GVPRKYN---WSWPALATIYKEEGFKALYKGFVPKVLRLGP 274
              R ++     +  +    K EGF A +KG  PK+L  GP
Sbjct: 241 ---RNFDNPESGFKIVKNTLKNEGFTAFFKGLTPKLLTTGP 278

 Score = 35.0 bits (79), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 41/89 (46%), Gaps = 4/89 (4%)

Query: 1   MSDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIA 60
           + D     +   F++  V   + ++V  PLD++KT +Q +        +K V + LK   
Sbjct: 202 LQDYSQATWSQNFISSIVGASASLIVSAPLDVIKTRIQNRNFDNPESGFKIVKNTLKN-- 259

Query: 61  AKEGPSRLYKGISSPILMEAPKRATKFAC 89
             EG +  +KG++  +L   PK    FA 
Sbjct: 260 --EGFTAFFKGLTPKLLTTGPKLVFSFAL 286

>CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomyces
           cerevisiae YJR077c MIR1, hypothetical start
          Length = 307

 Score = 77.4 bits (189), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 71/271 (26%), Positives = 126/271 (46%), Gaps = 22/271 (8%)

Query: 14  MAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGIS 73
           +AGA+   S    M P+D+VKT +QL+ +       KG+    ++I A+EG   L  G  
Sbjct: 18  LAGAIGCGSTHSSMVPIDVVKTRIQLEPT----VYNKGMVGSFRKIIAEEGAGALLTGFG 73

Query: 74  SPILMEAPKRATKFACNDEFQKIYKDLFG---AEKLTQPLSILSGASAGICESFVVVPFE 130
             +L  + + A KF   + F+K + D  G   A +    + I S A+A       + P E
Sbjct: 74  PTLLGYSIQGAFKFGGYEVFKKFFIDTLGYDTAARYKNSVYIGSAAAAEFLADIALCPLE 133

Query: 131 LVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIFQVRA- 189
             +IRL    +     +     I+++EG+ + Y+G    +++   +N   F ++F+ RA 
Sbjct: 134 ATRIRLVSQPTFANGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIAKF-LVFE-RAS 191

Query: 190 -----LLPKASTKSEQ--TRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKY 242
                L P   T S+   T  +LL+G   G  ++++S P D + S+V  T+  PG     
Sbjct: 192 ELYFSLAPPKDTLSQTSLTAINLLSGLTAGLAAAIVSQPADTLLSKVNKTSKAPG----- 246

Query: 243 NWSWPALATIYKEEGFKALYKGFVPKVLRLG 273
             +   L  + K+ GF   + G   +++ +G
Sbjct: 247 QSTVGLLFQLAKQLGFVGSFAGLPTRLVMVG 277

>Scas_721.27
          Length = 374

 Score = 77.8 bits (190), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 80/325 (24%), Positives = 140/325 (43%), Gaps = 65/325 (20%)

Query: 8   PFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGG----------------------- 44
           P+V+ F+AG + G++  +V  P D+VKT +Q  +                          
Sbjct: 52  PWVH-FVAGGIGGMAGAVVTCPFDLVKTRLQSDIYQSVYKSKAATVTAAHNSKIANSLVQ 110

Query: 45  SGPQYKGVFDCLKQIAAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAE 104
           +G  +K  F  L  +  +EG   L+KG+   ++   P R+  F      ++IY   F   
Sbjct: 111 AGTHFKETFGILGNVYKREGFRSLFKGLGPNLVGVIPARSINFFTYGTTKEIYSKAFNNG 170

Query: 105 KLTQPLSILSGASAGICESFVVVPFELVKIRLQ----DVSSKFTSPIAVVKNIVEKEGIL 160
           + T  + ++S A+AG   S    P  ++K R+Q      + K+ +    +K +++ EGI 
Sbjct: 171 QETPLIHLMSAATAGWATSTATNPIWMIKTRVQLDKAGTTRKYKNSWDCLKTVLKSEGIY 230

Query: 161 AMYNGLESTMWRHGIWNAGYFGII---------FQVRALLPKAS----------TKS--- 198
            +Y GL          +A Y G I          Q++ L+ + S          TKS   
Sbjct: 231 GLYRGL----------SASYLGSIEGILQWLLYEQMKHLIKQRSIEKFGHEGQLTKSRTE 280

Query: 199 ---EQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKE 255
              E  +    AG V   ++S+++ P +VV++R++   +  G P KY     +   I KE
Sbjct: 281 KIKEWCQRSGSAG-VAKFIASIVTYPHEVVRTRLRQMPMENGKP-KYTGLVQSFRVIIKE 338

Query: 256 EGFKALYKGFVPKVLRLGPGGGILL 280
           EG  ++Y G  P ++R  P   I+ 
Sbjct: 339 EGLASMYSGLTPHLMRTVPNSIIMF 363

>Kwal_0.232
          Length = 274

 Score = 75.9 bits (185), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 79/296 (26%), Positives = 134/296 (45%), Gaps = 50/296 (16%)

Query: 9   FVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRL 68
           F+   +AGA AG S  L  +P+D +KT  +LQ +GG                A  G   +
Sbjct: 6   FITSLLAGAAAGTSTDLFFFPIDTLKT--RLQAAGG--------------FFANGGYLGV 49

Query: 69  YKGISSPILMEAPKRATKFACNDEFQKIYKDLFG-----AEKLTQPLSILSGASAG-ICE 122
           Y+G+ S ++  AP  +  F   D  +   + +F      ++++ +  + +  +SAG I  
Sbjct: 50  YRGLGSAVVASAPSASLFFVTYDGMKSYSRPIFNNLITSSDQVAETATHMFSSSAGEIAA 109

Query: 123 SFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEK---EGI-LAMYNGLESTMWRHGIWNA 178
             V VP E++K R Q  + K  S +  +K +++    EGI   +Y G  +T+ R      
Sbjct: 110 CMVRVPAEVIKQRTQ--THKSDSSLQTLKKLLQNENGEGIRRNLYRGWSTTVMR----EI 163

Query: 179 GYFGIIFQVRALLPKA---STKSEQTR--NDLLAGTVGGTLSSLLSTPFDVVKSR--VQN 231
            +  I F +   L K    S   EQ         G V G +++  +TP DV+K+R  + +
Sbjct: 164 PFTCIQFPLYEFLKKQWAISGGREQVAPWQGAFCGCVAGGIAAATTTPLDVLKTRLMLSH 223

Query: 232 TAV-IPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGV 286
           T+V +  + R+          IY  EG+K  + G  P+ + +  GG I L V+  V
Sbjct: 224 TSVPVLHLARQ----------IYATEGWKVFFSGVGPRTVWISAGGAIFLGVYETV 269

>YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate
           transporter of the mitochondrial carrier (MCF) family
           [936 bp, 311 aa]
          Length = 311

 Score = 76.3 bits (186), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 71/270 (26%), Positives = 120/270 (44%), Gaps = 20/270 (7%)

Query: 14  MAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGIS 73
           +AGA+   S    M P+D+VKT +QL+ +       KG+    KQI A EG   L  G  
Sbjct: 22  LAGAIGCGSTHSSMVPIDVVKTRIQLEPT----VYNKGMVGSFKQIIAGEGAGALLTGFG 77

Query: 74  SPILMEAPKRATKFACNDEFQKIYKDLFG---AEKLTQPLSILSGASAGICESFVVVPFE 130
             +L  + + A KF   + F+K + D  G   A +    + + S A A       + P E
Sbjct: 78  PTLLGYSIQGAFKFGGYEVFKKFFIDNLGYDTASRYKNSVYMGSAAMAEFLADIALCPLE 137

Query: 131 LVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIFQVRAL 190
             +IRL          +     I+++EGI + Y+G    +++   +N   F ++F+  + 
Sbjct: 138 ATRIRLVSQPQFANGLVGGFSRILKEEGIGSFYSGFTPILFKQIPYNIAKF-LVFERASE 196

Query: 191 L------PKASTKSEQTR-NDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYN 243
                  PK    S  T   +LL+G   G  ++++S P D + S+V  T   PG      
Sbjct: 197 FYYGFAGPKEKLSSTSTTLLNLLSGLTAGLAAAIVSQPADTLLSKVNKTKKAPG-----Q 251

Query: 244 WSWPALATIYKEEGFKALYKGFVPKVLRLG 273
            +   LA + K+ GF   + G   +++ +G
Sbjct: 252 STVGLLAQLAKQLGFFGSFAGLPTRLVMVG 281

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 38/170 (22%), Positives = 71/170 (41%), Gaps = 11/170 (6%)

Query: 126 VVPFELVKIRLQDVSSKFTSP-IAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFG-- 182
           +VP ++VK R+Q   + +    +   K I+  EG  A+  G   T+  + I  A  FG  
Sbjct: 35  MVPIDVVKTRIQLEPTVYNKGMVGSFKQIIAGEGAGALLTGFGPTLLGYSIQGAFKFGGY 94

Query: 183 IIFQVRALLPKASTKSEQTRNDLLAGTVGGT--LSSLLSTPFDVVKSRVQNTAVIPGVPR 240
            +F+   +       + + +N +  G+      L+ +   P +  + R+ +       P+
Sbjct: 95  EVFKKFFIDNLGYDTASRYKNSVYMGSAAMAEFLADIALCPLEATRIRLVSQ------PQ 148

Query: 241 KYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFF 290
             N      + I KEEG  + Y GF P + +  P      +VF    +F+
Sbjct: 149 FANGLVGGFSRILKEEGIGSFYSGFTPILFKQIPYNIAKFLVFERASEFY 198

>KLLA0E15532g complement(1383230..1384210) similar to sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4 RNA splicing
           protein and member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 326

 Score = 75.9 bits (185), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 78/300 (26%), Positives = 135/300 (45%), Gaps = 41/300 (13%)

Query: 8   PFVYQFMAGAVAGVSEILVMYPLDMVKTVMQ---------------LQVSGGSGPQYKGV 52
           P  YQ +AGA AG+ E  +M+P+D +KT MQ                  +   G     +
Sbjct: 19  PLSYQLIAGAFAGIMEHSIMFPIDALKTRMQAVSEIKAAASASASGGAGAASGGAGAGTL 78

Query: 53  FDCLKQIAAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLT--QPL 110
              + +I++ EG   L++G+ S ++   P  A  FA   EF K  + L  A+     QPL
Sbjct: 79  LQQISRISSTEGSLALWRGVQSMVMGAGPAHAVYFATY-EFCK--EQLIDAKDFNTHQPL 135

Query: 111 -SILSGASAGICESFVVVPFELVKIRLQDVS-SKFTSPIAVVKNIVEKEGILAMYNGLES 168
            + +SG +A +    ++ PF+ +K RLQ  S S  +S   +  NI + EG +A +    +
Sbjct: 136 KTAVSGVAATVAADALMNPFDTIKQRLQLQSKSSDSSMWRMAFNIYKNEGPMAFFYSYPT 195

Query: 169 TMWRHGIWNAGYFGIIFQVRALLPKASTKSEQTRN------DLLAGTVGGTLSSLLSTPF 222
           T+      N  +  + F    ++ ++STK     N        L G + G   + ++TP 
Sbjct: 196 TL----AMNIPFAALNF----VIYESSTKFFNPTNAYNPWIHCLCGGIAGATCAAVTTPL 247

Query: 223 DVVKSRVQ----NTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGI 278
           D +K+ +Q    +T  +    +  N    A   I++  G+K  ++G  P+V+   P   I
Sbjct: 248 DCIKTVLQIRGSDTVHVESF-KTANTFKKAAQAIWQSYGWKGFWRGLQPRVISNIPATAI 306

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 53/211 (25%), Positives = 85/211 (40%), Gaps = 34/211 (16%)

Query: 107 TQPLS--ILSGASAGICESFVVVPFELVKIRLQDVSS--------------------KFT 144
           T PLS  +++GA AGI E  ++ P + +K R+Q VS                        
Sbjct: 17  TAPLSYQLIAGAFAGIMEHSIMFPIDALKTRMQAVSEIKAAASASASGGAGAASGGAGAG 76

Query: 145 SPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGII-FQVRALLPKASTKSEQTRN 203
           + +  +  I   EG LA++ G++S +   G  +A YF    F    L+      + Q   
Sbjct: 77  TLLQQISRISSTEGSLALWRGVQSMVMGAGPAHAVYFATYEFCKEQLIDAKDFNTHQPLK 136

Query: 204 DLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWS--WPALATIYKEEGFKAL 261
             ++G      +  L  PFD +K R+Q       +  K + S  W     IYK EG  A 
Sbjct: 137 TAVSGVAATVAADALMNPFDTIKQRLQ-------LQSKSSDSSMWRMAFNIYKNEGPMAF 189

Query: 262 YKGFVPKVLRLG-PGGGILLVVFTGVMDFFR 291
           +  + P  L +  P   +  V++     FF 
Sbjct: 190 FYSY-PTTLAMNIPFAALNFVIYESSTKFFN 219

>YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [930 bp, 309 aa]
          Length = 309

 Score = 75.9 bits (185), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 70/286 (24%), Positives = 124/286 (43%), Gaps = 20/286 (6%)

Query: 9   FVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVS----GGSGPQYKGVFDCLKQIAAKEG 64
           F   F+ G V+         P++ VK +MQ Q      G    +YKG+ DC K+ A  EG
Sbjct: 13  FGVDFLMGGVSAAIAKTGAAPIERVKLLMQNQEEMLKQGSLDTRYKGILDCFKRTATHEG 72

Query: 65  PSRLYKGISSPILMEAPKRATKFACNDEFQKIY---KDLFGAEKLTQPLSILSGASAGIC 121
               ++G ++ +L   P +A  FA  D+ + +    ++  G  K     ++ SG +AG  
Sbjct: 73  IVSFWRGNTANVLRYFPTQALNFAFKDKIKSLLSYDRERDGYAKWFAG-NLFSGGAAGGL 131

Query: 122 ESFVVVPFELVKIRL--------QDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRH 173
               V   +  + RL             +F   + V K  ++ +G+L +Y G   ++   
Sbjct: 132 SLLFVYSLDYARTRLAADARGSKSTSQRQFNGLLDVYKKTLKTDGLLGLYRGFVPSVLGI 191

Query: 174 GIWNAGYFGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTA 233
            ++   YFG+    + +L   + +     + LL G V    +S  S P D V+ R+  T+
Sbjct: 192 IVYRGLYFGLYDSFKPVLLTGALEGSFVASFLL-GWVITMGASTASYPLDTVRRRMMMTS 250

Query: 234 VIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGIL 279
              G   KY+ +   L  I ++EG  +L+KG    + R     G++
Sbjct: 251 ---GQTIKYDGALDCLRKIVQKEGAYSLFKGCGANIFRGVAAAGVI 293

>Kwal_33.15597
          Length = 305

 Score = 75.5 bits (184), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 69/270 (25%), Positives = 124/270 (45%), Gaps = 20/270 (7%)

Query: 14  MAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGIS 73
           +AGA+   +    M P+D+VKT +QL+ +       KG+    KQI + EG   L  G  
Sbjct: 18  LAGAIGCGTTHSAMVPIDVVKTRIQLEPT----VYNKGMISSFKQIISSEGAGALLTGFG 73

Query: 74  SPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESF---VVVPFE 130
             +L  + + + KF   + F+K++ D  G ++     + +   SA I E F    + P E
Sbjct: 74  PTLLGYSLQGSFKFGGYEVFKKLFIDTLGYDQAVNYKNSIYIGSAAIAEFFADIALCPLE 133

Query: 131 LVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIFQVRAL 190
             +IRL    +     +     I+++EG+ + YNG    +++   +N   F ++F+  A 
Sbjct: 134 ATRIRLVSQPTFANGLVGGFSRILKEEGLSSFYNGFTPILFKQIPYNIAKF-LVFERAAE 192

Query: 191 L------PK-ASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYN 243
           +      PK   + S  T  +LL+G   G  ++++S P D + S+V      PG      
Sbjct: 193 VYFGMAGPKETLSTSTTTGLNLLSGLTAGLAAAIVSQPADTLLSKVNKAKKAPG-----Q 247

Query: 244 WSWPALATIYKEEGFKALYKGFVPKVLRLG 273
            +   L  + KE GF   + G   +++ +G
Sbjct: 248 STIGLLGQLAKELGFVGSFAGLPTRLVMVG 277

 Score = 35.8 bits (81), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 36/167 (21%), Positives = 69/167 (41%), Gaps = 11/167 (6%)

Query: 113 LSGASAGICESFVVVPFELVKIRLQDVSSKFTSP-IAVVKNIVEKEGILAMYNGLESTMW 171
           L+GA         +VP ++VK R+Q   + +    I+  K I+  EG  A+  G   T+ 
Sbjct: 18  LAGAIGCGTTHSAMVPIDVVKTRIQLEPTVYNKGMISSFKQIISSEGAGALLTGFGPTLL 77

Query: 172 RHGIWNAGYFG--IIFQVRALLPKASTKSEQTRNDLLAGT--VGGTLSSLLSTPFDVVKS 227
            + +  +  FG   +F+   +      ++   +N +  G+  +    + +   P +  + 
Sbjct: 78  GYSLQGSFKFGGYEVFKKLFIDTLGYDQAVNYKNSIYIGSAAIAEFFADIALCPLEATRI 137

Query: 228 RVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGP 274
           R+ +       P   N      + I KEEG  + Y GF P + +  P
Sbjct: 138 RLVSQ------PTFANGLVGGFSRILKEEGLSSFYNGFTPILFKQIP 178

>Sklu_2117.2 YDL198C, Contig c2117 3737-4633
          Length = 298

 Score = 75.5 bits (184), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 78/292 (26%), Positives = 126/292 (43%), Gaps = 34/292 (11%)

Query: 1   MSDQKPLPFVYQFMAGAVAGVSEILVMYPLDMV-KTVMQLQVSGGSGPQYKGVFDCLKQI 59
           MS+ K    + + +  A AG+ EI V +P+D + K +M      GS  Q   V    ++ 
Sbjct: 1   MSNDKKQSGLARVLGSASAGILEIGVFHPVDTISKRLMSNHTKIGSSSQLNSV--IFREH 58

Query: 60  AAKEGPSR---LYKGISSPILMEAPKRATKFA--------CNDEFQKIYKDLFGAEKLTQ 108
           AA+    R   L+ G+      +  +R  K+          N  F+  + + FG +    
Sbjct: 59  AAEPLSKRVFTLFPGLGYAATYKILQRVYKYGGQPFANEFLNRNFKADFDNTFGEKTGKA 118

Query: 109 PLSILSGASAGICESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLES 168
             S  +G+  GI E  V++P +++KI+ Q     F      VK I++ EG L +Y G   
Sbjct: 119 LRSATAGSMIGIGE-IVLLPLDVLKIKRQTNPEAFKGR-GFVK-ILKDEG-LGLYRGWGW 174

Query: 169 TMWRHGIWNAGYFG-IIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKS 227
           T  R+   +   FG   F    +L            + ++  VG + S ++S P DV+K+
Sbjct: 175 TAARNAPGSFALFGGNAFAKEYILGLKDYSQATWSQNFVSSIVGASASLIISAPLDVIKT 234

Query: 228 RVQNTAVIPGVPRKYNWSWPA-----LATIYKEEGFKALYKGFVPKVLRLGP 274
           R+QN           N+  P      +    K EGF A +KG  PK+L  GP
Sbjct: 235 RIQNK----------NFENPESGFTIVKNTLKNEGFSAFFKGLTPKLLTTGP 276

 Score = 36.2 bits (82), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 44/100 (44%), Gaps = 4/100 (4%)

Query: 1   MSDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIA 60
           + D     +   F++  V   + +++  PLD++KT  ++Q      P+    F  +K   
Sbjct: 200 LKDYSQATWSQNFVSSIVGASASLIISAPLDVIKT--RIQNKNFENPESG--FTIVKNTL 255

Query: 61  AKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDL 100
             EG S  +KG++  +L   PK    FA       ++ +L
Sbjct: 256 KNEGFSAFFKGLTPKLLTTGPKLVFSFALAQTLIPVFDNL 295

>Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement
          Length = 288

 Score = 75.1 bits (183), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 72/285 (25%), Positives = 123/285 (43%), Gaps = 34/285 (11%)

Query: 6   PLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGP 65
           P P  Y +  G   G+   +  +PLD+ K  ++LQ +    P    +     QI   EG 
Sbjct: 5   PEPVKYPWWYGGFGGIVACVATHPLDLAK--VRLQTAPAPKPT---LVRMASQILRNEGV 59

Query: 66  SRLYKGISSPILMEAPKRATKFACNDEFQKIY--KDLFGAEKLTQPLSILSGASAGICES 123
             LY G+++ IL +      +F   D  ++ Y  K+   +     P S+ SGA  G+  +
Sbjct: 60  PGLYSGLTAAILRQCTYTTARFGVYDFVKERYIPKEYLNSMLYLLPCSMFSGAVGGLIGN 119

Query: 124 FVVVPFELVKIRLQDVSS-------KFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIW 176
               P ++V IR+Q+ SS        + +    +  I   EG+  ++ G +  + R GI 
Sbjct: 120 ----PADVVNIRMQNDSSLPAELRRNYKNAADGLYKICSGEGVAKLFTGWQPNLVR-GIL 174

Query: 177 NAGYFGIIFQ------VRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQ 230
                 + +       V+ +      KS    + LLAG V  T+ S    P DV+K+RV 
Sbjct: 175 MTSSQVVTYDIAKNYLVQNVGLDKDNKSTHFASSLLAGLVATTVCS----PADVIKTRVM 230

Query: 231 NTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPG 275
           N          ++ +   L    K+EG   +++G++P  +RLGP 
Sbjct: 231 NAH-----KHSHDSAVRILLDAVKQEGPSFMFRGWLPSFVRLGPN 270

>CAGL0F07711g complement(751794..752900) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, hypothetical start
          Length = 368

 Score = 75.9 bits (185), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 71/247 (28%), Positives = 111/247 (44%), Gaps = 23/247 (9%)

Query: 1   MSDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIA 60
             D +  P  + F+AG V G+     M+ LD VKT  Q      +  +YK +    + + 
Sbjct: 45  FDDYEHSPIWHCFLAGGVGGIIGDSAMHSLDTVKTRQQ---GAPNVHKYKHMLQAYRTMF 101

Query: 61  AKEGPSR-LYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAG 119
            +EG  R LY G  + +L   P  A  F+   EF K  + +     L    S L+    G
Sbjct: 102 IEEGFRRGLYGGYCAAMLGSFPSAAIFFSTY-EFTK--RTMINDYHLNDTFSHLTAGFLG 158

Query: 120 -ICESFVVVPFELVKIRLQ----------DVSSKFTSPIAVVKNIVEKEGILAMYNGLES 168
               SFV VP E++K RLQ          +    + S    +  I   EG+ A++ G ++
Sbjct: 159 DFFSSFVYVPSEVLKTRLQLQGCYNNPHFNSGYNYKSLRNAIATIYRTEGVAALFFGYKA 218

Query: 169 TMWRHGIWNAGYFGIIFQVRA----LLPKASTKSEQT-RNDLLAGTVGGTLSSLLSTPFD 223
           T+ R   ++A  F    + R     L  K   K + +  N+++ G   G L+ +L+TP D
Sbjct: 219 TLARDLPFSALQFAFYEKFRQWAFLLEGKDIYKHDLSISNEIVTGACAGGLAGILTTPLD 278

Query: 224 VVKSRVQ 230
           VVK+RVQ
Sbjct: 279 VVKTRVQ 285

>Scas_558.2
          Length = 289

 Score = 74.3 bits (181), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 73/296 (24%), Positives = 125/296 (42%), Gaps = 51/296 (17%)

Query: 9   FVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGG--SGPQYKGVFDCLKQIAAKEGPS 66
           FV   ++GA AG S  LV +P+D +KT  +LQ  GG      Y G+              
Sbjct: 6   FVMSLLSGAAAGTSTDLVFFPIDTLKT--RLQAKGGFFQNGGYHGI-------------- 49

Query: 67  RLYKGISSPILMEAPKRATKFACNDEFQKIYK----DLFGAEKLTQPLSI------LSGA 116
             Y+G+ S ++  AP  +  F   D  +   +     +  +     P S+      ++ +
Sbjct: 50  --YRGLGSAVVASAPSASLFFVTYDSMKVRVRPHVERVINSSGTRSPHSVDTIVHMIASS 107

Query: 117 SAGICESFVVVPFELVKIRLQ--DVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHG 174
              +    V VP E++K R Q    +S + +   ++KN  ++  I  +Y G  +T+ R  
Sbjct: 108 MGELAACLVRVPAEVIKQRTQVHSTNSSWQTFRTILKNENQEGIIRNLYRGWSTTIMR-- 165

Query: 175 IWNAGYFGIIFQVRALLPKASTKSEQTRNDL------LAGTVGGTLSSLLSTPFDVVKSR 228
                +  I F +   + K     +     L      + G++ G +++  +TP D +K+R
Sbjct: 166 --EIPFTCIQFPLYEFMKKEWALYDNEVGHLKPWKGAICGSIAGGIAAATTTPLDFLKTR 223

Query: 229 VQ-NTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVF 283
           +  N   IP      N        IYKEEGFK  + G  P+ + +  GG I L V+
Sbjct: 224 LMLNKDSIPIKSLIRN--------IYKEEGFKIFFSGIYPRTMWISAGGAIFLGVY 271

>KLLA0E23705g complement(2099965..2101071) highly similar to
           sp|P38127 Saccharomyces cerevisiae YBR192w RIM2
           mitochondrial carrier protein (MCF), start by similarity
          Length = 368

 Score = 74.7 bits (182), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 95/191 (49%), Gaps = 23/191 (12%)

Query: 1   MSDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIA 60
           +++ +  P+++  +A A AG +   V  P+ +VKT +QL  +G     YK   DC+K + 
Sbjct: 162 LNNGQEAPWIH-LLAAATAGWATSTVTNPIWLVKTRLQLDKAGTK--TYKNSLDCIKSVV 218

Query: 61  AKEGPSRLYKGISSP-----------ILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQP 109
             EG   LYKG+S+            IL E  KR  K    ++F  I++D        + 
Sbjct: 219 KNEGVLGLYKGLSASYLGSVEGILQWILYEQMKRIIKERSIEKFGHIHEDAKSTSDKVKE 278

Query: 110 LSILSGASAGICE---SFVVVPFELVKIRLQDVSS-----KFTSPIAVVKNIVEKEGILA 161
               SG SAG+ +   S V  P E+V+ RL+   +     K+T  +   + I+++EG+++
Sbjct: 279 WCQRSG-SAGLAKFVASIVTYPHEVVRTRLRQAPTENGKLKYTGLVQSFRVIIKEEGLVS 337

Query: 162 MYNGLESTMWR 172
           MY+GL   + R
Sbjct: 338 MYSGLTPHLLR 348

 Score = 70.9 bits (172), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 80/327 (24%), Positives = 146/327 (44%), Gaps = 61/327 (18%)

Query: 3   DQKPL--PFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQV-----------SGGSGP-- 47
           D +P   P+V+ F+AG + G++  +V  P D+VKT +Q  V           + GS    
Sbjct: 43  DSQPAVKPWVH-FVAGGIGGMAGAIVTCPFDVVKTRLQSDVFRTQYKSAAMQNNGSSTLH 101

Query: 48  -------QYKGVFDCLKQIAAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDL 100
                   +K  F  +  +  +EG   L+KG+   ++   P R+  F      + IY   
Sbjct: 102 FVSRSLLHFKETFGIIGNVYRQEGFRSLFKGLGPNLVGVIPARSINFLTYGTTKDIYSRT 161

Query: 101 FGAEKLTQPLSILSGASAGICESFVVVPFELVKIRLQ---DVSSKFTSPIAVVKNIVEKE 157
               +    + +L+ A+AG   S V  P  LVK RLQ     +  + + +  +K++V+ E
Sbjct: 162 LNNGQEAPWIHLLAAATAGWATSTVTNPIWLVKTRLQLDKAGTKTYKNSLDCIKSVVKNE 221

Query: 158 GILAMYNGLESTMWRHGIWNAGYFG--------IIF-QVRALLPKAS-------TKSEQT 201
           G+L +Y GL          +A Y G        I++ Q++ ++ + S        +  ++
Sbjct: 222 GVLGLYKGL----------SASYLGSVEGILQWILYEQMKRIIKERSIEKFGHIHEDAKS 271

Query: 202 RNDLL------AGTVGGT--LSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIY 253
            +D +      +G+ G    ++S+++ P +VV++R++      G   KY     +   I 
Sbjct: 272 TSDKVKEWCQRSGSAGLAKFVASIVTYPHEVVRTRLRQAPTENG-KLKYTGLVQSFRVII 330

Query: 254 KEEGFKALYKGFVPKVLRLGPGGGILL 280
           KEEG  ++Y G  P +LR  P   I+ 
Sbjct: 331 KEEGLVSMYSGLTPHLLRTVPNSIIMF 357

 Score = 37.4 bits (85), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 21/92 (22%), Positives = 45/92 (48%), Gaps = 19/92 (20%)

Query: 218 LSTPFDVVKSRVQN----------------TAVIPGVPR---KYNWSWPALATIYKEEGF 258
           ++ PFDVVK+R+Q+                ++ +  V R    +  ++  +  +Y++EGF
Sbjct: 67  VTCPFDVVKTRLQSDVFRTQYKSAAMQNNGSSTLHFVSRSLLHFKETFGIIGNVYRQEGF 126

Query: 259 KALYKGFVPKVLRLGPGGGILLVVFTGVMDFF 290
           ++L+KG  P ++ + P   I  + +    D +
Sbjct: 127 RSLFKGLGPNLVGVIPARSINFLTYGTTKDIY 158

>Scas_667.4
          Length = 308

 Score = 73.6 bits (179), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 69/293 (23%), Positives = 127/293 (43%), Gaps = 25/293 (8%)

Query: 4   QKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQ----VSGGSGPQYKGVFDCLKQI 59
           +K   F   F+ G V+         P++ VK ++Q Q      G    +YKG+ +C ++ 
Sbjct: 8   KKESNFAIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDSKYKGIIECFQRT 67

Query: 60  AAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQ-----PLSILS 114
           A  EG    ++G ++ ++   P +A  FA  D+     K +FG +K          ++ S
Sbjct: 68  AKTEGIIAFWRGNTANVIRYFPTQALNFAFKDKI----KAMFGFKKEEGYGKWFAGNLAS 123

Query: 115 GASAGICESFVVVPFELVKIRL--------QDVSSKFTSPIAVVKNIVEKEGILAMYNGL 166
           G +AG      V   +  + RL        +  S ++   I V K  +  +G+  +Y G 
Sbjct: 124 GGAAGGLSLLFVYSLDYARTRLAADAKSSKKGGSRQYKGLIDVYKQTLATDGMAGLYRGF 183

Query: 167 ESTMWRHGIWNAGYFGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVK 226
             ++    ++   YFG+   ++  +   S +     + LL G +  T +S  S P D V+
Sbjct: 184 LPSVVGIIVYRGLYFGLYDSLKPAVLTGSLEGSFLASFLL-GWIVTTGASTASYPLDTVR 242

Query: 227 SRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGIL 279
            R+  T+   G   KY+ ++     +   EG  +L+KG    +LR   G G++
Sbjct: 243 RRMMMTS---GQAVKYDGAFDCFRKVVAAEGVSSLFKGCGANILRGVAGAGVI 292

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 71/189 (37%), Gaps = 28/189 (14%)

Query: 9   FVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSG---GSGPQYKGVFDCLKQIAAKEGP 65
           F     +G  AG   +L +Y LD  +T +         G   QYKG+ D  KQ  A +G 
Sbjct: 117 FAGNLASGGAAGGLSLLFVYSLDYARTRLAADAKSSKKGGSRQYKGLIDVYKQTLATDGM 176

Query: 66  SRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESFV 125
           + LY+G    ++     R   F   D  +     L G+ + +   S L G       S  
Sbjct: 177 AGLYRGFLPSVVGIIVYRGLYFGLYDSLKPAV--LTGSLEGSFLASFLLGWIVTTGASTA 234

Query: 126 VVPFELVKIRL-----------------------QDVSSKFTSPIAVVKNIVEKEGILAM 162
             P + V+ R+                       + VSS F    A +   V   G+++M
Sbjct: 235 SYPLDTVRRRMMMTSGQAVKYDGAFDCFRKVVAAEGVSSLFKGCGANILRGVAGAGVISM 294

Query: 163 YNGLESTMW 171
           Y+ L+  M+
Sbjct: 295 YDQLQMIMF 303

>Scas_669.6
          Length = 373

 Score = 73.6 bits (179), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 75/294 (25%), Positives = 127/294 (43%), Gaps = 44/294 (14%)

Query: 27  MYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSR-LYKGISSPILMEAPKRAT 85
           M+ LD VKT  Q        P+YK +    + I  +EG +R LY G  + +L   P  A 
Sbjct: 69  MHSLDTVKTRQQ---GAPMTPKYKNMTTAYRTIFLEEGIARGLYGGYFAAMLGSFPSAAI 125

Query: 86  KFACNDEFQKIYKDLFGAEKLTQPLSILSGASAG-ICESFVVVPFELVKIRLQDVSSKFT 144
            F     ++   + + G       +S LS    G    SFV VP E++K RLQ +  +  
Sbjct: 126 FFGT---YEWCKRKMIGDLGFNDTVSHLSAGLLGDFVSSFVYVPSEVLKTRLQ-LQGRVN 181

Query: 145 SPI-----------AVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIFQVRALLPK 193
           +P              ++ IV  EG+ A++ G ++T+ R   ++A  FG   + R    K
Sbjct: 182 NPFFQSGYNYRSLRTAIRIIVNTEGVKALFFGYKATLARDLPFSALQFGFYEKFRQTAFK 241

Query: 194 ASTKSEQTRN-----DLLAGTVGGTLSSLLSTPFDVVKSRVQ--------NTAVIPG-VP 239
              K     N     ++  G + G L+ +++TP DV+K+R+Q        N+A   G + 
Sbjct: 242 LEKKDITKHNLSIPNEIFTGAIAGGLAGIITTPMDVIKTRLQTQQADINPNSATTVGAIS 301

Query: 240 RKYNWS----------WPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVF 283
            K N            + +L  +Y+ EG    + G  P+ +       I+L+++
Sbjct: 302 AKTNKKSRPIVLSNSIFRSLKLVYQSEGVIGFFSGVGPRFVWTSVQSSIMLLLY 355

>Scas_715.45
          Length = 305

 Score = 72.8 bits (177), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 67/259 (25%), Positives = 117/259 (45%), Gaps = 26/259 (10%)

Query: 29  PLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGISSPILMEAPKRATKFA 88
           PLD++K  +Q+  +      Y+     + QI  KEG  +L+ G+ +  +  + + A K+ 
Sbjct: 36  PLDLIKCRLQVDPT-----LYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGAGKYG 90

Query: 89  CNDEFQKIY-----KDLFGAEKLTQPLSILSGASAGICESFVVVPFELVKIRLQDVSSKF 143
             + F+++Y     KD   A K    + +LS A+A      ++ PFE +K++ Q     +
Sbjct: 91  GYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQTTMPPW 150

Query: 144 TSP-IAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFG----IIFQVRALLPKASTKS 198
            +  I   K +  KEG+   Y G+     R   +    F     I+  + A LP   ++ 
Sbjct: 151 CNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEM 210

Query: 199 ---EQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWP-ALATIYK 254
              +Q     + G + G L +++S P DV+ S++ N        RK N S   AL  IY 
Sbjct: 211 SALQQISVSFVGGYMAGILCAIVSHPADVMVSKINN-------ERKVNESMNVALKRIYS 263

Query: 255 EEGFKALYKGFVPKVLRLG 273
             GF  L+ G   ++L +G
Sbjct: 264 RIGFVGLWNGLPVRILMIG 282

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/155 (23%), Positives = 69/155 (44%), Gaps = 11/155 (7%)

Query: 126 VVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFG--- 182
           V P +L+K RLQ   + + S  + +  I++KEG+  ++ G+ +T   + +  AG +G   
Sbjct: 34  VTPLDLIKCRLQVDPTLYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYE 93

Query: 183 ---IIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVP 239
               ++    +  +A+    +T   LL+       + ++  PF+ +K + Q T     +P
Sbjct: 94  LFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQTT-----MP 148

Query: 240 RKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGP 274
              N        +Y +EG    YKG  P   R  P
Sbjct: 149 PWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIP 183

>AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH]
           (585963..586970) [1008 bp, 335 aa]
          Length = 335

 Score = 73.2 bits (178), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 68/302 (22%), Positives = 119/302 (39%), Gaps = 49/302 (16%)

Query: 14  MAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYK-------GVFDCLKQIAAKEGPS 66
           +AG +AG     ++ PLD +K + Q      S PQ+        G+    K I A +GP 
Sbjct: 24  LAGGIAGSCAKTLVAPLDRIKILFQT-----SNPQFAQFAGSMGGLVRASKYIMAHDGPR 78

Query: 67  RLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESFVV 126
             ++G S+ +L   P  A KF   ++ + +    +  E   + L  LSG+ AG+C  FV 
Sbjct: 79  GFFQGHSATLLRIFPYAAIKFIAYEQIRSVVIPTWRHESHWRRL--LSGSLAGLCSVFVT 136

Query: 127 VPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIFQ 186
            P +LV++RL  V+ +  + +  +   +  E             W    W+  Y G    
Sbjct: 137 YPLDLVRVRLAYVTERHDAKVRKIMACIYNERPSEALRKWYIPQW-FAHWSNFYRGYTPT 195

Query: 187 VRALLPKA----------------------------------STKSEQTRNDLLAGTVGG 212
           V  ++P A                                   T   +T   L+AG + G
Sbjct: 196 VIGMIPYAGVSFFAHDLCQDIFRHPMLEPYSVLSPGGSSAYDRTVPLKTWAQLVAGGLAG 255

Query: 213 TLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRL 272
             S   + PF++++ R+Q +A+     R +         IY E G++  + G     +++
Sbjct: 256 MASQTAAYPFEIIRRRLQVSAITDPTRRHFVGINEIAKIIYTEGGWRGFFVGLSIGYIKV 315

Query: 273 GP 274
            P
Sbjct: 316 TP 317

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 84/203 (41%), Gaps = 32/203 (15%)

Query: 113 LSGASAGICESFVVVPFELVKIRLQDVSSKFTS-------PIAVVKNIVEKEGILAMYNG 165
           L+G  AG C   +V P + +KI  Q  + +F          +   K I+  +G    + G
Sbjct: 24  LAGGIAGSCAKTLVAPLDRIKILFQTSNPQFAQFAGSMGGLVRASKYIMAHDGPRGFFQG 83

Query: 166 LESTMWRHGIWNAGYFGIIFQVRA-LLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDV 224
             +T+ R   + A  F    Q+R+ ++P    +S   R  LL+G++ G  S  ++ P D+
Sbjct: 84  HSATLLRIFPYAAIKFIAYEQIRSVVIPTWRHESHWRR--LLSGSLAGLCSVFVTYPLDL 141

Query: 225 VKSRVQN-TAVIPGVPRKYNWSWPALATIYKEEGFKAL---------------YKGFVPK 268
           V+ R+   T       RK       +A IY E   +AL               Y+G+ P 
Sbjct: 142 VRVRLAYVTERHDAKVRK------IMACIYNERPSEALRKWYIPQWFAHWSNFYRGYTPT 195

Query: 269 VLRLGPGGGILLVVFTGVMDFFR 291
           V+ + P  G+         D FR
Sbjct: 196 VIGMIPYAGVSFFAHDLCQDIFR 218

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/185 (20%), Positives = 71/185 (38%), Gaps = 44/185 (23%)

Query: 12  QFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGP------ 65
           + ++G++AG+  + V YPLD+V+  +   V+     + + +  C+      E        
Sbjct: 121 RLLSGSLAGLCSVFVTYPLDLVRVRLAY-VTERHDAKVRKIMACIYNERPSEALRKWYIP 179

Query: 66  ------SRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILS----- 114
                 S  Y+G +  ++   P     F  +D  Q I++       + +P S+LS     
Sbjct: 180 QWFAHWSNFYRGYTPTVIGMIPYAGVSFFAHDLCQDIFR-----HPMLEPYSVLSPGGSS 234

Query: 115 ----------------GASAGICESFVVVPFELVKIRLQ-----DVSSKFTSPIAVVKNI 153
                           G  AG+       PFE+++ RLQ     D + +    I  +  I
Sbjct: 235 AYDRTVPLKTWAQLVAGGLAGMASQTAAYPFEIIRRRLQVSAITDPTRRHFVGINEIAKI 294

Query: 154 VEKEG 158
           +  EG
Sbjct: 295 IYTEG 299

 Score = 30.4 bits (67), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 40/85 (47%), Gaps = 5/85 (5%)

Query: 6   PLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGP---QYKGVFDCLKQIAAK 62
           PL    Q +AG +AG++     YP ++++   +LQVS  + P    + G+ +  K I  +
Sbjct: 241 PLKTWAQLVAGGLAGMASQTAAYPFEIIRR--RLQVSAITDPTRRHFVGINEIAKIIYTE 298

Query: 63  EGPSRLYKGISSPILMEAPKRATKF 87
            G    + G+S   +   P  A  F
Sbjct: 299 GGWRGFFVGLSIGYIKVTPMVACSF 323

>KLLA0D09889g complement(834904..835998) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, start by similarity
          Length = 364

 Score = 72.8 bits (177), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 74/285 (25%), Positives = 124/285 (43%), Gaps = 36/285 (12%)

Query: 26  VMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSR-LYKGISSPILMEAPKRA 84
            M+ LD VKT  Q      S  +YK +    + I  +EG  + LY G S  +L   P  A
Sbjct: 72  AMHSLDTVKTRQQ---GAPSTVKYKNMIGAYRTIILEEGLRKGLYGGYSGAMLGSFPSAA 128

Query: 85  TKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAG-ICESFVVVPFELVKIRLQDVSSKF 143
             FA    ++   + + G   + +  S L+    G    SFV VP E++K RLQ +  ++
Sbjct: 129 IFFAT---YEYTKRKMIGEWGINETFSHLTAGFLGDFISSFVYVPSEVLKTRLQ-LQGRY 184

Query: 144 TSPI-----------AVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIFQVRALLP 192
            +P              V  IV +EG   ++ G ++T+ R   ++   F    + R L  
Sbjct: 185 NNPFFRSGYNYKNLTDAVTTIVRREGWPTLFFGYKATLSRDLPFSGLQFAFYEKFRQLAF 244

Query: 193 KASTKSEQT----RNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRK------- 241
               K+        N+++ G   G L+ +++TP DVVK+R+Q    +P +P         
Sbjct: 245 AVENKTFDEDLSLSNEIITGAAAGGLAGIITTPLDVVKTRIQTQ--LPDIPENSSQNLKQ 302

Query: 242 ---YNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVF 283
               N     + T+YK EG   L+ G  P+ +       I+L+++
Sbjct: 303 QTLTNSITKGMMTVYKTEGLAGLFSGVGPRFIWTSIQSSIMLLLY 347

>AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH]
           complement(164665..165762) [1098 bp, 365 aa]
          Length = 365

 Score = 72.8 bits (177), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 70/297 (23%), Positives = 126/297 (42%), Gaps = 56/297 (18%)

Query: 29  PLDMVKTVMQ---------LQVSGGSGPQYKGVFD------CLKQIAAKEGPSRLYKGIS 73
           P D+VKT +Q          Q +  +   Y+G+         ++ +  +EG   L+KG+ 
Sbjct: 69  PFDVVKTRLQSDVFHGAYKTQATARTNVVYQGLMHFRETVGIIQNVYTQEGFRSLFKGLG 128

Query: 74  SPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESFVVVPFELVK 133
             ++   P R+  F      +     L    +    +  L+GA+AG   S    P  LVK
Sbjct: 129 PNLVGVIPARSINFFTYGVTKDTASRLLNDGQEAPWIHFLAGATAGWATSTATNPIWLVK 188

Query: 134 IRLQ------DVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFG----- 182
            RLQ        S ++ +    +K ++  EGIL +Y GL          +A Y G     
Sbjct: 189 TRLQLDKAADGRSRRYKNSWDCLKGVMRNEGILGLYKGL----------SASYLGSVESI 238

Query: 183 ----IIFQVRALLPKASTK-----SEQTRNDLL--------AGTVGGT--LSSLLSTPFD 223
               +  Q++ ++ + S +     SE+ +   +        +G+ G     +S+L+ P +
Sbjct: 239 LQWVLYEQMKHIIRQRSIEEFGDISEENKTTYMKVKEWCQRSGSAGAAKLFASILTYPHE 298

Query: 224 VVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILL 280
           VV++R++      G   KY   + + + I KEEGF ++Y G  P ++R  P   I+ 
Sbjct: 299 VVRTRLRQAPKENG-KLKYTGLFQSFSLIIKEEGFASMYSGLTPHLMRTVPNSIIMF 354

 Score = 67.8 bits (164), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 53/191 (27%), Positives = 91/191 (47%), Gaps = 20/191 (10%)

Query: 1   MSDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQL-QVSGGSGPQYKGVFDCLKQI 59
           ++D +  P+++ F+AGA AG +      P+ +VKT +QL + + G   +YK  +DCLK +
Sbjct: 156 LNDGQEAPWIH-FLAGATAGWATSTATNPIWLVKTRLQLDKAADGRSRRYKNSWDCLKGV 214

Query: 60  AAKEGPSRLYKGISSP-----------ILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQ 108
              EG   LYKG+S+            +L E  K   +    +EF  I ++        +
Sbjct: 215 MRNEGILGLYKGLSASYLGSVESILQWVLYEQMKHIIRQRSIEEFGDISEENKTTYMKVK 274

Query: 109 PLSILSGA--SAGICESFVVVPFELVKIRLQDVSS-----KFTSPIAVVKNIVEKEGILA 161
                SG+  +A +  S +  P E+V+ RL+         K+T        I+++EG  +
Sbjct: 275 EWCQRSGSAGAAKLFASILTYPHEVVRTRLRQAPKENGKLKYTGLFQSFSLIIKEEGFAS 334

Query: 162 MYNGLESTMWR 172
           MY+GL   + R
Sbjct: 335 MYSGLTPHLMR 345

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/177 (25%), Positives = 70/177 (39%), Gaps = 43/177 (24%)

Query: 126 VVPFELVKIRLQ-DVSS-------------------KFTSPIAVVKNIVEKEGILAMYNG 165
             PF++VK RLQ DV                      F   + +++N+  +EG  +++ G
Sbjct: 67  TCPFDVVKTRLQSDVFHGAYKTQATARTNVVYQGLMHFRETVGIIQNVYTQEGFRSLFKG 126

Query: 166 LESTMWRHGIWNAGYFGIIFQVRAL--LPKASTKSEQTR--ND--------LLAGTVGGT 213
           L   +           G+I   R++       TK   +R  ND         LAG   G 
Sbjct: 127 LGPNL----------VGVI-PARSINFFTYGVTKDTASRLLNDGQEAPWIHFLAGATAGW 175

Query: 214 LSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVL 270
            +S  + P  +VK+R+Q      G  R+Y  SW  L  + + EG   LYKG     L
Sbjct: 176 ATSTATNPIWLVKTRLQLDKAADGRSRRYKNSWDCLKGVMRNEGILGLYKGLSASYL 232

 Score = 32.0 bits (71), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 34/73 (46%), Gaps = 1/73 (1%)

Query: 15  AGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGISS 74
           AGA    + IL  YP ++V+T ++         +Y G+F     I  +EG + +Y G++ 
Sbjct: 283 AGAAKLFASILT-YPHEVVRTRLRQAPKENGKLKYTGLFQSFSLIIKEEGFASMYSGLTP 341

Query: 75  PILMEAPKRATKF 87
            ++   P     F
Sbjct: 342 HLMRTVPNSIIMF 354

>Sklu_2442.8 YNL003C, Contig c2442 12309-13136
          Length = 275

 Score = 72.0 bits (175), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 83/298 (27%), Positives = 134/298 (44%), Gaps = 54/298 (18%)

Query: 9   FVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGG--SGPQYKGVFDCLKQIAAKEGPS 66
           F+    +GA AG S  L  +P+D +KT  +LQ  GG  +   YKGV              
Sbjct: 6   FLVSLASGAAAGTSTDLAFFPIDTLKT--RLQAKGGFFANGGYKGV-------------- 49

Query: 67  RLYKGISSPILMEAPKRATKFACNDEFQKIY------KDLFGAEKLTQPLSILSGASAG- 119
             Y+G+ S ++  AP  +  F   D   K+Y      K +    ++   LS +  +S G 
Sbjct: 50  --YRGLGSAVIASAPSASLFFVSYDSM-KVYSKPVISKYVTSNNQMADTLSHMFSSSIGE 106

Query: 120 ICESFVVVPFELVKIRLQ--DVSSKFTSPIAVVKNIVEKEGIL-AMYNGLESTMWRHGIW 176
           +    V VP E++K R Q    +S + +   +++N    EG+L  +Y G  +T+ R    
Sbjct: 107 VSACLVRVPAEVIKQRTQTHKTNSSWQTFTKILQN-ENGEGVLRNLYRGWNTTIMRE--- 162

Query: 177 NAGYFGIIFQVRALLPKASTKSEQTRNDLLA-------GTVGGTLSSLLSTPFDVVKSRV 229
              +  I F +   L K  T +++   D +A       G+V G +++  +TP DV+K+R+
Sbjct: 163 -IPFTCIQFPLYEFLKK--TWAKRNGQDHVAPWQGSVCGSVAGAIAAATTTPLDVLKTRL 219

Query: 230 Q-NTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGV 286
             +   IP      N        IY EEGFK  + G  P+ + +  GG I L V+  V
Sbjct: 220 MLSHKSIPVAQLAKN--------IYAEEGFKVFFSGVGPRTMWISAGGAIFLGVYETV 269

>Scas_721.129
          Length = 323

 Score = 72.0 bits (175), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 93/203 (45%), Gaps = 15/203 (7%)

Query: 103 AEKLTQPLSILSGASAGICESFVVVPFELVKIRLQ------DVSSK-FTSPIAVVKNIVE 155
           A+K+++  S ++G  A         P ELVKIR+Q       V  K + +PI  +  I  
Sbjct: 16  AQKVSKFGSFIAGGMAACIAVTFTNPIELVKIRMQLQGELAAVGQKVYRNPIQGMGVIFR 75

Query: 156 KEGILAMYNGLESTMWRHGIWNAGYFGIIFQVRALLP------KASTKSEQTRNDLLAGT 209
            EGI  +  GL +        N    G    +R  L       + S K ++   ++ AG 
Sbjct: 76  NEGIRGLQKGLVAAYIYQIGLNGSRLGFYEPIRNALNSTFYPNEESHKIQKVSINVAAGA 135

Query: 210 VGGTLSSLLSTPFDVVKSRVQN--TAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVP 267
             G + +++ +P  +VK+R+Q+   A+  G    Y   W  L+TI + EGFK L++G   
Sbjct: 136 SSGIIGAVIGSPLFLVKTRMQSYSDAIKIGEQTHYRNVWNGLSTIARTEGFKGLFRGIDA 195

Query: 268 KVLRLGPGGGILLVVFTGVMDFF 290
            +LR G G  + L ++    +F 
Sbjct: 196 AILRTGAGSSVQLPIYNTAKNFL 218

 Score = 70.9 bits (172), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 66/296 (22%), Positives = 120/296 (40%), Gaps = 20/296 (6%)

Query: 13  FMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQ--YKGVFDCLKQIAAKEGPSRLYK 70
           F+AG +A    +    P+++VK  MQLQ    +  Q  Y+     +  I   EG   L K
Sbjct: 25  FIAGGMAACIAVTFTNPIELVKIRMQLQGELAAVGQKVYRNPIQGMGVIFRNEGIRGLQK 84

Query: 71  GISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQ-----PLSILSGASAGICESFV 125
           G+ +  + +     ++    +  +      F   + +       +++ +GAS+GI  + +
Sbjct: 85  GLVAAYIYQIGLNGSRLGFYEPIRNALNSTFYPNEESHKIQKVSINVAAGASSGIIGAVI 144

Query: 126 VVPFELVKIRLQDVS--------SKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWN 177
             P  LVK R+Q  S        + + +    +  I   EG   ++ G+++ + R G  +
Sbjct: 145 GSPLFLVKTRMQSYSDAIKIGEQTHYRNVWNGLSTIARTEGFKGLFRGIDAAILRTGAGS 204

Query: 178 AGYFGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPG 237
           +    I    +  L K     +     L A T+ G   +++  P+DV+ +R+ N      
Sbjct: 205 SVQLPIYNTAKNFLLKNDLMKDGPGLHLTASTISGLGVAVVMNPWDVILTRIYNQK---- 260

Query: 238 VPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFFRTV 293
               Y           + EG  ALYKGF  ++LR+ P   I L      M    +V
Sbjct: 261 -GNLYKGPVDCFVKTVRTEGISALYKGFQAQILRIAPHTIICLTFMEQTMKLVYSV 315

>Scas_562.12
          Length = 300

 Score = 71.6 bits (174), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 75/295 (25%), Positives = 123/295 (41%), Gaps = 41/295 (13%)

Query: 2   SDQKPLPFVYQFMAGAVAGVSEILVMYPLDMV-KTVMQLQVSGGSGPQYKGV-------- 52
           S+ +    V + +  A AG+ EI V +P+D + K +M      G+  +   V        
Sbjct: 3   SNDRKQSGVARLLGSASAGILEIGVFHPVDTISKRLMSNHTKIGNSHELNRVIFREHFSE 62

Query: 53  ---------FDCLKQIAAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGA 103
                    F  L   A+ +   R+YK    P        A +F  N  ++K +   FG 
Sbjct: 63  PLGKRLFTLFPGLGYAASYKVLQRVYKYGGQPF-------ANEF-LNKHYKKDFDSAFGE 114

Query: 104 EKLTQPLSILSGASAGICESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMY 163
           +      S  +G+  GI E  V++P +++KI+ Q     F     V   I++ EGI  +Y
Sbjct: 115 KTGKAMRSATAGSLIGIGE-IVLLPLDVLKIKRQTNPEAFKGRGFV--KILKDEGIFNLY 171

Query: 164 NGLESTMWRHGIWNAGYFG-IIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPF 222
            G   T  R+   +   FG   F    +L            + ++  VG + S ++S P 
Sbjct: 172 RGWGWTAARNAPGSFALFGGNAFAKEYILGLEDYSQASWSQNFISSIVGASCSLIVSAPL 231

Query: 223 DVVKSRVQNTAVIPGVPRKYNWSWPALATI---YKEEGFKALYKGFVPKVLRLGP 274
           DV+K+R+QN        R ++     L  +   +K EG  A +KG  PK+L  GP
Sbjct: 232 DVIKTRIQN--------RSFDNPETGLTIVKNTFKNEGITAFFKGLTPKLLTTGP 278

 Score = 31.2 bits (69), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 38/88 (43%), Gaps = 4/88 (4%)

Query: 1   MSDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIA 60
           + D     +   F++  V     ++V  PLD++KT  ++Q      P+       +K   
Sbjct: 202 LEDYSQASWSQNFISSIVGASCSLIVSAPLDVIKT--RIQNRSFDNPETG--LTIVKNTF 257

Query: 61  AKEGPSRLYKGISSPILMEAPKRATKFA 88
             EG +  +KG++  +L   PK    FA
Sbjct: 258 KNEGITAFFKGLTPKLLTTGPKLVFSFA 285

>AAL014C [173] [Homologous to ScYNL003C (PET8) - SH]
           (317388..318203) [816 bp, 271 aa]
          Length = 271

 Score = 70.9 bits (172), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 73/298 (24%), Positives = 135/298 (45%), Gaps = 47/298 (15%)

Query: 9   FVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGG--SGPQYKGVFDCLKQIAAKEGPS 66
           F+   ++GA AG S  +V +P+D +KT  +LQ  GG      Y+G+              
Sbjct: 5   FLASLVSGAAAGTSTDVVFFPIDTLKT--RLQAKGGFFHNGGYRGI-------------- 48

Query: 67  RLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFG----AEKLTQPLSILSGASAG-IC 121
             Y+G+ S ++  AP  +  F   D  ++  + + G    +E+L + L+ +  +S G + 
Sbjct: 49  --YRGLGSAVVASAPGASLFFVTYDSMKQQLRPVMGRWTASEQLAEVLTHMLSSSLGEMS 106

Query: 122 ESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEK---EGIL-AMYNGLESTMWRHGIWN 177
              V VP E++K R Q  +    S +  ++ I+     EG++  +Y G  +T+ R   + 
Sbjct: 107 ACLVRVPAEVIKQRTQ--THHTNSSLQTLRLILRDPTGEGVVRGLYRGWWTTIMREIPFT 164

Query: 178 AGYFGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLST----PFDVVKSRVQ-NT 232
              F +      L  K +  +E  R     G V G+L+  ++     P DV+K+R+  + 
Sbjct: 165 CIQFPLY---EYLKKKWAAYAEIERVSAWQGAVCGSLAGGIAAAATTPLDVLKTRMMLHE 221

Query: 233 AVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFF 290
             +P +            T+++EEG +  ++G  P+ + +  GG I L V+  V   F
Sbjct: 222 RRVPMLH--------LARTLFREEGARVFFRGIGPRTMWISAGGAIFLGVYEAVHSLF 271

 Score = 31.2 bits (69), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 19/90 (21%), Positives = 36/90 (40%), Gaps = 17/90 (18%)

Query: 204 DLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYK 263
            L++G   GT + ++  P D +K+R+Q                 A    +   G++ +Y+
Sbjct: 8   SLVSGAAAGTSTDVVFFPIDTLKTRLQ-----------------AKGGFFHNGGYRGIYR 50

Query: 264 GFVPKVLRLGPGGGILLVVFTGVMDFFRTV 293
           G    V+   PG  +  V +  +    R V
Sbjct: 51  GLGSAVVASAPGASLFFVTYDSMKQQLRPV 80

>YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiamine
           pyrophosphate transporter, controls import of thiamine
           pyrophosphate during growth on fermentative carbon
           sources, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 71.2 bits (173), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 67/272 (24%), Positives = 122/272 (44%), Gaps = 22/272 (8%)

Query: 13  FMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGI 72
            +AGAV+G+    +  P+D +K  +QL  + G  P    V +  + +   EG    +KG 
Sbjct: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGN 79

Query: 73  SSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESFVVVPFELV 132
               L+     + +F+    F + Y   FG E     L +  GA AGI  S V  PF+++
Sbjct: 80  IPGSLLYVTYGSAQFSSYSLFNR-YLTPFGLEARLHSLVV--GAFAGITSSIVSYPFDVL 136

Query: 133 KIRLQDVSSKFTSPIAV-VKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIFQVRALL 191
           + RL   +   +  I   V++I + EG+   + G  ++M    +  +  FG    +R   
Sbjct: 137 RTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIRIYC 196

Query: 192 PK------ASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQ-----------NTAV 234
            +      A  K E    +  AGT+GG ++ +++ P + ++ R+Q             + 
Sbjct: 197 DENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSS 256

Query: 235 IPGVPRKYNWSWPALATIYKEEGFKALYKGFV 266
           + G  + Y ++   L  I K+EG  +LY+G +
Sbjct: 257 VYGSYKGYGFARIGLQ-ILKQEGVSSLYRGIL 287

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 77/167 (46%), Gaps = 18/167 (10%)

Query: 111 SILSGASAGICESFVVVPFELVKIRLQDVSSKFTSP-----IAVVKNIVEKEGILAMYNG 165
           ++L+GA +G+    +  P + +KIRLQ   +    P     + V +++++ EGI + + G
Sbjct: 19  TLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKG 78

Query: 166 -LESTMWRHGIWNAGYFGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDV 224
            +  ++      +A +       R L P      E   + L+ G   G  SS++S PFDV
Sbjct: 79  NIPGSLLYVTYGSAQFSSYSLFNRYLTPFG---LEARLHSLVVGAFAGITSSIVSYPFDV 135

Query: 225 VKSRV--QNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKV 269
           +++R+   N      + R+       +  I+K EG    +KG +  +
Sbjct: 136 LRTRLVANNQMHSMSITRE-------VRDIWKLEGLPGFFKGSIASM 175

 Score = 35.0 bits (79), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 40/181 (22%), Positives = 76/181 (41%), Gaps = 31/181 (17%)

Query: 10  VYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLY 69
           ++  + GA AG++  +V YP D+++T +       S    + V D  K     EG    +
Sbjct: 113 LHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKL----EGLPGFF 168

Query: 70  KGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQP--------LSILSGASAGIC 121
           KG  + +       +  F   +   +IY D    EK T          L+  +G   G+ 
Sbjct: 169 KGSIASMTTITLTASIMFGTYETI-RIYCD--ENEKTTAAHKKWELATLNHSAGTIGGVI 225

Query: 122 ESFVVVPFELVKIRLQDVSS----KFTSPIAVVKN------------IVEKEGILAMYNG 165
              +  P E ++ R+Q ++S    KF+   +V  +            I+++EG+ ++Y G
Sbjct: 226 AKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRG 285

Query: 166 L 166
           +
Sbjct: 286 I 286

>Scas_714.18
          Length = 305

 Score = 70.9 bits (172), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 66/299 (22%), Positives = 117/299 (39%), Gaps = 42/299 (14%)

Query: 12  QFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSR-LYK 70
           + +AG++AG     + YP D VK  +Q Q        +   + C+K     EG     Y+
Sbjct: 15  EILAGSIAGAIGKFIEYPFDTVKVRLQTQ----EAYMFPSTWSCIKYTYENEGILEGFYQ 70

Query: 71  GISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESFVVVPFE 130
           GI SP++  A + A  F   ++           E     + ++S   AG C SFV+ P E
Sbjct: 71  GIESPLIGAALENAILFLAYNQCSSFLNAF--TEFSAFLIILISAGFAGSCASFVLTPVE 128

Query: 131 LVKIRLQDVS--------------------------SKFTSPIAVVKNIVEKEGILAMYN 164
           L+K +LQ  +                           + T  I  +K+I++++G+  ++ 
Sbjct: 129 LIKCKLQISNLHYSLHDNDGEQQDEEDEDQGMVIGEGRHTRIIPTIKSIIKEKGLFGLWQ 188

Query: 165 GLESTMWRHGIWNAGYFGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDV 224
           G  ST  R  I +  +F     ++  L    ++   T   L++G   G   +    P D 
Sbjct: 189 GQSSTFIRESIGSVVWFATYELMKQTLRDPKSEVNTTWQLLISGATAGLAFNGSVFPADT 248

Query: 225 VKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVF 283
           VKS +Q   +              + +I + +G    Y+G    +LR  P    +   +
Sbjct: 249 VKSIMQTEHLAL---------METVRSILERDGVAGFYRGLGITLLRAVPSNAAVFYTY 298

>Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement
          Length = 310

 Score = 70.9 bits (172), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 69/302 (22%), Positives = 134/302 (44%), Gaps = 31/302 (10%)

Query: 8   PFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSR 67
           P   + ++G  AG    +  +PLD+VK  +QL ++    PQ  G +D +K+I        
Sbjct: 7   PVQKEMISGLTAGTITTVSTHPLDLVKVRLQL-LATNKKPQ--GYYDVVKRIVKDSKQHS 63

Query: 68  L----YKGISSPILMEAPK--------RATK---FA-CNDEFQKIYKDLFGAEKLTQPLS 111
                Y+G+   +L  +          RA+K   F  CN + ++    +   +++T  + 
Sbjct: 64  FFRETYRGLGVNLLGNSVAWGLYFGLYRASKDWVFQWCNTDVKRFNNTMNNDKEMTSLMY 123

Query: 112 ILSGASAGICESFVVVPFELVKIRLQDVS----SKFTSPIAVVKNIVEKEGILAMYNGLE 167
           +L+ A +G+  S +  P  ++K R+   S      + S +  +K +   EG+   + GL 
Sbjct: 124 LLAAAMSGVATSVLTNPIWVIKTRIMSTSFVDSRSYRSTVDGIKKLYRIEGLAGFWRGLV 183

Query: 168 STMWRHGIWN-AGYFGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLST----PF 222
            +++  G+   A YF +   ++     A    ++ +   L      +LS ++S     P 
Sbjct: 184 PSLF--GVSQGAIYFTVYDTLKYHYFAAKHVDKKKKLSNLEYITITSLSKMVSVTAVYPL 241

Query: 223 DVVKSRVQNTAVIPGV-PRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLV 281
            ++KS +Q+  V   + P+  +  W  + TIY  +G   LYKG +  ++R  P   I   
Sbjct: 242 QLLKSNLQSFEVSTVINPKTSHRVWKLITTIYVRDGVTGLYKGLLANLIRAVPSTCITFC 301

Query: 282 VF 283
           V+
Sbjct: 302 VY 303

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/182 (21%), Positives = 84/182 (46%), Gaps = 12/182 (6%)

Query: 1   MSDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIA 60
           M++ K +  +   +A A++GV+  ++  P+ ++KT + +  S      Y+   D +K++ 
Sbjct: 112 MNNDKEMTSLMYLLAAAMSGVATSVLTNPIWVIKTRI-MSTSFVDSRSYRSTVDGIKKLY 170

Query: 61  AKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIY---KDLFGAEKLTQPLSILSGAS 117
             EG +  ++G+  P L    + A  F   D  +  Y   K +   +KL+    I   + 
Sbjct: 171 RIEGLAGFWRGL-VPSLFGVSQGAIYFTVYDTLKYHYFAAKHVDKKKKLSNLEYITITSL 229

Query: 118 AGICESFVVVPFELVKIRLQ--DVSSKFTSPIA-----VVKNIVEKEGILAMYNGLESTM 170
           + +     V P +L+K  LQ  +VS+      +     ++  I  ++G+  +Y GL + +
Sbjct: 230 SKMVSVTAVYPLQLLKSNLQSFEVSTVINPKTSHRVWKLITTIYVRDGVTGLYKGLLANL 289

Query: 171 WR 172
            R
Sbjct: 290 IR 291

>Kwal_26.7972
          Length = 358

 Score = 71.2 bits (173), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 67/308 (21%), Positives = 121/308 (39%), Gaps = 55/308 (17%)

Query: 14  MAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQY-------KGVFDCLKQIAAKEGPS 66
           +AG +AG     ++ PLD +K + Q      S P Y        G+      I A +G  
Sbjct: 32  LAGGIAGSCAKTLIAPLDRIKILFQT-----SNPHYLKYSGSTMGLIRAGAHINAHDGIR 86

Query: 67  RLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESFVV 126
             Y+G S+ ++   P  A KF   ++ +     +   E  T    + SG+ AG+C  F+ 
Sbjct: 87  GFYQGHSATLIRIFPYAAIKFIAYEQIRHFM--IPSKEYETHARRLASGSMAGLCSVFMT 144

Query: 127 VPFELVKIRLQDVSSKFT-SPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIF 185
            P +L+++RL  V+ +     + V+K I  +    ++ +      W    W   Y G   
Sbjct: 145 YPLDLIRVRLAYVTDRSRIKMLPVIKQIYTERASESLTSKSYVPRW-FAHWCNFYRGFTP 203

Query: 186 QVRALLP---------------------------------------KASTKSEQTRNDLL 206
            V  ++P                                       K S++  +T  +L+
Sbjct: 204 TVLGMIPYAGVSFFAHDLCGDILRSGALSPYSVLPISDEELTIRSKKQSSRPLKTWAELV 263

Query: 207 AGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFV 266
           AG + G  S   S PF++++ R+Q + V P     +      +  IYKE G++  + G  
Sbjct: 264 AGGLAGMASQTASYPFEIIRRRLQVSVVSPTSIHNFQTIPDMIRIIYKERGWRGFFVGLS 323

Query: 267 PKVLRLGP 274
              +++ P
Sbjct: 324 IGYIKVTP 331

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/204 (22%), Positives = 83/204 (40%), Gaps = 31/204 (15%)

Query: 113 LSGASAGICESFVVVPFELVKIRLQDVSSKFT----SPIAVVK---NIVEKEGILAMYNG 165
           L+G  AG C   ++ P + +KI  Q  +  +     S + +++   +I   +GI   Y G
Sbjct: 32  LAGGIAGSCAKTLIAPLDRIKILFQTSNPHYLKYSGSTMGLIRAGAHINAHDGIRGFYQG 91

Query: 166 LESTMWRHGIWNAGYFGIIFQVRA-LLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDV 224
             +T+ R   + A  F    Q+R  ++P    ++   R  L +G++ G  S  ++ P D+
Sbjct: 92  HSATLIRIFPYAAIKFIAYEQIRHFMIPSKEYETHARR--LASGSMAGLCSVFMTYPLDL 149

Query: 225 VKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKAL----------------YKGFVPK 268
           ++ R+          R      P +  IY E   ++L                Y+GF P 
Sbjct: 150 IRVRLAYV-----TDRSRIKMLPVIKQIYTERASESLTSKSYVPRWFAHWCNFYRGFTPT 204

Query: 269 VLRLGPGGGILLVVFTGVMDFFRT 292
           VL + P  G+         D  R+
Sbjct: 205 VLGMIPYAGVSFFAHDLCGDILRS 228

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 41/84 (48%), Gaps = 1/84 (1%)

Query: 5   KPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQ-VSGGSGPQYKGVFDCLKQIAAKE 63
           +PL    + +AG +AG++     YP ++++  +Q+  VS  S   ++ + D ++ I  + 
Sbjct: 254 RPLKTWAELVAGGLAGMASQTASYPFEIIRRRLQVSVVSPTSIHNFQTIPDMIRIIYKER 313

Query: 64  GPSRLYKGISSPILMEAPKRATKF 87
           G    + G+S   +   P  A  F
Sbjct: 314 GWRGFFVGLSIGYIKVTPMVACSF 337

>YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses loss of Abf2p
           [903 bp, 300 aa]
          Length = 300

 Score = 70.5 bits (171), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 70/278 (25%), Positives = 118/278 (42%), Gaps = 27/278 (9%)

Query: 12  QFMAGAVAGVSEILVMYPLDMV-KTVMQLQVSGGSGPQYKGVF--DCLKQIAAKEGPSRL 68
           + +  A AG+ EI V +P+D + K +M       SG +   V   D   +   K   + L
Sbjct: 13  RLLGSASAGIMEIAVFHPVDTISKRLMSNHTKITSGQELNRVIFRDHFSEPLGKRLFT-L 71

Query: 69  YKGISSPILMEAPKRATKFA--------CNDEFQKIYKDLFGAEKLTQPLSILSGASAGI 120
           + G+      +  +R  K+          N  ++K + +LFG +      S  +G+  GI
Sbjct: 72  FPGLGYAASYKVLQRVYKYGGQPFANEFLNKHYKKDFDNLFGEKTGKAMRSAAAGSLIGI 131

Query: 121 CESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGY 180
            E  V++P +++KI+ Q     F     +   I+  EG+  +Y G   T  R+   +   
Sbjct: 132 GE-IVLLPLDVLKIKRQTNPESFKGRGFI--KILRDEGLFNLYRGWGWTAARNAPGSFAL 188

Query: 181 FG-IIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVP 239
           FG   F    +L            + ++  VG   S ++S P DV+K+R+QN        
Sbjct: 189 FGGNAFAKEYILGLKDYSQATWSQNFISSIVGACSSLIVSAPLDVIKTRIQN-------- 240

Query: 240 RKYNWSWPALATI---YKEEGFKALYKGFVPKVLRLGP 274
           R ++     L  +    K EG  A +KG  PK+L  GP
Sbjct: 241 RNFDNPESGLRIVKNTLKNEGVTAFFKGLTPKLLTTGP 278

 Score = 34.3 bits (77), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 40/88 (45%), Gaps = 4/88 (4%)

Query: 1   MSDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIA 60
           + D     +   F++  V   S ++V  PLD++KT +Q +         + V + LK   
Sbjct: 202 LKDYSQATWSQNFISSIVGACSSLIVSAPLDVIKTRIQNRNFDNPESGLRIVKNTLKN-- 259

Query: 61  AKEGPSRLYKGISSPILMEAPKRATKFA 88
             EG +  +KG++  +L   PK    FA
Sbjct: 260 --EGVTAFFKGLTPKLLTTGPKLVFSFA 285

>Kwal_27.12081
          Length = 369

 Score = 70.5 bits (171), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 78/330 (23%), Positives = 140/330 (42%), Gaps = 56/330 (16%)

Query: 8   PFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGP----------------QYKG 51
           P+V+ F+AG   G++  +V  P D+VKT +Q  V   +                   ++ 
Sbjct: 52  PWVH-FVAGGAGGMAGAIVTCPFDVVKTRLQSDVFQSTYANLSHNKSSNVVSSGIRHFRE 110

Query: 52  VFDCLKQIAAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLS 111
            F  +  +   EG   L+KG+   ++   P R+  F      ++IY   F   +    + 
Sbjct: 111 TFGIISNLYKLEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKQIYSRAFNNGEEAPWIH 170

Query: 112 ILSGASAGICESFVVVPFELVKIRLQ----DVSSKFTSPIAVVKNIVEKEGILAMYNGLE 167
           ++S A+AG   S    P  L+K RLQ      + ++ +    +K+I++KEG   +Y GL 
Sbjct: 171 LISAATAGWATSTATNPIWLIKTRLQLDKAGHTRQYKNSWDCLKHIIQKEGFFGLYKGL- 229

Query: 168 STMWRHGIWNAGYFG---------IIFQVRALLPKASTK-----SEQTRND--------L 205
                    +A Y G         +  Q++ ++   S +     SE  +N          
Sbjct: 230 ---------SASYLGSVEGILQWLLYEQMKQMIKMRSIEKFGHISEGEKNTSEKIKEWCQ 280

Query: 206 LAGTVGGT--LSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYK 263
            +G+ G    L+S+++ P +VV++R++  A +     KY     +   I KEEG  ++Y 
Sbjct: 281 RSGSAGLAKFLASIVTYPHEVVRTRLRQ-APLENDKLKYTGLIQSFRVIIKEEGLASMYG 339

Query: 264 GFVPKVLRLGPGGGILLVVFTGVMDFFRTV 293
           G  P +LR  P   I+   +  V+     V
Sbjct: 340 GLTPHLLRTVPNSIIMFGTWELVIKLLSDV 369

>Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement
          Length = 302

 Score = 69.7 bits (169), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 70/292 (23%), Positives = 125/292 (42%), Gaps = 32/292 (10%)

Query: 1   MSDQKPLP------FVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQ-YKGVF 53
           MS ++P+P      +    + G VA       + PLD+VK  +Q+       PQ Y+   
Sbjct: 1   MSTKQPIPLFSPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVN------PQLYRSNL 54

Query: 54  DCLKQIAAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFG---AEKLTQPL 110
           D  K I   EG S+++ G+ +  +  + + A K+   + F++ Y +L     A +    +
Sbjct: 55  DGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAV 114

Query: 111 SILSGASAGICESFVVVPFELVKIRLQDVSSKFTSP-IAVVKNIVEKEGILAMYNGLEST 169
            + + ASA      ++ P+E +K++ Q     F    +     I   EG+  +Y G+   
Sbjct: 115 YLCASASAEFLADILLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPL 174

Query: 170 MWRHGIWNAGYFG----IIFQVRALLPKASTK---SEQTRNDLLAGTVGGTLSSLLSTPF 222
             R   +    F     I+  + A LP++  +   S+Q     + G + G L +++S P 
Sbjct: 175 WCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPA 234

Query: 223 DVVKSRVQNTAVIPGVPRKYNWSW-PALATIYKEEGFKALYKGFVPKVLRLG 273
           DV+ S+V          RK   S   A   IY   GF  L+ G   ++  +G
Sbjct: 235 DVMVSKVN-------ADRKQGESMVEASKRIYSRIGFGGLWNGLPVRIFMIG 279

>Scas_673.17
          Length = 314

 Score = 68.9 bits (167), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 67/271 (24%), Positives = 122/271 (45%), Gaps = 22/271 (8%)

Query: 14  MAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGIS 73
           +AGA+   +    + P+D+VKT +QL+ +       KG+    K+I A EG   L  G  
Sbjct: 25  LAGAIGCGTTHSSLVPVDVVKTRIQLEPT----VYNKGMVGSFKKIIADEGAGALLTGFG 80

Query: 74  SPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICE---SFVVVPFE 130
             +L  + + A KF   + F+K+  D  G E      + +   SA + E      + P E
Sbjct: 81  PTLLGYSVQGAFKFGGYEVFKKLSIDTIGYENAVHYKNSVYMGSAAVAEFLADIALCPLE 140

Query: 131 LVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIFQVRA- 189
             +IRL    +     +     I+++EG+ + Y+G    +++   +N   F ++F+ RA 
Sbjct: 141 ATRIRLVSQPTFANGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIAKF-LVFE-RAS 198

Query: 190 -----LLPKASTKSEQTRN--DLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKY 242
                ++    T S+ T    +LL+G   G  ++ +S P D + S+V  T   PG     
Sbjct: 199 EVYYGIVGAKETLSDMTNTGINLLSGLTAGFAAAFVSQPADTLLSKVNKTKKAPG----- 253

Query: 243 NWSWPALATIYKEEGFKALYKGFVPKVLRLG 273
             +   LA + K+ G    + G   +++ +G
Sbjct: 254 QSTIGLLAQLAKQLGVIGSFAGLPTRLIMVG 284

 Score = 36.6 bits (83), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 35/154 (22%), Positives = 65/154 (42%), Gaps = 11/154 (7%)

Query: 126 VVPFELVKIRLQDVSSKFTSP-IAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFG-- 182
           +VP ++VK R+Q   + +    +   K I+  EG  A+  G   T+  + +  A  FG  
Sbjct: 38  LVPVDVVKTRIQLEPTVYNKGMVGSFKKIIADEGAGALLTGFGPTLLGYSVQGAFKFGGY 97

Query: 183 IIFQVRALLPKASTKSEQTRNDLLAGT--VGGTLSSLLSTPFDVVKSRVQNTAVIPGVPR 240
            +F+  ++       +   +N +  G+  V   L+ +   P +  + R+ +       P 
Sbjct: 98  EVFKKLSIDTIGYENAVHYKNSVYMGSAAVAEFLADIALCPLEATRIRLVSQ------PT 151

Query: 241 KYNWSWPALATIYKEEGFKALYKGFVPKVLRLGP 274
             N      + I KEEG  + Y GF P + +  P
Sbjct: 152 FANGLVGGFSRILKEEGVGSFYSGFTPILFKQIP 185

>Kwal_27.11626
          Length = 299

 Score = 68.9 bits (167), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 73/290 (25%), Positives = 123/290 (42%), Gaps = 30/290 (10%)

Query: 1   MSDQKPLPFVYQFMAGAVAGVSEILVMYPLDMV-KTVMQLQVSGGSGPQYKGVFDCLKQI 59
           MS+ K    + + +  A AG+ EI V +P+D V K +M       S  Q   V    ++ 
Sbjct: 1   MSNDKKQSGIARVLGSASAGILEIGVFHPVDTVSKRLMSNHTKISSSAQLNSV--IFREH 58

Query: 60  AAKEGPSRLYK---GISSPILMEAPKRATKFA--------CNDEFQKIYKDLFGAEKLTQ 108
           A +    RL+    G+      +  +R  K+          N  F+  + + FG +    
Sbjct: 59  AGEALGKRLFTLFPGLGYAASYKILQRVYKYGGQPFANEFLNKNFKADFDNAFGEKTGKA 118

Query: 109 PLSILSGASAGICESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLES 168
             S  +G+  GI E  V++P +++KI+ Q     F     +   I++ EG   +Y G   
Sbjct: 119 LRSATAGSLIGIGE-IVLLPLDVLKIKRQTNPESFKGRGFI--KILKDEG-FGLYRGWGW 174

Query: 169 TMWRHGIWNAGYFG-IIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKS 227
           T  R+   +   FG   F    +L      S     + ++  VG + S ++S P DV+K+
Sbjct: 175 TAARNAPGSFALFGGNAFAKEYILGLKDYSSATWSQNFVSSIVGASASLIVSAPLDVIKT 234

Query: 228 RVQNTAVIPGVPRKYN---WSWPALATIYKEEGFKALYKGFVPKVLRLGP 274
           R+QN        R ++     +  +    K EG  A +KG  PK+L  GP
Sbjct: 235 RIQN--------RHFDNPESGFRIVQNTLKNEGITAFFKGLTPKLLTTGP 276

 Score = 34.3 bits (77), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 23/102 (22%), Positives = 44/102 (43%), Gaps = 4/102 (3%)

Query: 1   MSDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIA 60
           + D     +   F++  V   + ++V  PLD++KT +Q +        ++ V + LK   
Sbjct: 200 LKDYSSATWSQNFVSSIVGASASLIVSAPLDVIKTRIQNRHFDNPESGFRIVQNTLKN-- 257

Query: 61  AKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFG 102
             EG +  +KG++  +L   PK    FA        +  + G
Sbjct: 258 --EGITAFFKGLTPKLLTTGPKLVFSFALAQSLIPAFDKMLG 297

>Scas_697.47
          Length = 328

 Score = 68.9 bits (167), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 75/279 (26%), Positives = 117/279 (41%), Gaps = 26/279 (9%)

Query: 12  QFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRL--- 68
             +AG V GV  +L  +P D++K   Q   SG +      +   LK   A    + L   
Sbjct: 39  SLVAGGVGGVCAVLTGHPFDLIKVRCQ---SGQASSTIHAIKIILKDARAIPTSNMLVNS 95

Query: 69  ----YKGISSPILMEAPKRATKFACNDEFQKIY-KDLFGAEKLTQPLSILSGASAGICES 123
               YKG+  P+L   P  A  F   D  +KI  +    + +LT      +G  + I  +
Sbjct: 96  VKGFYKGVIPPLLGVTPIFAVSFWGYDVGKKIVTRSDSSSAQLTMGQMAAAGFISAIPTT 155

Query: 124 FVVVPFELVKIRLQDV-SSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFG 182
            V  P E +K+ LQ   ++  TS I   KNIV+  G+ +++ G  +T+ R G  +A YF 
Sbjct: 156 LVTAPTERIKVVLQTAGANSKTSFIGAAKNIVKDGGVKSLFKGSLATLARDGPGSALYFA 215

Query: 183 I------IFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIP 236
                      R    ++ T      N  LAG + G    L+  P D +K+++Q+++   
Sbjct: 216 SYEISKKFLNDRNATAESKTGEVNIANVCLAGGIAGMSMWLVVFPIDTIKTKLQSSS--- 272

Query: 237 GVPRKYNWSWPALATIY-KEEGFKALYKGFVPKVLRLGP 274
                      A   IY K  G K  + G  P +LR  P
Sbjct: 273 ----GSQSMVAATREIYVKRGGIKGFFPGLGPALLRSFP 307

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 77/174 (44%), Gaps = 13/174 (7%)

Query: 15  AGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVF-DCLKQIAAKEGPSRLYKGIS 73
           AG ++ +   LV  P + +K V+Q      +G   K  F    K I    G   L+KG  
Sbjct: 146 AGFISAIPTTLVTAPTERIKVVLQT-----AGANSKTSFIGAAKNIVKDGGVKSLFKGSL 200

Query: 74  SPILMEAPKRATKFACNDEFQKIYKDLFG-AEKLTQPLSI----LSGASAGICESFVVVP 128
           + +  + P  A  FA  +  +K   D    AE  T  ++I    L+G  AG+    VV P
Sbjct: 201 ATLARDGPGSALYFASYEISKKFLNDRNATAESKTGEVNIANVCLAGGIAGMSMWLVVFP 260

Query: 129 FELVKIRLQDVSSKFTSPIAVVKNI-VEKEGILAMYNGLESTMWRHGIWNAGYF 181
            + +K +LQ  SS   S +A  + I V++ GI   + GL   + R    NA  F
Sbjct: 261 IDTIKTKLQS-SSGSQSMVAATREIYVKRGGIKGFFPGLGPALLRSFPANAATF 313

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 81/188 (43%), Gaps = 24/188 (12%)

Query: 111 SILSGASAGICESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTM 170
           S+++G   G+C      PF+L+K+R Q  S + +S I  +K I++    +   N L +++
Sbjct: 39  SLVAGGVGGVCAVLTGHPFDLIKVRCQ--SGQASSTIHAIKIILKDARAIPTSNMLVNSV 96

Query: 171 WRHGIWNAGYFGIIFQVRALLP-------------KASTKSEQTRNDLLAG--TVGGTLS 215
                    Y G+I  +  + P             K  T+S+ +   L  G     G +S
Sbjct: 97  ------KGFYKGVIPPLLGVTPIFAVSFWGYDVGKKIVTRSDSSSAQLTMGQMAAAGFIS 150

Query: 216 SLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPG 275
           ++ +T       R++      G   K ++   A   I K+ G K+L+KG +  + R GPG
Sbjct: 151 AIPTTLVTAPTERIKVVLQTAGANSKTSF-IGAAKNIVKDGGVKSLFKGSLATLARDGPG 209

Query: 276 GGILLVVF 283
             +    +
Sbjct: 210 SALYFASY 217

 Score = 35.0 bits (79), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 44/86 (51%), Gaps = 7/86 (8%)

Query: 14  MAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSR-LYKGI 72
           +AG +AG+S  LV++P+D +KT  +LQ S GS    + +    ++I  K G  +  + G+
Sbjct: 245 LAGGIAGMSMWLVVFPIDTIKT--KLQSSSGS----QSMVAATREIYVKRGGIKGFFPGL 298

Query: 73  SSPILMEAPKRATKFACNDEFQKIYK 98
              +L   P  A  F   +    ++K
Sbjct: 299 GPALLRSFPANAATFLGVELTHSLFK 324

>AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH]
           complement(587623..588513) [891 bp, 296 aa]
          Length = 296

 Score = 68.6 bits (166), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 78/285 (27%), Positives = 124/285 (43%), Gaps = 24/285 (8%)

Query: 13  FMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGI 72
           F+AGA AG  E  V YP +  KT +QL    GSG + +     L + A  +G   LY G 
Sbjct: 14  FVAGAAAGAIEGCVTYPFEFAKTRLQL-AQQGSG-ESRNPLVLLYRTARTQGAGALYVGC 71

Query: 73  SSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICES-FVVVPFEL 131
            + ++    K   +F   D  ++  +D  GA  L+ P  +L+G  AG+ ES   V PFE 
Sbjct: 72  PAFVVGNTCKAGVRFLGFDALRRALQDERGA--LSGPRGMLAGLGAGLLESVLAVTPFEA 129

Query: 132 VKIRLQDVSSKFTSP------IAVVKNIVEKEGILAMYNGLESTM---WRHGIWNAGYFG 182
           VK  L D   +   P          +N       L +       +    R     A  FG
Sbjct: 130 VKTALID-DRQAARPRYQHNGRGAARNYALLLRELGLRGLYGGLVPVALRQASNQAVRFG 188

Query: 183 IIFQVRALLPK-ASTKSEQ---TRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGV 238
              Q++  + + A T ++Q   +    L G + G ++   + P D VK+R+Q        
Sbjct: 189 CYTQLKQAVQRYAGTPADQPLGSGQTFLVGALSGIVTVYATMPVDTVKTRMQALDAA--- 245

Query: 239 PRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVF 283
             +Y  +      + +EEG +AL++G  P++ RL   GGI+   +
Sbjct: 246 --RYGSTVGCFRAVVREEGVRALWRGATPRLGRLVLSGGIVFTAY 288

 Score = 36.2 bits (82), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 35/72 (48%), Gaps = 5/72 (6%)

Query: 2   SDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAA 61
           +DQ PL     F+ GA++G+  +    P+D VKT MQ         +Y     C + +  
Sbjct: 205 ADQ-PLGSGQTFLVGALSGIVTVYATMPVDTVKTRMQAL----DAARYGSTVGCFRAVVR 259

Query: 62  KEGPSRLYKGIS 73
           +EG   L++G +
Sbjct: 260 EEGVRALWRGAT 271

>ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH]
           (241532..242521) [990 bp, 329 aa]
          Length = 329

 Score = 68.9 bits (167), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 75/272 (27%), Positives = 118/272 (43%), Gaps = 28/272 (10%)

Query: 15  AGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQI----AAKEGPSRL-- 68
           AGAV GV  +L  +P D++K   Q         Q  G  D +++I     A+ G S +  
Sbjct: 53  AGAVGGVCAVLTGHPFDLLKVRCQSN-------QASGTVDAVRKILVEARAQSGLSAVNM 105

Query: 69  ----YKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESF 124
               YKG+  P+L   P  A  F   D  +K+      + KLT      +G  + I  + 
Sbjct: 106 MRGFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTWNDNSGKLTTAQLATAGFISAIPTTL 165

Query: 125 VVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGII 184
           V+ P E VK+ LQ  S+   S  +  K+I+   G+ +++ G  +T+ R G  +A YF   
Sbjct: 166 VMAPTERVKVVLQTQSNH--SLGSAAKHILATGGVRSLFRGSLATLARDGPGSALYFASY 223

Query: 185 FQVRALLPKASTKSEQT-RNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYN 243
              +A L   S  +E + +N  LAG + G    +   P D +K+ +Q++           
Sbjct: 224 EATKAYLNARSGTNELSIKNVCLAGGMAGVSMWVGVFPIDTIKTELQSS-------NTRQ 276

Query: 244 WSWPALATIYKEE-GFKALYKGFVPKVLRLGP 274
               A   IY    G K  + G  P +LR  P
Sbjct: 277 TMMEATRKIYNTRGGIKGFFPGIGPALLRSFP 308

 Score = 49.7 bits (117), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 69/167 (41%), Gaps = 7/167 (4%)

Query: 15  AGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGISS 74
           AG ++ +   LVM P + VK V+Q Q +   G          K I A  G   L++G  +
Sbjct: 155 AGFISAIPTTLVMAPTERVKVVLQTQSNHSLG-------SAAKHILATGGVRSLFRGSLA 207

Query: 75  PILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESFVVVPFELVKI 134
            +  + P  A  FA  +  +       G  +L+     L+G  AG+     V P + +K 
Sbjct: 208 TLARDGPGSALYFASYEATKAYLNARSGTNELSIKNVCLAGGMAGVSMWVGVFPIDTIKT 267

Query: 135 RLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYF 181
            LQ  +++ T   A  K    + GI   + G+   + R    NA  F
Sbjct: 268 ELQSSNTRQTMMEATRKIYNTRGGIKGFFPGIGPALLRSFPANAATF 314

 Score = 35.0 bits (79), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 40/85 (47%), Gaps = 3/85 (3%)

Query: 192 PKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVP--RKYNWSWPAL 249
           PK++   E  ++ L AG VGG  + L   PFD++K R Q+      V   RK      A 
Sbjct: 39  PKSNALYENAKS-LAAGAVGGVCAVLTGHPFDLLKVRCQSNQASGTVDAVRKILVEARAQ 97

Query: 250 ATIYKEEGFKALYKGFVPKVLRLGP 274
           + +      +  YKG +P +L + P
Sbjct: 98  SGLSAVNMMRGFYKGVIPPLLGVTP 122

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 46/192 (23%), Positives = 76/192 (39%), Gaps = 37/192 (19%)

Query: 111 SILSGASAGICESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTM 170
           S+ +GA  G+C      PF+L+K+R Q   +  T   AV K +VE        +GL +  
Sbjct: 50  SLAAGAVGGVCAVLTGHPFDLLKVRCQSNQASGTVD-AVRKILVEARA----QSGLSAVN 104

Query: 171 WRHGIWNAGYFGIIFQVRALLPKAST--------KSEQTRND----------LLAGTVGG 212
              G     Y G+I  +  + P  +         K   T ND            AG +  
Sbjct: 105 MMRGF----YKGVIPPLLGVTPIFAVSFWGYDVGKKLVTWNDNSGKLTTAQLATAGFISA 160

Query: 213 TLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALA-TIYKEEGFKALYKGFVPKVLR 271
             ++L+  P + VK  +Q          + N S  + A  I    G ++L++G +  + R
Sbjct: 161 IPTTLVMAPTERVKVVLQT---------QSNHSLGSAAKHILATGGVRSLFRGSLATLAR 211

Query: 272 LGPGGGILLVVF 283
            GPG  +    +
Sbjct: 212 DGPGSALYFASY 223

 Score = 28.9 bits (63), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 40/86 (46%), Gaps = 7/86 (8%)

Query: 14  MAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSR-LYKGI 72
           +AG +AGVS  + ++P+D +KT +Q      S    + + +  ++I    G  +  + GI
Sbjct: 246 LAGGMAGVSMWVGVFPIDTIKTELQ------SSNTRQTMMEATRKIYNTRGGIKGFFPGI 299

Query: 73  SSPILMEAPKRATKFACNDEFQKIYK 98
              +L   P  A  F   +    ++K
Sbjct: 300 GPALLRSFPANAATFLGVELTHSLFK 325

>CAGL0G01166g complement(111298..112185) highly similar to tr|Q06143
           Saccharomyces cerevisiae YLR348c DIC1, hypothetical
           start
          Length = 295

 Score = 68.2 bits (165), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 66/279 (23%), Positives = 128/279 (45%), Gaps = 30/279 (10%)

Query: 11  YQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYK 70
           Y +  G  AG+  ++  +PLD+ K  ++LQ +    P    +   L+ I   EG   LY 
Sbjct: 8   YPWWYGGAAGIFAVMNTHPLDLTK--VRLQAAPIPKPT---IVQMLRSILKNEGIVGLYA 62

Query: 71  GISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQ-----PLSILSGASAGICESFV 125
           G+S+ +L +      +F   D  ++    +   +KLT        S++SGA  G+  +F 
Sbjct: 63  GLSASLLRQCTYTTARFGMYDALKE---HVIPRDKLTNMWYLLGASMVSGALGGLAGNFA 119

Query: 126 VVPFELVKIRLQDVSS-------KFTSPIAVVKNIVEKEGILAMY-NGLESTMWRHGIWN 177
               +L+ IR+Q+ S+        + + I  +  I + EG  +++  G +  M R G+  
Sbjct: 120 ----DLINIRMQNDSALPLDKRRNYKNAIDGMVKIYKAEGAKSLFLTGWKPNMVR-GVLM 174

Query: 178 AGYFGIIFQV--RALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVI 235
                + + +    L+ K +   ++    L +  + G +++ + +P DV+K+ V N    
Sbjct: 175 TASQVVTYDMFKNFLVTKYNMDPKKNSTHLTSSLLAGFVATTVCSPADVIKTIVMNAHKK 234

Query: 236 PGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGP 274
           PG    ++ S+  L     +EG   +++G+VP   RL P
Sbjct: 235 PG--HNHDSSFKILMEAINKEGPSFMFRGWVPSFTRLAP 271

 Score = 30.8 bits (68), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 35/84 (41%), Gaps = 1/84 (1%)

Query: 12  QFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKG 71
              +  +AG     V  P D++KT++ +      G  +   F  L +   KEGPS +++G
Sbjct: 203 HLTSSLLAGFVATTVCSPADVIKTIV-MNAHKKPGHNHDSSFKILMEAINKEGPSFMFRG 261

Query: 72  ISSPILMEAPKRATKFACNDEFQK 95
                   AP     F   ++ +K
Sbjct: 262 WVPSFTRLAPFTMLIFFAMEQLKK 285

>CAGL0K02915g 259026..260054 highly similar to sp|P38702
           Saccharomyces cerevisiae YHR002w LEU5, hypothetical
           start
          Length = 342

 Score = 68.2 bits (165), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 71/324 (21%), Positives = 135/324 (41%), Gaps = 62/324 (19%)

Query: 3   DQKPLPFVYQF-MAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYK-------GVFD 54
           D+  L +V +  +AG V+G     ++ PLD +K + Q      S P Y        G+++
Sbjct: 11  DKNSLDYVVRSGLAGGVSGSCAKTLIAPLDRIKILFQ-----TSNPHYSKYAGSLVGLYE 65

Query: 55  CLKQIAAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILS 114
             K I   +G    ++G S  +L   P  A KF   ++ + I   +   E  +    + S
Sbjct: 66  AAKHIWINDGIRGFFQGHSVTLLRIFPYAAVKFVAYEQIRSIL--IPSREYESHWRRLAS 123

Query: 115 GASAGICESFVVVPFELVKIRLQDVS-SKFTSPIAVVKNIVEKEGILAMYNGLESTMWRH 173
           G+ AG+C  F+  P +L ++RL  V+  K      +VK I  +     + + L    W  
Sbjct: 124 GSLAGLCSVFITYPLDLTRVRLAYVTEHKRVKLRDIVKTIYHEPASEGLTSHLLVPKW-F 182

Query: 174 GIWNAGYFGIIFQVRALLPKA---------------------------STKSEQTRN--- 203
             W   Y G +  V  ++P A                           S++ E  R    
Sbjct: 183 AHWCNFYRGYVPTVLGMIPYAGVSFFAHDLIHDIMKSSLMAPYAVKQLSSQEELERKKLR 242

Query: 204 ---------DLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALAT--- 251
                    +L+AG + G LS   + P ++++ R+Q + + P   + Y+  + ++++   
Sbjct: 243 QKTPLRTWAELVAGGLSGILSQTAAYPLEIIRRRLQVSTLSP--RKMYDHKFQSISSIAR 300

Query: 252 -IYKEEGFKALYKGFVPKVLRLGP 274
            IY+E+G++  + G     +++ P
Sbjct: 301 IIYQEKGWRGFFVGLSIGYIKVTP 324

 Score = 47.4 bits (111), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 48/204 (23%), Positives = 84/204 (41%), Gaps = 31/204 (15%)

Query: 113 LSGASAGICESFVVVPFELVKIRLQDVS---SKFTSPIA----VVKNIVEKEGILAMYNG 165
           L+G  +G C   ++ P + +KI  Q  +   SK+   +       K+I   +GI   + G
Sbjct: 23  LAGGVSGSCAKTLIAPLDRIKILFQTSNPHYSKYAGSLVGLYEAAKHIWINDGIRGFFQG 82

Query: 166 LESTMWRHGIWNAGYFGIIFQVRALL-PKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDV 224
              T+ R   + A  F    Q+R++L P    +S   R  L +G++ G  S  ++ P D+
Sbjct: 83  HSVTLLRIFPYAAVKFVAYEQIRSILIPSREYESHWRR--LASGSLAGLCSVFITYPLDL 140

Query: 225 VKSRVQNTAVIPGVPRKYNWSWPALATIYKE---EGFKA-------------LYKGFVPK 268
            + R+        V  +       + TIY E   EG  +              Y+G+VP 
Sbjct: 141 TRVRLAYVTEHKRVKLR-----DIVKTIYHEPASEGLTSHLLVPKWFAHWCNFYRGYVPT 195

Query: 269 VLRLGPGGGILLVVFTGVMDFFRT 292
           VL + P  G+       + D  ++
Sbjct: 196 VLGMIPYAGVSFFAHDLIHDIMKS 219

>CAGL0B04543g 441599..442552 highly similar to tr|Q12289
           Saccharomyces cerevisiae YOR100c CRC1, start by
           similarity
          Length = 317

 Score = 67.8 bits (164), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 85/309 (27%), Positives = 125/309 (40%), Gaps = 50/309 (16%)

Query: 13  FMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSR----- 67
            +AG V GV  +L  +P D++K   Q         Q K   D +  I  KE  S      
Sbjct: 25  LVAGGVGGVCAVLTGHPFDLIKVRCQSN-------QAKSTMDAV-SIILKEARSLSTVNG 76

Query: 68  --------------LYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQ-PLSI 112
                          YKG+  P++   P  A  F   D    I K L   ++ +  PL+ 
Sbjct: 77  SLTTSLFFKNSVKGFYKGVIPPLIGVTPIFAVSFWGYD----IGKRLVTWKQASDAPLTT 132

Query: 113 LSGASAG----ICESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLES 168
              A+AG    I  + V  P E +K+ LQ  S    S I   K+IV   G+ +++NG  +
Sbjct: 133 AQMATAGFISAIPTTLVTAPTERIKVVLQTNSEFKGSFIKAAKHIVSTGGVKSLFNGSLA 192

Query: 169 TMWRHGIWNAGYFGIIFQVRALLPKASTKSEQTRNDL----LAGTVGGTLSSLLSTPFDV 224
           T+ R G  +A YF      +A L K+  K ++   +L    LAG + G    L+  P D 
Sbjct: 193 TLARDGPGSALYFASYELSKAFLNKSVAKKDKDEVNLANVCLAGGIAGMSMWLVVFPIDT 252

Query: 225 VKSRVQ-NTAVIPGVPRKYNWSWPALATIYKEE-GFKALYKGFVPKVLRLGPGGGILLVV 282
           +K+R+Q  T  I  V         A   IY +  G K  + G  P +LR  P      + 
Sbjct: 253 IKTRLQVATTPISMV--------QATKDIYIQRGGIKGFFPGLGPALLRSFPANAATFLG 304

Query: 283 FTGVMDFFR 291
                 FF+
Sbjct: 305 VELTHAFFK 313

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 42/193 (21%), Positives = 79/193 (40%), Gaps = 28/193 (14%)

Query: 111 SILSGASAGICESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNG-LEST 169
           ++++G   G+C      PF+L+K+R Q   +K  S +  V  I+++   L+  NG L ++
Sbjct: 24  ALVAGGVGGVCAVLTGHPFDLIKVRCQSNQAK--STMDAVSIILKEARSLSTVNGSLTTS 81

Query: 170 MWRHGIWNAGYFGIIFQVRALLP-------------------KASTKSEQTRNDLLAGTV 210
           ++        Y G+I  +  + P                   +AS     T     AG +
Sbjct: 82  LFFKNSVKGFYKGVIPPLIGVTPIFAVSFWGYDIGKRLVTWKQASDAPLTTAQMATAGFI 141

Query: 211 GGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVL 270
               ++L++ P + +K  +Q  +   G   K      A   I    G K+L+ G +  + 
Sbjct: 142 SAIPTTLVTAPTERIKVVLQTNSEFKGSFIK------AAKHIVSTGGVKSLFNGSLATLA 195

Query: 271 RLGPGGGILLVVF 283
           R GPG  +    +
Sbjct: 196 RDGPGSALYFASY 208

>Scas_716.29
          Length = 316

 Score = 67.8 bits (164), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 75/302 (24%), Positives = 133/302 (44%), Gaps = 35/302 (11%)

Query: 13  FMAGAVAGVSEILVMYPLDMVKTVMQLQVS-GGSGPQYKGVFDCLKQIAAKEGPSR-LYK 70
            +AG+V+G+    V+ PLD +K  +QL+ S  G  P   G+   +K +   EG  R  +K
Sbjct: 26  LVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAP--SGLLKMMKGMILNEGGLRSFWK 83

Query: 71  GISSPILMEAPKRATKFACNDEFQKIYKDLFG--AEKLTQPLSILSGASAGICESFVVVP 128
           G     +M       +F+        Y +LFG  ++   Q  S++ GA AG+  SFV  P
Sbjct: 84  GNVPGTMMYVLYGGAQFSS----YSFYNNLFGETSDMNGQLQSLVVGALAGMTSSFVSYP 139

Query: 129 FELVKIRL---QDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIF 185
            ++++ R    QDV+   +S     K I   EGI   + G  ++M+   +  +  FG   
Sbjct: 140 TDVLRTRFIANQDVA--LSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYE 197

Query: 186 QVRALLPKASTKSEQTRN-DLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNW 244
            ++    + S +S+ T      A ++ G  S +++ P D ++ R+Q   V   V  ++N 
Sbjct: 198 SIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQ---VRNSVYVQHNV 254

Query: 245 SWPALATIY----------------KEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMD 288
               +  IY                ++EG  +LY+G    + +  P   + L  +  VM 
Sbjct: 255 ENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMR 314

Query: 289 FF 290
            +
Sbjct: 315 LY 316

 Score = 28.9 bits (63), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 23/104 (22%), Positives = 43/104 (41%), Gaps = 22/104 (21%)

Query: 12  QFMAGAVAGVSEILVMYPLDMVKTVMQLQVS------------GGSGPQYKGV------F 53
           ++ A +++GV+  +V YPLD ++  +Q++ S                  YKG        
Sbjct: 217 RYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGL 276

Query: 54  DCLKQIAAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIY 97
           + L+Q    EG   LY+G+S  +    P         +   ++Y
Sbjct: 277 NILRQ----EGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRLY 316

>AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH]
           (1500683..1501609) [927 bp, 308 aa]
          Length = 308

 Score = 67.4 bits (163), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 71/270 (26%), Positives = 123/270 (45%), Gaps = 20/270 (7%)

Query: 14  MAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGIS 73
           +AGA+   +    M P+D+VKT +QL+    S     G+    ++I  +EG + L  G  
Sbjct: 20  LAGAIGCGATHSAMVPIDVVKTRIQLEPLKYS----SGMVGSFRKIVGEEGAAALLTGFG 75

Query: 74  SPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQ---PLSILSGASAGICESFVVVPFE 130
             +L  + + A KF   + F+K + D  G E   Q   P+ I S A A       + P E
Sbjct: 76  PTLLGYSMQGAFKFGGYEVFKKAFVDALGYETACQYRTPIYIGSAAIAEFFADIALCPLE 135

Query: 131 LVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIFQ--VR 188
             +IRL    +     +     I+++EGI + YNG    +++   +N   F ++F+    
Sbjct: 136 ATRIRLVSQPTFANGLVGGFARILKEEGIGSFYNGFTPILFKQIPYNIAKF-VVFEHAAN 194

Query: 189 ALLPKASTK-----SEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYN 243
           A    A +K     +  T  +LLAG   G  ++++S P D + S+V  T   PG      
Sbjct: 195 AYFGLAGSKENLSTTAATGINLLAGLTAGLAAAVISQPADTLLSKVNKTKKAPG-----Q 249

Query: 244 WSWPALATIYKEEGFKALYKGFVPKVLRLG 273
            ++  L  + K+ GF   + G   +++ +G
Sbjct: 250 STFGLLMQLAKQLGFVGSFAGLPTRLVMVG 279

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 73/176 (41%), Gaps = 11/176 (6%)

Query: 113 LSGASAGICESFVVVPFELVKIRLQDVSSKFTSP-IAVVKNIVEKEGILAMYNGLESTMW 171
           L+GA         +VP ++VK R+Q    K++S  +   + IV +EG  A+  G   T+ 
Sbjct: 20  LAGAIGCGATHSAMVPIDVVKTRIQLEPLKYSSGMVGSFRKIVGEEGAAALLTGFGPTLL 79

Query: 172 RHGIWNAGYFG--IIFQVRALLPKASTKSEQTRNDLLAGT--VGGTLSSLLSTPFDVVKS 227
            + +  A  FG   +F+   +       + Q R  +  G+  +    + +   P +  + 
Sbjct: 80  GYSMQGAFKFGGYEVFKKAFVDALGYETACQYRTPIYIGSAAIAEFFADIALCPLEATRI 139

Query: 228 RVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVF 283
           R+ +       P   N      A I KEEG  + Y GF P + +  P      VVF
Sbjct: 140 RLVSQ------PTFANGLVGGFARILKEEGIGSFYNGFTPILFKQIPYNIAKFVVF 189

>AFL196W [2999] [Homologous to ScYMR166C - SH]
           complement(66955..68040) [1086 bp, 361 aa]
          Length = 361

 Score = 67.8 bits (164), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 71/282 (25%), Positives = 127/282 (45%), Gaps = 31/282 (10%)

Query: 26  VMYPLDMVKTVMQLQVSGGSGP-QYKGVFDCLKQIAAKEGPSR-LYKGISSPILMEAPKR 83
           VM+ LD VKT  Q    G  G  +Y+ +    + +A +EG  R LY G  + +L   P  
Sbjct: 70  VMHSLDTVKTRQQ----GAPGEVKYRHMISAYRTLALEEGVRRGLYGGYGAAMLGSFPSA 125

Query: 84  ATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAG-ICESFVVVPFELVKIRLQ----- 137
           A  F     ++ + + +    ++ +  S L+    G +  S V VP E++K RLQ     
Sbjct: 126 AVFFGT---YEWVKRQMINEWQIHETYSHLAAGFLGDLFSSVVYVPSEVLKTRLQLQGCY 182

Query: 138 -----DVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIFQVRA--- 189
                     +      V+ IV  EG+ A++ G ++T+ R   ++A  F    + R    
Sbjct: 183 NNRHFQSGYNYRGLSDAVRTIVRTEGVSALFFGYKATLSRDLPFSALQFAFYERFRKWAF 242

Query: 190 LLPKASTKSEQT-RNDLLAGTVGGTLSSLLSTPFDVVKSRVQN----TAVIP--GVPRKY 242
           LL +       +   +++ G   G L+ +++TP DVVK+R+Q     +A  P    P + 
Sbjct: 243 LLERKPVDGHLSFTAEVVTGASAGGLAGIITTPLDVVKTRIQTQPRGSAGTPDASAPARL 302

Query: 243 NWS-WPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVF 283
           N S + +L  + + EG    + G  P+ +       I+L+++
Sbjct: 303 NGSIFRSLLVVLRYEGLGGAFSGVGPRFIWTSIQSSIMLLLY 344

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 67/135 (49%), Gaps = 10/135 (7%)

Query: 12  QFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGG-----SGPQYKGVFDCLKQIAAKEGPS 66
              AG +  +   +V  P +++KT +QLQ         SG  Y+G+ D ++ I   EG S
Sbjct: 151 HLAAGFLGDLFSSVVYVPSEVLKTRLQLQGCYNNRHFQSGYNYRGLSDAVRTIVRTEGVS 210

Query: 67  RLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLS----ILSGASAGICE 122
            L+ G  + +  + P  A +FA  + F+K +  L   + +   LS    +++GASAG   
Sbjct: 211 ALFFGYKATLSRDLPFSALQFAFYERFRK-WAFLLERKPVDGHLSFTAEVVTGASAGGLA 269

Query: 123 SFVVVPFELVKIRLQ 137
             +  P ++VK R+Q
Sbjct: 270 GIITTPLDVVKTRIQ 284

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 4/48 (8%)

Query: 3   DQKP----LPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSG 46
           ++KP    L F  + + GA AG    ++  PLD+VKT +Q Q  G +G
Sbjct: 245 ERKPVDGHLSFTAEVVTGASAGGLAGIITTPLDVVKTRIQTQPRGSAG 292

>Kwal_23.3965
          Length = 307

 Score = 67.0 bits (162), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 66/298 (22%), Positives = 129/298 (43%), Gaps = 27/298 (9%)

Query: 5   KPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEG 64
           + +P     +AG ++G+S  +V  PLD +K  +QLQ++  +  QY G+    K++  +EG
Sbjct: 10  QEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEA--QYGGILVTFKRLVRQEG 67

Query: 65  PSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESF 124
              L+KG    + M     +T+F     +  + K L  ++   Q  + + GA +G C + 
Sbjct: 68  VRALWKGNVPAMAMYILYGSTQFT---SYAILNKLLSKSQLPAQIHTGMVGALSGTCSAI 124

Query: 125 VVVPFELVKIR-LQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGI 183
              P ++++ R + + S + ++ ++  + I   EG    + G+ S++    +  +     
Sbjct: 125 ASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGVSSSIVSIAVATSSILAT 184

Query: 184 IFQVRALLPKASTKSEQTRNDL--LAGTVGGTLSSLLSTPFDVVKSRVQNTAVIP----G 237
              V+    +   +       L   A  + G +S  +  P D V+ R Q   VI     G
Sbjct: 185 YESVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQ---VIDWQQLG 241

Query: 238 VPRKYNWSWPALAT------------IYKEEGFKALYKGFVPKVLRLGPGGGILLVVF 283
            P   N ++ A  +            I ++EG  ALY G+   + +  P   + L V+
Sbjct: 242 HPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVY 299

 Score = 58.2 bits (139), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 42/182 (23%), Positives = 84/182 (46%), Gaps = 10/182 (5%)

Query: 111 SILSGASAGICESFVVVPFELVKIRLQ---DVSSKFTSPIAVVKNIVEKEGILAMYNGLE 167
           S+++G  +GI    V  P + +KIRLQ      +++   +   K +V +EG+ A++ G  
Sbjct: 17  SLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNV 76

Query: 168 STMWRHGIWNAGYFGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKS 227
             M  + ++ +  F     +  LL K+   ++   +  + G + GT S++ S P DV+++
Sbjct: 77  PAMAMYILYGSTQFTSYAILNKLLSKSQLPAQI--HTGMVGALSGTCSAIASYPCDVLRT 134

Query: 228 RVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVM 287
           R      I    R+ +        I++ EGF+  +KG    ++ +      +L  +  V 
Sbjct: 135 RF-----IANHSRELSTMLSTAQEIWRHEGFRGFFKGVSSSIVSIAVATSSILATYESVK 189

Query: 288 DF 289
            F
Sbjct: 190 IF 191

>KLLA0D14036g complement(1203522..1204817) some similarities with
           sp|P40556 Saccharomyces cerevisiae YIL006w, hypothetical
           start
          Length = 431

 Score = 67.8 bits (164), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 80/324 (24%), Positives = 143/324 (44%), Gaps = 62/324 (19%)

Query: 14  MAGAVAGVSEILVMYPLDMVKTVMQ---LQVSG------GS------GPQYKGVFDCLKQ 58
           ++GA+AG    +++ PLD+ KT +Q   LQ++G      GS      G  Y G++  L  
Sbjct: 108 LSGALAGFLAGVIVCPLDVAKTRLQAQGLQLNGPVTRPVGSVATTFGGKYYSGIWGTLTT 167

Query: 59  IAAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFG-AEKLTQPLSILSGAS 117
           I   E    LYKGI   +L   P     F+  +  +  Y   F  +E L+  +S L+   
Sbjct: 168 IVRDESIRGLYKGIVPIVLGYFPTWMIYFSVYERCKLSYPRYFNNSEFLSHSMSALT--- 224

Query: 118 AGICESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEK-------EGILAMYNGLESTM 170
           AG   + +  P  +VK RL   S K    +   KN ++        EGI + Y+GL  ++
Sbjct: 225 AGAISTTLTNPIWVVKTRLMLQSGKNIKGMTHYKNTLDAFIKIYKVEGIKSFYSGLIPSL 284

Query: 171 WRHGIWN-AGYFGIIFQVRALL--------------------PKASTKSEQTRNDLLAGT 209
           +  G+ + A +F +  +++ +L                    P+ +  +      L+  +
Sbjct: 285 F--GLLHVAIHFPVYEKLKKVLHCYPSGRPNQETMNVNGNSNPQTTGSTNFQLGRLIVAS 342

Query: 210 VGGTL-SSLLSTPFDVVKSRVQ-NTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVP 267
            G  + +S L+ P +++++R+Q  + + P +          + T Y +EG +  Y GF+ 
Sbjct: 343 CGSKMIASTLTYPHEILRTRLQLKSDMKPSIK-------SIIRTTYAKEGIRGFYSGFLT 395

Query: 268 KVLRLGPGGGILLVVFTGVMDFFR 291
            + R  P   I LV F    ++FR
Sbjct: 396 NMFRTVPASAITLVSF----EYFR 415

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 78/185 (42%), Gaps = 24/185 (12%)

Query: 110 LSILSGASAGICESFVVVPFELVKIRLQDVSSKFTSPI--------------------AV 149
           ++ LSGA AG     +V P ++ K RLQ    +   P+                      
Sbjct: 105 ITALSGALAGFLAGVIVCPLDVAKTRLQAQGLQLNGPVTRPVGSVATTFGGKYYSGIWGT 164

Query: 150 VKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIFQVRALLPKASTKSEQTRNDLLAGT 209
           +  IV  E I  +Y G+   +  +      YF +  + +   P+    SE   + + A T
Sbjct: 165 LTTIVRDESIRGLYKGIVPIVLGYFPTWMIYFSVYERCKLSYPRYFNNSEFLSHSMSALT 224

Query: 210 VGGTLSSLLSTPFDVVKSR--VQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVP 267
            G  +S+ L+ P  VVK+R  +Q+   I G+   Y  +  A   IYK EG K+ Y G +P
Sbjct: 225 AGA-ISTTLTNPIWVVKTRLMLQSGKNIKGMTH-YKNTLDAFIKIYKVEGIKSFYSGLIP 282

Query: 268 KVLRL 272
            +  L
Sbjct: 283 SLFGL 287

>CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534
           Saccharomyces cerevisiae YDL119c, hypothetical start
          Length = 297

 Score = 67.0 bits (162), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 62/297 (20%), Positives = 122/297 (41%), Gaps = 25/297 (8%)

Query: 12  QFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKG 71
             + G   G+S  + + PLD++KT  Q Q  GG+  Q     D   Q+     PS +   
Sbjct: 7   HLIGGFAGGLSSAVALQPLDLLKTRFQ-QTKGGTLWQTVKSLDTPWQLWRGTLPSAIRTS 65

Query: 72  ISSPILMEAPK-RATKFACNDEFQKIYKDLFGAE----KLTQPLSILSGASAGICESFVV 126
           + S + + +     T  A   +F      + G      +L+   ++++GA A     ++ 
Sbjct: 66  VGSALYLSSLNLMRTALAKRKQFDTADSVVTGKSSNLPQLSMYENLVTGAFARGTVGYIT 125

Query: 127 VPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIFQ 186
           +P  ++K+R +     + S     K+I  +EGI   + G   T  R   ++  Y  +  +
Sbjct: 126 MPITIIKVRYESTLYNYKSIAEAAKSIAAQEGIRGFFRGFGPTCLRDAPYSGLYVLLYEK 185

Query: 187 VRALLPKASTKS-------------EQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTA 233
           ++  LP    KS               T  +  +  +  ++++ ++ PFD +K+R+Q   
Sbjct: 186 LKHTLPTILPKSLLQLDSEGRYTAYTSTAINSTSAILSASMATTVTAPFDTIKTRMQLE- 244

Query: 234 VIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFF 290
                P K+   W  L TI  +E    ++ G   ++ R     GI   ++  ++  F
Sbjct: 245 -----PTKFKTFWSTLTTIVTQEHPIKIFSGLSMRLTRKALSAGIAWGIYEELIKHF 296

>Sklu_2115.4 YDL119C, Contig c2115 2906-3805
          Length = 299

 Score = 66.6 bits (161), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 62/287 (21%), Positives = 124/287 (43%), Gaps = 34/287 (11%)

Query: 12  QFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEG------P 65
             + G V G++  +V+ P D++KT +Q         +   ++  LK+I + +       P
Sbjct: 10  HLIGGFVGGLTSAIVLQPFDLLKTRLQQN-------KDTTLWGTLKEIRSPKQLWRGALP 62

Query: 66  SRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESFV 125
           S L   I S + +             + Q +        +LT   ++ SGA       F+
Sbjct: 63  SSLRTSIGSALYLSTLNVFRTAMAKGKTQTLNPGSSFLPQLTMYENLASGAFTRGVVGFI 122

Query: 126 VVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIF 185
            +P  ++K+R +     + S     ++I   EGI   +NG  +T+ R   + AG + +++
Sbjct: 123 TMPITIIKVRYESTMYSYKSLGEATRHIYSTEGIRGFFNGCGATVMRDAPY-AGLYVLLY 181

Query: 186 Q-----VRALLPKAS---------TKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQN 231
           +     V  +LP ++         T    T  + ++  +  +L++ +++PFD +K+R+Q 
Sbjct: 182 EKAKLLVPMMLPSSTISYDEAGMFTTYTSTVVNSISAFMSASLATTITSPFDTIKTRMQL 241

Query: 232 TAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGI 278
                  P K++  +  L  I  +E FK L+ G   ++ R     GI
Sbjct: 242 D------PTKFSGFYKTLVLIVSKEKFKNLFDGLTLRLTRKAFSAGI 282

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/194 (22%), Positives = 79/194 (40%), Gaps = 27/194 (13%)

Query: 103 AEKLTQPLSILSGASAGICESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAM 162
           AE+      ++ G   G+  + V+ PF+L+K RLQ   +K T+    +K I   +    +
Sbjct: 2   AERPKTSSHLIGGFVGGLTSAIVLQPFDLLKTRLQQ--NKDTTLWGTLKEIRSPK---QL 56

Query: 163 YNGLESTMWRHGIWNAGYFGIIFQVRALLPKASTKSEQTRN-------------DLLAGT 209
           + G   +  R  I +A Y   +   R  + K  T   QT N             +L +G 
Sbjct: 57  WRGALPSSLRTSIGSALYLSTLNVFRTAMAKGKT---QTLNPGSSFLPQLTMYENLASGA 113

Query: 210 VGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKV 269
               +   ++ P  ++K R ++T         Y     A   IY  EG +  + G    V
Sbjct: 114 FTRGVVGFITMPITIIKVRYESTMY------SYKSLGEATRHIYSTEGIRGFFNGCGATV 167

Query: 270 LRLGPGGGILLVVF 283
           +R  P  G+ ++++
Sbjct: 168 MRDAPYAGLYVLLY 181

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 44/93 (47%), Gaps = 15/93 (16%)

Query: 200 QTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFK 259
           +T + L+ G VGG  S+++  PFD++K+R+Q          K    W  L  I      K
Sbjct: 6   KTSSHLIGGFVGGLTSAIVLQPFDLLKTRLQQ--------NKDTTLWGTLKEIRSP---K 54

Query: 260 ALYKGFVPKVLRLGPGGGILLVVFTGVMDFFRT 292
            L++G +P  LR   G  + L      ++ FRT
Sbjct: 55  QLWRGALPSSLRTSIGSALYL----STLNVFRT 83

>YPR128C (ANT1) [5547] chr16 complement(791212..792198)
           Peroxisome-localized protein involved in adenine
           nucleotide transport, medium-chain fatty acid
           metabolism, and peroxisome proliferation, has similarity
           to ADP/ATP carrier proteins [987 bp, 328 aa]
          Length = 328

 Score = 66.6 bits (161), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 76/289 (26%), Positives = 128/289 (44%), Gaps = 41/289 (14%)

Query: 14  MAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGP-----------QYKGVFDCLKQIAAK 62
           + GAVA     + +YPLD+ KT++Q QVS  S             +YK V DC+  I  +
Sbjct: 8   LTGAVASAMANIAVYPLDLSKTIIQSQVSPSSSEDSNEGKVLPNRRYKNVVDCMINIFKE 67

Query: 63  EGPSRLYKGISSPILMEAPKRATKFACNDEFQKIY--KDLFGAEKLTQ---PLS------ 111
           +G   LY+G++   +    +    F      +K Y    L G + L     P++      
Sbjct: 68  KGILGLYQGMTVTTVATFVQNFVYFFWYTFIRKSYMKHKLLGLQSLKNRDGPITPSTIEE 127

Query: 112 -ILSGASAGICESFVVVPFELVKIRLQDV----SSKFTSPIAVVKNIVEKEG--ILAMYN 164
            +L  A+A I + F   P  +V  R Q V    S+KFT+   V+K+I  +    I A + 
Sbjct: 128 LVLGVAAASISQLF-TSPMAVVATRQQTVHSAESAKFTN---VIKDIYRENNGDITAFWK 183

Query: 165 GLESTMWRHGIWNAGY--FGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPF 222
           GL + +      +  Y  F  + +V          S     + + G +   +S+L++ P 
Sbjct: 184 GLRTGLALTINPSITYASFQRLKEVFFHDHSNDAGSLSAVQNFILGVLSKMISTLVTQPL 243

Query: 223 DVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLR 271
            V K+ +Q+         K+     AL  +YK EG K+L+KG +P++ +
Sbjct: 244 IVAKAMLQSAG------SKFTTFQEALLYLYKNEGLKSLWKGVLPQLTK 286

>Scas_687.15*
          Length = 328

 Score = 65.9 bits (159), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 80/331 (24%), Positives = 135/331 (40%), Gaps = 69/331 (20%)

Query: 12  QFMAGAVAGVSEILVMYPLDMVKTVMQLQV-SGGSGPQYKGVFDCLKQIAAKEGPSRLYK 70
           Q +AG+ A V E  + YP + +KT  QL   + G+ P     F+ L+ I         + 
Sbjct: 11  QILAGSAAAVFETTLTYPFEFLKTGFQLHRRTVGAKP-----FEALRPIKV------YFA 59

Query: 71  GISSPILMEAPKRATKFACNDEFQKIYKD--LFGAEKLTQPLSILSGASAGICESFVVVP 128
           G ++  L    K + +FA  D+  +I +D  L     L  P  +L+G   G  ES  ++P
Sbjct: 60  GCTALNLSAIVKTSVRFATFDKACQILRDPNLPKDSLLKGPRLLLAGILTGAVESLCIIP 119

Query: 129 FELVKIRL-----------------------------------------QDVSSKFTSP- 146
           FE VK+ +                                         + V SK+ S  
Sbjct: 120 FENVKVTMIENSLQLSESKPTEKEIAGTLKKKVTFHVAKPKQLSPQEQWRQVYSKYPSSN 179

Query: 147 -IAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIFQVRALLPKASTKSEQTRNDL 205
             +VVK I    G+     G   T++R    +   F     ++ L+        Q  N++
Sbjct: 180 IFSVVKEIYLTRGLRGFAQGAMPTVFRQVSNSTVRFTAYTTLKQLI-----SPTQPLNEV 234

Query: 206 LAGTVGGTLSS---LLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALY 262
            A  +G   S     L+ P DVVK+R+Q+           N ++     ++ EEG  +L+
Sbjct: 235 YAFGIGLFSSCAVVALTQPIDVVKTRMQSKTAHYFYKNSLNCAY----RVFVEEGMVSLW 290

Query: 263 KGFVPKVLRLGPGGGILLVVFTGVMDFFRTV 293
           KG++P++ ++G  GGI   V+  V +   T+
Sbjct: 291 KGWLPRLFKVGLSGGISFGVYQYVENLSHTL 321

 Score = 37.7 bits (86), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 37/71 (52%), Gaps = 3/71 (4%)

Query: 1   MSDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIA 60
           +S  +PL  VY F  G  +  + + +  P+D+VKT MQ   S  +   YK   +C  ++ 
Sbjct: 225 ISPTQPLNEVYAFGIGLFSSCAVVALTQPIDVVKTRMQ---SKTAHYFYKNSLNCAYRVF 281

Query: 61  AKEGPSRLYKG 71
            +EG   L+KG
Sbjct: 282 VEEGMVSLWKG 292

 Score = 28.5 bits (62), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 19/29 (65%)

Query: 109 PLSILSGASAGICESFVVVPFELVKIRLQ 137
           P+ IL+G++A + E+ +  PFE +K   Q
Sbjct: 9   PIQILAGSAAAVFETTLTYPFEFLKTGFQ 37

>YOR100C (CRC1) [4905] chr15 complement(513295..514278)
           Mitochondrial carnitine carrier, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [984 bp, 327 aa]
          Length = 327

 Score = 65.5 bits (158), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 77/288 (26%), Positives = 120/288 (41%), Gaps = 40/288 (13%)

Query: 10  VYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAK------- 62
           +  F+AG V GV  +   +P D++K   Q   +G +      + + +K+   +       
Sbjct: 36  IKSFVAGGVGGVCAVFTGHPFDLIKVRCQ---NGQANSTVHAITNIIKEAKTQVKGTLFT 92

Query: 63  EGPSRLYKGISSPILMEAPKRATKFACNDEFQKIY---KDLFGAEKLTQPLSILSGASAG 119
                 YKG+  P+L   P  A  F   D  +K+        G+ +LT      +G  + 
Sbjct: 93  NSVKGFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTFNNKQGGSNELTMGQMAAAGFISA 152

Query: 120 ICESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAG 179
           I  + V  P E VK+ LQ  SSK  S I   K IV++ GI +++ G  +T+ R G  +A 
Sbjct: 153 IPTTLVTAPTERVKVVLQ-TSSK-GSFIQAAKTIVKEGGIASLFKGSLATLARDGPGSAL 210

Query: 180 YFGIIFQVRALLPKASTKSEQTRND------------LLAGTVGGTLSSLLSTPFDVVKS 227
           YF         + K    S Q R D             LAG + G    L   P D +K+
Sbjct: 211 YF-----ASYEISKNYLNSRQPRQDAGKDEPVNILNVCLAGGIAGMSMWLAVFPIDTIKT 265

Query: 228 RVQNTAVIPGVPRKYNWSWPALATIY-KEEGFKALYKGFVPKVLRLGP 274
           ++Q ++      R+   S  A   IY +  G K  + G  P +LR  P
Sbjct: 266 KLQASST-----RQNMLS--ATKEIYLQRGGIKGFFPGLGPALLRSFP 306

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 78/189 (41%), Gaps = 21/189 (11%)

Query: 15  AGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGISS 74
           AG ++ +   LV  P + VK V+Q    G             K I  + G + L+KG  +
Sbjct: 147 AGFISAIPTTLVTAPTERVKVVLQTSSKGS-------FIQAAKTIVKEGGIASLFKGSLA 199

Query: 75  PILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQ------PLSILS----GASAGICESF 124
            +  + P  A  FA  +    I K+   + +  Q      P++IL+    G  AG+    
Sbjct: 200 TLARDGPGSALYFASYE----ISKNYLNSRQPRQDAGKDEPVNILNVCLAGGIAGMSMWL 255

Query: 125 VVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGII 184
            V P + +K +LQ  S++     A  +  +++ GI   + GL   + R    NA  F  +
Sbjct: 256 AVFPIDTIKTKLQASSTRQNMLSATKEIYLQRGGIKGFFPGLGPALLRSFPANAATFLGV 315

Query: 185 FQVRALLPK 193
               +L  K
Sbjct: 316 EMTHSLFKK 324

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/194 (22%), Positives = 84/194 (43%), Gaps = 37/194 (19%)

Query: 111 SILSGASAGICESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTM 170
           S ++G   G+C  F   PF+L+K+R Q+   +  S +  + NI+++         ++ T+
Sbjct: 38  SFVAGGVGGVCAVFTGHPFDLIKVRCQN--GQANSTVHAITNIIKEA-----KTQVKGTL 90

Query: 171 WRHGIWNAGYFGIIFQVRALLP--------------------KASTKSEQTRNDL-LAGT 209
           + + +    Y G+I  +  + P                    K    +E T   +  AG 
Sbjct: 91  FTNSV-KGFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTFNNKQGGSNELTMGQMAAAGF 149

Query: 210 VGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKV 269
           +    ++L++ P + VK  +Q ++       K ++   A  TI KE G  +L+KG +  +
Sbjct: 150 ISAIPTTLVTAPTERVKVVLQTSS-------KGSF-IQAAKTIVKEGGIASLFKGSLATL 201

Query: 270 LRLGPGGGILLVVF 283
            R GPG  +    +
Sbjct: 202 ARDGPGSALYFASY 215

 Score = 36.2 bits (82), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 39/92 (42%), Gaps = 22/92 (23%)

Query: 197 KSEQTRNDL---LAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIY 253
           KS   R ++   +AG VGG  +     PFD++K R QN         + N +  A+  I 
Sbjct: 28  KSNPVRENIKSFVAGGVGGVCAVFTGHPFDLIKVRCQNG--------QANSTVHAITNII 79

Query: 254 KE-----------EGFKALYKGFVPKVLRLGP 274
           KE              K  YKG +P +L + P
Sbjct: 80  KEAKTQVKGTLFTNSVKGFYKGVIPPLLGVTP 111

 Score = 32.3 bits (72), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 21/96 (21%), Positives = 44/96 (45%), Gaps = 7/96 (7%)

Query: 4   QKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKE 63
            +P+  +   +AG +AG+S  L ++P+D +KT +Q   +       + +    K+I  + 
Sbjct: 234 DEPVNILNVCLAGGIAGMSMWLAVFPIDTIKTKLQASST------RQNMLSATKEIYLQR 287

Query: 64  GPSR-LYKGISSPILMEAPKRATKFACNDEFQKIYK 98
           G  +  + G+   +L   P  A  F   +    ++K
Sbjct: 288 GGIKGFFPGLGPALLRSFPANAATFLGVEMTHSLFK 323

>KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomyces
           cerevisiae YOR100c CRC1 mitochondrial carnitine carrier,
           member of the mitochondrial carrier (MCF) family, start
           by similarity
          Length = 328

 Score = 65.5 bits (158), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 77/283 (27%), Positives = 119/283 (42%), Gaps = 38/283 (13%)

Query: 15  AGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQI--AAKE--GPSRL-- 68
           AG V GV  +L  +P D+VK   Q         Q +   D +  I  AA++  GP+ L  
Sbjct: 34  AGGVGGVCAVLTGHPFDLVKVRCQSN-------QARSAMDAVSHILQAARQAAGPTSLNA 86

Query: 69  ----YKGISSPILMEAPKRATKFACNDEFQKIYKDL----FGAEKLTQP-LSILSGASAG 119
               YKG+  P+L   P  A  F   D  +K+   +           +P L++   A+AG
Sbjct: 87  VRGFYKGVVPPLLGVTPIFAVSFWGYDVGKKLVTSVPSSAASGAAAVEPELTLSQMAAAG 146

Query: 120 ----ICESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGI 175
               I  + V  P E VK+ LQ    K  S +   K IV  +G  +++ G  +T+ R G 
Sbjct: 147 FISAIPTTLVTAPTERVKVVLQTTQGK-ASFLDAAKQIVRTQGFQSLFKGSLATLSRDGP 205

Query: 176 WNAGYFGIIFQVRALLPKASTKSE---QTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNT 232
            +A YF      +  L KAS  +       N  ++G + G    ++  P D VK+++Q++
Sbjct: 206 GSALYFASYEICKEYLNKASGHTSGELSITNVCISGGMAGVSMWVVVFPIDTVKTQLQSS 265

Query: 233 AVIPGVPRKYNWSWPALATIYKEE-GFKALYKGFVPKVLRLGP 274
           +       K          IY    G K  + G  P +LR  P
Sbjct: 266 S-------KRQSMLEVTRMIYNTRGGIKGFFPGVGPAILRSFP 301

 Score = 36.6 bits (83), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 40/86 (46%), Gaps = 6/86 (6%)

Query: 194 ASTKSEQTRN--DLLAGTVGGTLSSLLSTPFDVVKSRVQNT---AVIPGVPRKYNWSWPA 248
           + TKS+ T N   L AG VGG  + L   PFD+VK R Q+    + +  V      +  A
Sbjct: 19  SQTKSQLTENLKSLAAGGVGGVCAVLTGHPFDLVKVRCQSNQARSAMDAVSHILQAARQA 78

Query: 249 LATIYKEEGFKALYKGFVPKVLRLGP 274
            A        +  YKG VP +L + P
Sbjct: 79  -AGPTSLNAVRGFYKGVVPPLLGVTP 103

 Score = 32.3 bits (72), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 47/200 (23%), Positives = 90/200 (45%), Gaps = 30/200 (15%)

Query: 105 KLTQPL-SILSGASAGICESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEK------- 156
           +LT+ L S+ +G   G+C      PF+LVK+R Q  S++  S +  V +I++        
Sbjct: 24  QLTENLKSLAAGGVGGVCAVLTGHPFDLVKVRCQ--SNQARSAMDAVSHILQAARQAAGP 81

Query: 157 ---EGILAMYNG-LESTMWRHGIWNAGYFG------IIFQV--RALLPKASTKSEQTRND 204
                +   Y G +   +    I+   ++G      ++  V   A    A+ + E T + 
Sbjct: 82  TSLNAVRGFYKGVVPPLLGVTPIFAVSFWGYDVGKKLVTSVPSSAASGAAAVEPELTLSQ 141

Query: 205 L-LAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYK 263
           +  AG +    ++L++ P + VK  +Q T        K ++   A   I + +GF++L+K
Sbjct: 142 MAAAGFISAIPTTLVTAPTERVKVVLQTTQ------GKASF-LDAAKQIVRTQGFQSLFK 194

Query: 264 GFVPKVLRLGPGGGILLVVF 283
           G +  + R GPG  +    +
Sbjct: 195 GSLATLSRDGPGSALYFASY 214

 Score = 31.6 bits (70), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 41/86 (47%), Gaps = 7/86 (8%)

Query: 14  MAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSR-LYKGI 72
           ++G +AGVS  +V++P+D VKT +Q      S  + + + +  + I    G  +  + G+
Sbjct: 239 ISGGMAGVSMWVVVFPIDTVKTQLQ------SSSKRQSMLEVTRMIYNTRGGIKGFFPGV 292

Query: 73  SSPILMEAPKRATKFACNDEFQKIYK 98
              IL   P  A  F   +    ++K
Sbjct: 293 GPAILRSFPANAATFLGVELTHSLFK 318

>Kwal_23.3529
          Length = 395

 Score = 65.5 bits (158), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 71/280 (25%), Positives = 125/280 (44%), Gaps = 28/280 (10%)

Query: 26  VMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSR-LYKGISSPILMEAPKRA 84
           VM+ LD VKT  Q      + P+Y+ +    ++I  +EG  R LY G ++ +L   P  A
Sbjct: 102 VMHSLDTVKTRQQ---GAPNAPKYRNMISAYQKIFMEEGIRRGLYGGYTAAMLGSFPSAA 158

Query: 85  TKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESFVVVPFELVKIRLQDVSSKFT 144
             F   +  ++   D +G  +    L+  +G S  +  S V VP E++K RLQ +   + 
Sbjct: 159 IFFGTYELTKRKLIDDWGVNETLSHLT--AGLSGDLVSSVVYVPSEVLKTRLQ-LQGCYN 215

Query: 145 SPI-----------AVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIFQVR----A 189
           +P              +  IV  EG   ++ G ++T+ R   ++A  F    + R     
Sbjct: 216 NPHFHSGYNYRNLRDAITAIVRLEGWQTLFFGYKATLCRDLPFSAFQFAFYEKFRQWAFT 275

Query: 190 LLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQN------TAVIPGVPRKYN 243
           L  K  ++     N+LL G   G L+ +++TP DV+K+R+Q        +    + R  N
Sbjct: 276 LEGKTPSQDLSLLNELLTGAAAGGLAGIITTPMDVIKTRIQTQMPSTVASDSTRLVRIEN 335

Query: 244 WSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVF 283
                L  +Y+ EG    + G  P+ +       I+L+++
Sbjct: 336 SLIKGLTAVYRSEGTLGFFSGVGPRFIWTSIQSSIMLLLY 375

>Kwal_23.5757
          Length = 307

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 65/258 (25%), Positives = 111/258 (43%), Gaps = 25/258 (9%)

Query: 29  PLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGISSPILMEAPKRATKFA 88
           PLD+VK   Q+  S      YK   D  +QI   EG ++++ G+ +  +  + + A K+ 
Sbjct: 39  PLDLVKCRRQVDAS-----LYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYG 93

Query: 89  CNDEFQKIYKDLFG---AEKLTQPLSILSGASAGICESFVVVPFELVKIRLQD-VSSKFT 144
             + F+  Y  L     A      + + + ASA       + P+E +K+R Q  V   F 
Sbjct: 94  GYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTAVPPPFA 153

Query: 145 SPI-AVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFG----IIFQVRALLP---KAST 196
             +      +V  EG  ++Y G+    +R   +    F     I+  + A LP   +  +
Sbjct: 154 RNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMS 213

Query: 197 KSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWS-WPALATIYKE 255
           +  Q       G + G L +++S P DV+ S+V N        RK   S   A + IY +
Sbjct: 214 QLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNE-------RKSGESTLQATSRIYGK 266

Query: 256 EGFKALYKGFVPKVLRLG 273
            GF  L+ G   ++L +G
Sbjct: 267 IGFPGLWNGLAVRILMIG 284

 Score = 50.8 bits (120), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 44/153 (28%), Positives = 68/153 (44%), Gaps = 8/153 (5%)

Query: 126 VVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNA----GYF 181
           V P +LVK R Q  +S + S +   + IV  EG   ++ G+ +T   + +  A    GY 
Sbjct: 37  VTPLDLVKCRRQVDASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYE 96

Query: 182 GIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRK 241
               Q   L+   +  S +T   L A      ++ +   P++ +K R Q TAV P   R 
Sbjct: 97  FFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVR-QQTAVPPPFARN 155

Query: 242 YNWSWPALATIYKEEGFKALYKGFVPKVLRLGP 274
               + A + +   EGF +LYKG  P   R  P
Sbjct: 156 V---FDAYSKMVGAEGFASLYKGITPLWFRQIP 185

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 38/161 (23%), Positives = 67/161 (41%), Gaps = 15/161 (9%)

Query: 15  AGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGISS 74
           A A A     + + P + +K   Q  V     P  + VFD   ++   EG + LYKGI+ 
Sbjct: 122 ASASAEFIADIFLCPWEAIKVRQQTAVPP---PFARNVFDAYSKMVGAEGFASLYKGITP 178

Query: 75  PILMEAPKRATKFACNDEFQKIYKDLFG-----AEKLTQ----PLSILSGASAGICESFV 125
               + P    KF     F++I + ++        +++Q     +S   G  AGI  + V
Sbjct: 179 LWFRQIPYTMCKFT---SFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVV 235

Query: 126 VVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGL 166
             P +++  ++ +      S +     I  K G   ++NGL
Sbjct: 236 SHPADVMVSKVNNERKSGESTLQATSRIYGKIGFPGLWNGL 276

>YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in
           transport of FAD from cytosol into the mitochondrial
           matrix, member of mitochondrial carrier (MCF) family of
           membrane transporters [936 bp, 311 aa]
          Length = 311

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 75/311 (24%), Positives = 134/311 (43%), Gaps = 35/311 (11%)

Query: 1   MSDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQI- 59
           M D +  P   + ++G  AG    LV++PLD++K  +QL  +      Y G F  +K+I 
Sbjct: 1   MVDHQWTPLQKEVISGLSAGSVTTLVVHPLDLLKVRLQLSATSAQKAHY-GPFMVIKEII 59

Query: 60  --AAKEGPS---RLYKGISSPILMEAPKRATKFACNDEFQK-IYKDLF-----------G 102
             +A  G S    LY+G+S  +   A      F      ++ IYK +             
Sbjct: 60  RSSANSGRSVTNELYRGLSINLFGNAIAWGVYFGLYGVTKELIYKSVAKPGETQLKGVGN 119

Query: 103 AEKLTQPLSILSGASAGICESFVVVPFELVKIRLQDVSS----KFTSPIAVVKNIVEKEG 158
             K+   + + +GAS+G+  + +  P  ++K R+   S      +TS    V+ ++  +G
Sbjct: 120 DHKMNSLIYLSAGASSGLMTAILTNPIWVIKTRIMSTSKGAQGAYTSMYNGVQQLLRTDG 179

Query: 159 ILAMYNGLESTMWRHGI-WNAGYFGI--IFQVRALLPKASTKSEQTRNDLLA---GTVGG 212
              ++ GL   ++  G+   A YF +    + R L  K     +    +L      ++G 
Sbjct: 180 FQGLWKGLVPALF--GVSQGALYFAVYDTLKQRKLRRKRENGLDIHLTNLETIEITSLGK 237

Query: 213 TLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRL 272
            +S  L  PF ++KS +Q+        +K+   +P +  I   +GF  LYKG    ++R 
Sbjct: 238 MVSVTLVYPFQLLKSNLQS---FRANEQKFRL-FPLIKLIIANDGFVGLYKGLSANLVRA 293

Query: 273 GPGGGILLVVF 283
            P   I   V+
Sbjct: 294 IPSTCITFCVY 304

>Scas_702.10
          Length = 302

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 69/287 (24%), Positives = 122/287 (42%), Gaps = 29/287 (10%)

Query: 1   MSDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVF-DCLKQI 59
           M+D       Y +  G  AG+   ++ +PLD+ K  +Q      + P  K      L  I
Sbjct: 1   MTDSPTKQIKYPWWYGGAAGIFACVMTHPLDLAKVRLQ------AAPLPKPTLGRMLTTI 54

Query: 60  AAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQK--IYKDLFGAEKLTQPLSILSGAS 117
              E    LY G+S+ +L +      +F   D  ++  I +          P S+ SGA 
Sbjct: 55  LRNENVMGLYSGLSAAVLRQCTYTTVRFGAYDLMKENLIPQGHINDMVYLLPCSMFSGAI 114

Query: 118 AGICESFVVVPFELVKIRLQDVSS-------KFTSPIAVVKNIVEKEG-ILAMYNGLEST 169
            G+  +F     ++V IR+Q+ S+        + + I  V  I   EG I  +  G +  
Sbjct: 115 GGLVGNFA----DVVNIRMQNDSALKPELRRNYRNAIDGVYKIYMHEGGIKTLLTGWKPN 170

Query: 170 MWRHGIWNAGYFGIIFQV--RALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKS 227
           M R G+       + + V    L+ K S   ++    L A  + G +++ + +P DV+K+
Sbjct: 171 MVR-GVLMTASQVVTYDVFKNYLVTKLSFDPKKNSTHLSASLLAGLVATTICSPADVIKT 229

Query: 228 RVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGP 274
           R+ N         +   +   L +  K+EG   +++G++P   RLGP
Sbjct: 230 RIMNAH-----KTESESAIKILTSAIKKEGPSFMFRGWLPIFTRLGP 271

>KLLA0B14454g complement(1268709..1269626) highly similar to
           sp|P23641 Saccharomyces cerevisiae YJR077c MIR1
           phosphate transport protein, mitochondrial (MCF), start
           by similarity
          Length = 305

 Score = 63.9 bits (154), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 71/270 (26%), Positives = 119/270 (44%), Gaps = 20/270 (7%)

Query: 14  MAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGIS 73
           +AGA+        M P+D+VKT +QL+ +       KG+    KQI + EG   L  G  
Sbjct: 18  LAGAIGCGITHSSMVPIDVVKTRIQLEPT----VYNKGMVSSFKQIISSEGAGALLTGFG 73

Query: 74  SPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESF---VVVPFE 130
             +L  + + + KF   + F+K+  D  G +      + +   SA I E F    + P E
Sbjct: 74  PTLLGYSLQGSFKFGGYELFKKLAIDNMGYDNAVNYKNTIYIGSAAIAEFFADIALCPLE 133

Query: 131 LVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIFQVRA- 189
             +IRL    +           I+++EG+ + YNG    +++   +N   F  +F+  A 
Sbjct: 134 ATRIRLVSQPTFANGLFGGFSRILKEEGVGSFYNGFTPILFKQIPYNIAKF-FVFEHAAN 192

Query: 190 ----LLPKASTKSEQTRN--DLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYN 243
               L     T SE T    +L AG   G  ++++S P D + S+V  T   PG      
Sbjct: 193 AYFGLAGPKETMSETTHTAINLAAGLTAGLAAAVVSQPADTLLSKVNKTKKAPG-----Q 247

Query: 244 WSWPALATIYKEEGFKALYKGFVPKVLRLG 273
            +   LA + K+ GF   + G   +++ +G
Sbjct: 248 STIGLLAQLAKQLGFVGSFTGLPTRLVMVG 277

 Score = 37.7 bits (86), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 73/168 (43%), Gaps = 13/168 (7%)

Query: 113 LSGA-SAGICESFVVVPFELVKIRLQDVSSKFTSP-IAVVKNIVEKEGILAMYNGLESTM 170
           L+GA   GI  S  +VP ++VK R+Q   + +    ++  K I+  EG  A+  G   T+
Sbjct: 18  LAGAIGCGITHS-SMVPIDVVKTRIQLEPTVYNKGMVSSFKQIISSEGAGALLTGFGPTL 76

Query: 171 WRHGIWNAGYFG--IIFQVRALLPKASTKSEQTRNDLLAGT--VGGTLSSLLSTPFDVVK 226
             + +  +  FG   +F+  A+       +   +N +  G+  +    + +   P +  +
Sbjct: 77  LGYSLQGSFKFGGYELFKKLAIDNMGYDNAVNYKNTIYIGSAAIAEFFADIALCPLEATR 136

Query: 227 SRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGP 274
            R+ +       P   N  +   + I KEEG  + Y GF P + +  P
Sbjct: 137 IRLVSQ------PTFANGLFGGFSRILKEEGVGSFYNGFTPILFKQIP 178

>KLLA0F13464g 1246646..1247548 highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1 member of the
           mitochondrial carrier family (MCF), start by similarity
          Length = 300

 Score = 63.9 bits (154), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 69/277 (24%), Positives = 116/277 (41%), Gaps = 30/277 (10%)

Query: 14  MAGAVAGVSEILVMYPLDMV-KTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRL---Y 69
           +  A AG+ EI V +P+D + K +M       S  Q   V    +  A++    RL   +
Sbjct: 15  LGSASAGILEIGVFHPVDTISKRLMSNHTKIASTSQLNSV--IFRDFASEPLGRRLLSLF 72

Query: 70  KGISSPILMEAPKRATKFA--------CNDEFQKIYKDLFGAEKLTQPLSILSGASAGIC 121
            G+      +  +R  K+          N  F+  +   FG +      S  +G+  GI 
Sbjct: 73  PGLGYAAAYKILQRVYKYGGQPFANEFLNKNFKGDFDQAFGEKTGKALRSATAGSLIGIG 132

Query: 122 ESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYF 181
           E  V++P +++KI+ Q     F     +   I++ EG   +Y G   T  R+   +   F
Sbjct: 133 E-IVLLPLDVLKIKRQTNPESFKGRGFL--KIIKDEG-FGLYRGWGWTAARNAPGSFALF 188

Query: 182 G-IIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPR 240
           G   F    +L            + ++  VG + S ++S P DV+K+R+QN        R
Sbjct: 189 GGNAFAKEYILGLKDYGQATWSQNFVSSIVGASASLIVSAPLDVIKTRIQN--------R 240

Query: 241 KYN---WSWPALATIYKEEGFKALYKGFVPKVLRLGP 274
            ++     +  +    K EGF A +KG  PK+L  GP
Sbjct: 241 NFDNPESGFKIIKNTLKNEGFTAFFKGLTPKLLTTGP 277

 Score = 36.2 bits (82), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 41/89 (46%), Gaps = 4/89 (4%)

Query: 12  QFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKG 71
            F++  V   + ++V  PLD++KT  ++Q      P+    F  +K     EG +  +KG
Sbjct: 212 NFVSSIVGASASLIVSAPLDVIKT--RIQNRNFDNPESG--FKIIKNTLKNEGFTAFFKG 267

Query: 72  ISSPILMEAPKRATKFACNDEFQKIYKDL 100
           ++  +L   PK    FA       I+ +L
Sbjct: 268 LTPKLLTTGPKLVFSFALAQTLIPIFDNL 296

>KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces
           cerevisiae YNL003c PET8 member of the mitochondrial
           carrier (MCF) family, start by similarity
          Length = 274

 Score = 63.2 bits (152), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 75/298 (25%), Positives = 128/298 (42%), Gaps = 45/298 (15%)

Query: 9   FVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGG--SGPQYKGVFDCLKQIAAKEGPS 66
           F+   ++GA AG S  L  +P+D +KT  +LQ  GG  +   YKGV              
Sbjct: 6   FIASLVSGAAAGTSTDLAFFPIDTLKT--RLQAKGGFFANGGYKGV-------------- 49

Query: 67  RLYKGISSPILMEAPKRATKFACNDEFQKIYKDLF------GAEKLTQPLSILSGASAG- 119
             Y+G+ S ++  AP  +  F   D  +   + +       G ++    LS +  +S G 
Sbjct: 50  --YRGLGSAVVASAPSASLFFVAYDSMKCWSRPVIGQLLPKGEDQTADTLSHMVSSSFGE 107

Query: 120 ICESFVVVPFELVKIRLQD--VSSKFTSPIAVVKNIVEKEGI-LAMYNGLESTMWRHGIW 176
           I    V VP E++K R Q    +S   +  A+++N    EG+   +Y G  +T+ R   +
Sbjct: 108 ISACMVRVPAEVIKQRTQTHRTNSSLQTLQALLRN-ENGEGLRRNLYRGWSTTIMREIPF 166

Query: 177 NAGYFGIIFQVRALLPKASTKSEQTRNDLLAGTV----GGTLSSLLSTPFDVVKSRVQNT 232
               F +   ++    +   K    R     G+V     G +++  +TP DV+K+R+   
Sbjct: 167 TCIQFPLYEYMKKRWAEVQGKE---RAAPWQGSVCGCIAGGIAAAATTPLDVLKTRIM-- 221

Query: 233 AVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFF 290
                +  K   +     T+ +EEG K  + G  P+ + +  GG I L V+  V   F
Sbjct: 222 -----LHHKSVSALHLAKTMLQEEGVKVFFSGVGPRTMWISAGGAIFLGVYETVHSLF 274

 Score = 29.6 bits (65), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 20/90 (22%), Positives = 35/90 (38%), Gaps = 17/90 (18%)

Query: 204 DLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYK 263
            L++G   GT + L   P D +K+R+Q                 A    +   G+K +Y+
Sbjct: 9   SLVSGAAAGTSTDLAFFPIDTLKTRLQ-----------------AKGGFFANGGYKGVYR 51

Query: 264 GFVPKVLRLGPGGGILLVVFTGVMDFFRTV 293
           G    V+   P   +  V +  +  + R V
Sbjct: 52  GLGSAVVASAPSASLFFVAYDSMKCWSRPV 81

>Kwal_23.4731
          Length = 314

 Score = 63.5 bits (153), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 67/308 (21%), Positives = 128/308 (41%), Gaps = 30/308 (9%)

Query: 8   PFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGP-- 65
           P   + +AG  AG    +  +PLD+VK  +QL V+      YK V   + + +  +    
Sbjct: 12  PLQREIIAGLAAGTLTTIATHPLDLVKLRLQLLVNTTHSHGYKEVIKTIIRDSKADSNVF 71

Query: 66  SRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQP--------------LS 111
              Y+G+   ++  +      F     F K     +G  ++  P              L 
Sbjct: 72  REAYRGLGVNLIGNSIAWGLYFGLY-RFTKDMVYRYGVAQMKTPTQSSFQKDKAMGPSLY 130

Query: 112 ILSGASAGICESFVVVPFELVKIRLQDVSS----KFTSPIAVVKNIVEKEGILAMYNGLE 167
           + S A +G+  + +  P  ++K R+   SS    ++ +    ++ +   EG    + GL 
Sbjct: 131 LASAALSGLGTAILTNPIWVIKTRIMSTSSQASERYKTTWDGIRKVYAHEGFSGFWRGLV 190

Query: 168 STMWRHGIWN-AGYFGIIFQVRA--LLPKASTKSEQTRN--DLLAGTVGGTLSSLLSTPF 222
            +++  G+   A YF I   +R      +  T+ E+  N  ++   +V   LS     PF
Sbjct: 191 PSLF--GVAQGAIYFTIYDSLRHQYFARRGITEDEKMGNLENIAITSVSKMLSVTAVYPF 248

Query: 223 DVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVV 282
            ++KS +Q+ A +    R     W  + +I+++EG + LYKG    +LR  P   I   +
Sbjct: 249 QLLKSNLQSFAAVE--KRDSYRFWNLVKSIHQKEGLQGLYKGLSANLLRAIPSTCITFCI 306

Query: 283 FTGVMDFF 290
           +  +  + 
Sbjct: 307 YENLRHWL 314

>Scas_717.20
          Length = 356

 Score = 63.5 bits (153), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 75/328 (22%), Positives = 139/328 (42%), Gaps = 70/328 (21%)

Query: 3   DQKPLPFVYQF-MAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYK-------GVFD 54
           D+  L ++ +  +AG ++G     ++ PLD +K + Q      S P Y        G+ +
Sbjct: 25  DKNSLEYITRSGLAGGISGSCAKTLIAPLDRIKILFQT-----SNPHYTKYAGSLVGLKE 79

Query: 55  CLKQIAAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLF-GAEKLTQPLSIL 113
             K I   +G    ++G S  ++   P  A KF     +++I   L    E  +    ++
Sbjct: 80  AAKHIWLNDGIRGFFQGHSVTLMRIFPYAAVKFVA---YEQIRNTLIPSKEYESHWRRLM 136

Query: 114 SGASAGICESFVVVPFELVKIRLQDVS-SKFTSPIAVVKNI--------VEKEGIL---- 160
           SG+ AG+C  F   P +L+++RL  V+  K  S + +VK I        +E +G +    
Sbjct: 137 SGSLAGLCSVFTTYPLDLIRVRLAYVTEHKRISLLGLVKTIYKEPASTTLEAKGYIPNWF 196

Query: 161 ----AMYNGLESTMWRHGIWNAGYFGIIFQVRALLPK-------------ASTKSEQ--- 200
                 Y G   T+    +    Y G+ F    LL               A ++SEQ   
Sbjct: 197 AHWCNFYRGYTPTV----LGMIPYAGVSFFAHDLLHDVLKHPILAPYSVLALSESEQEER 252

Query: 201 ----------TRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALA 250
                     T  +LL+G + G  S   + PF++++ R+Q + +   V + Y+  + +++
Sbjct: 253 HFKHQRLPLRTWAELLSGGLAGMASQTAAYPFEIIRRRLQVSTL--SVSQMYDHRFQSIS 310

Query: 251 T----IYKEEGFKALYKGFVPKVLRLGP 274
                IYKE G++  + G     +++ P
Sbjct: 311 EIAKIIYKERGWRGFFVGLSIGYIKVTP 338

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 48/204 (23%), Positives = 79/204 (38%), Gaps = 33/204 (16%)

Query: 113 LSGASAGICESFVVVPFELVKIRLQDVSSKFTSPIA-------VVKNIVEKEGILAMYNG 165
           L+G  +G C   ++ P + +KI  Q  +  +T             K+I   +GI   + G
Sbjct: 37  LAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYAGSLVGLKEAAKHIWLNDGIRGFFQG 96

Query: 166 LESTMWRHGIWNAGYFGIIFQVR-ALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDV 224
              T+ R   + A  F    Q+R  L+P    +S   R  L++G++ G  S   + P D+
Sbjct: 97  HSVTLMRIFPYAAVKFVAYEQIRNTLIPSKEYESHWRR--LMSGSLAGLCSVFTTYPLDL 154

Query: 225 VKSRVQNTAVIPGVPRKYNWSWPALA-TIYKEEGFKAL----------------YKGFVP 267
           ++ R+        V      S   L  TIYKE     L                Y+G+ P
Sbjct: 155 IRVRLAY------VTEHKRISLLGLVKTIYKEPASTTLEAKGYIPNWFAHWCNFYRGYTP 208

Query: 268 KVLRLGPGGGILLVVFTGVMDFFR 291
            VL + P  G+       + D  +
Sbjct: 209 TVLGMIPYAGVSFFAHDLLHDVLK 232

 Score = 28.1 bits (61), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 19/85 (22%), Positives = 39/85 (45%), Gaps = 3/85 (3%)

Query: 6   PLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQ---LQVSGGSGPQYKGVFDCLKQIAAK 62
           PL    + ++G +AG++     YP ++++  +Q   L VS     +++ + +  K I  +
Sbjct: 260 PLRTWAELLSGGLAGMASQTAAYPFEIIRRRLQVSTLSVSQMYDHRFQSISEIAKIIYKE 319

Query: 63  EGPSRLYKGISSPILMEAPKRATKF 87
            G    + G+S   +   P  A  F
Sbjct: 320 RGWRGFFVGLSIGYIKVTPMVACSF 344

>KLLA0E18788g complement(1661093..1662238) similar to sp|P38702
           Saccharomyces cerevisiae YHR002w, start by similarity
          Length = 381

 Score = 62.4 bits (150), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 67/314 (21%), Positives = 124/314 (39%), Gaps = 61/314 (19%)

Query: 14  MAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQY-------KGVFDCLKQIAAKEGPS 66
           +AG VAG     ++ PLD +K + Q      S P Y       +G+ +    I +++   
Sbjct: 58  LAGGVAGSCAKTLIAPLDRIKILFQT-----SNPHYVKYAGSFQGLLNAGVHIWSRDRLR 112

Query: 67  RLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESFVV 126
            +++G S+ +L   P  A KF   ++ + +   +   E  T    + SG+ AG+C  F  
Sbjct: 113 GVFQGHSATLLRIFPYAAVKFIAYEQIRNVI--IPSKEYETHFRRLCSGSLAGLCSVFCT 170

Query: 127 VPFELVKIRLQDVSSKFTSPI-AVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIF 185
            P +L+++RL  V+      +  +VK I  +    A+ +      W    W   Y G I 
Sbjct: 171 YPLDLIRVRLAYVTEHHKVRVWPLVKQIYSEPASEALSSKAYVPKW-FAQWCNFYRGYIP 229

Query: 186 QVRALLPKA----------------------------------------STKSEQ----- 200
            V  ++P A                                        +T++ +     
Sbjct: 230 TVIGMIPYAGVSFFAHDLFHDILRHPVIAPYSVLRVDDLDADDLKVDVQTTRTGKRIPLN 289

Query: 201 TRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKA 260
           T  +LLAG + G  S   + PF++++ R+Q  AV   +  K+         I+ E G++ 
Sbjct: 290 TWAELLAGGLAGMASQTAAYPFEIIRRRLQVGAVTNPLEHKFTSMSEMAKIIFHERGWRG 349

Query: 261 LYKGFVPKVLRLGP 274
            + G     +++ P
Sbjct: 350 FFVGLSIGYIKVTP 363

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/203 (21%), Positives = 80/203 (39%), Gaps = 31/203 (15%)

Query: 113 LSGASAGICESFVVVPFELVKIRLQ-------DVSSKFTSPIAVVKNIVEKEGILAMYNG 165
           L+G  AG C   ++ P + +KI  Q         +  F   +    +I  ++ +  ++ G
Sbjct: 58  LAGGVAGSCAKTLIAPLDRIKILFQTSNPHYVKYAGSFQGLLNAGVHIWSRDRLRGVFQG 117

Query: 166 LESTMWRHGIWNAGYFGIIFQVR-ALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDV 224
             +T+ R   + A  F    Q+R  ++P  S + E     L +G++ G  S   + P D+
Sbjct: 118 HSATLLRIFPYAAVKFIAYEQIRNVIIP--SKEYETHFRRLCSGSLAGLCSVFCTYPLDL 175

Query: 225 VKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKAL----------------YKGFVPK 268
           ++ R+        V       WP +  IY E   +AL                Y+G++P 
Sbjct: 176 IRVRLAYVTEHHKVR-----VWPLVKQIYSEPASEALSSKAYVPKWFAQWCNFYRGYIPT 230

Query: 269 VLRLGPGGGILLVVFTGVMDFFR 291
           V+ + P  G+         D  R
Sbjct: 231 VIGMIPYAGVSFFAHDLFHDILR 253

>Scas_662.12
          Length = 308

 Score = 61.6 bits (148), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 69/299 (23%), Positives = 129/299 (43%), Gaps = 26/299 (8%)

Query: 8   PFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQI------AA 61
           P   + ++G  AG    L+++PLD++K  +QL  +  +    KG    + ++        
Sbjct: 6   PIQKEIISGLSAGSLTTLIVHPLDLIKVRLQLLATTTTQQHQKGYTYLINELINNSKKMG 65

Query: 62  KEGP-----SRLYKGISSPILMEAPKRATKFAC-NDEFQKIYKDLFGAEKLTQPLSILSG 115
            +GP        Y+G+   +L  A   +  F   N     ++++ +     T  + + SG
Sbjct: 66  SQGPIYNLIKESYRGLPINLLGNAVAWSLYFTIYNSTKDYMFQNNYLHNNNT-TIFLTSG 124

Query: 116 ASAGICESFVVVPFELVKIRLQDVSSKFTSPIAVV----KNIVEKEGILAMYNGLESTMW 171
             +GI  + +  P  ++K R+   S         +    K+++ KEG  A++ GL  ++ 
Sbjct: 125 LISGISTTLLTNPLWVIKTRIMSTSRHHKDSYKSIRHGFKSLLTKEGPKAIWMGLLPSLL 184

Query: 172 RHGIWN-AGYFGIIFQVRALLPKASTKSEQTR-NDLLAGTVGGTLSSLLST----PFDVV 225
             G+   A YF I   ++        KS++   N  L   +  +LS +LS     PF ++
Sbjct: 185 --GVSQGAIYFMIYDNLKLHFNVNLNKSKKDNANANLKIVLISSLSKMLSVMSVYPFQLL 242

Query: 226 KSRVQN-TAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVF 283
           KS +Q   +V   +P+        +  IY++ G K LYKG    +LR  P   I   ++
Sbjct: 243 KSNLQTFRSVTNNIPQNDYHFITLIRKIYRDNGIKGLYKGLSANLLRAIPSTCITFCIY 301

>KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces
           cerevisiae YMR241w YHM2 yeast suppressor gene of HM
           (mitochondrial histone) mutant (ABF2) singleton, start
           by similarity
          Length = 308

 Score = 61.6 bits (148), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 76/307 (24%), Positives = 125/307 (40%), Gaps = 42/307 (13%)

Query: 4   QKPLPFVYQFMAGAVAGVSEILVM-YPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAK 62
           +KP+ F    + GA   + E+  +  PL++VKT M       +  Q+   F  +  I ++
Sbjct: 10  KKPISFS-NILLGAGLNMCEVTTLGQPLEVVKTTM------AANRQFT-FFQAINHIWSR 61

Query: 63  EGPSRLYKGISSPILMEAPKRATKF-----ACNDEFQKIYKDLFGAEKLTQPLSILSGAS 117
            G    Y+G+     +EA  +              F+K+  + FGA        I+ G S
Sbjct: 62  GGVFGFYQGLIPWAWIEASTKGAVLLFVSAEAEYHFKKLGLNNFGA-------GIMGGVS 114

Query: 118 AGICESFVVVPF-------ELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTM 170
            G+ ++++ + F       E+ K +     +K  S  A  K I  KEGI  +  G+ +  
Sbjct: 115 GGVAQAYLTMGFCTCMKTVEITKHKSAAAGAK-QSSWAAFKEIYNKEGIRGINKGVNAVA 173

Query: 171 WRHGIWNAGYFGIIFQVRALLPKASTKSE-----QTRNDLLAGTVGGTLSSLLSTPFDVV 225
            R        FG    V   L K + K+           + A  +GG LS+  + P +V+
Sbjct: 174 IRQMTNWGSRFGFSRLVEEGLRKFTGKTNPDDKLTALEKIFASAIGGGLSAW-NQPIEVI 232

Query: 226 KSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVF-T 284
           +  +Q+    P  P+       A   IY+  G K LY+G  P++     G GI   VF  
Sbjct: 233 RVEMQSKTNDPNRPKDLTVG-KAFRYIYQSNGVKGLYRGVTPRI-----GLGIWQTVFMV 286

Query: 285 GVMDFFR 291
           G  D  R
Sbjct: 287 GCGDIAR 293

>AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803)
           [951 bp, 316 aa]
          Length = 316

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 73/290 (25%), Positives = 126/290 (43%), Gaps = 22/290 (7%)

Query: 13  FMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGI 72
           F+AG V G     V+ P++ VK ++Q+Q S  +     G+   +KQ+  +EG   L++G 
Sbjct: 20  FVAGGVGGAVSRTVVSPVERVKILLQVQSS--TTAYNGGLVHAVKQVYKEEGVKGLFRGN 77

Query: 73  SSPILMEAPKRATKFACNDEFQK---IYKDLFGAEKLTQPLSILSGASAGICESFVVVPF 129
               L   P  A ++A   EF K    +    G E+L     ++ GA  G     V  P 
Sbjct: 78  GINCLRIFPYSAVQYAVY-EFCKTRVFHVGQSGHEQLRSWERLVGGALGGGASVLVTYPL 136

Query: 130 ELVKIRL-----------QDVSSKFTSP---IAVVKNIVEKEGIL-AMYNGLESTMWRHG 174
           +LV+ RL           +  +     P   + +++ I  +EG L   Y G+  T     
Sbjct: 137 DLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVV 196

Query: 175 IWNAGYFGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQN-TA 233
            + A  F +  +++AL+P            L  G V G ++  +  PFD+++ R Q  T 
Sbjct: 197 PFVALNFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTM 256

Query: 234 VIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVF 283
               +  +Y     AL TI ++EG +  YKG    ++++ P   +   V+
Sbjct: 257 GQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVY 306

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 48/180 (26%), Positives = 83/180 (46%), Gaps = 15/180 (8%)

Query: 110 LSILSGASAGICESFVVVPFELVKIRLQDVSSKFTSP---IAVVKNIVEKEGILAMYNGL 166
           ++ ++G   G     VV P E VKI LQ  SS        +  VK + ++EG+  ++ G 
Sbjct: 18  IAFVAGGVGGAVSRTVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGN 77

Query: 167 ESTMWRHGIWNAGYFGII-FQVRALLPKASTKSEQTRN--DLLAGTVGGTLSSLLSTPFD 223
                R   ++A  + +  F    +     +  EQ R+   L+ G +GG  S L++ P D
Sbjct: 78  GINCLRIFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERLVGGALGGGASVLVTYPLD 137

Query: 224 VVKSRVQ-NTAVIPGVPRK--YNWSWP-----ALATIYKEE-GFKALYKGFVPKVLRLGP 274
           +V++R+   TA +  + R   ++   P      L  I++EE G +  Y+G  P  L + P
Sbjct: 138 LVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVP 197

>CAGL0G08910g complement(853693..854562) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1, hypothetical
           start
          Length = 289

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 64/305 (20%), Positives = 132/305 (43%), Gaps = 31/305 (10%)

Query: 1   MSDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIA 60
           MSD+   P   + ++G  AG    L+++PLD+ K  +QL ++  +   Y+ ++   + + 
Sbjct: 1   MSDRYT-PLQKEVISGLTAGSVTTLIVHPLDLFKVRLQLLITSTTKKGYRNLWS--EIVG 57

Query: 61  AKEGPSR-LYKGISSPI--------LMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLS 111
           +    +R LY+G++  +        L  A  R  K    +   +I  D    + L+  + 
Sbjct: 58  SDLSLTRELYRGLTVNLVGNTIAWGLYFASYRVAKDYLINYNHRIRND----KDLSSWMY 113

Query: 112 ILSGASAGICESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMW 171
           + + AS+G+  + +  P  ++K R+   ++   + + V++++++ +G+  ++ GL   + 
Sbjct: 114 LSASASSGMLTTVLTNPLWVIKTRMMSKANSDLTSMKVLRDLIKNDGVQGLWKGLVPAL- 172

Query: 172 RHGIWNAGYFGIIFQV--RALLPKASTKSEQTRNDLLAGTVGGTLSSLLST----PFDVV 225
             G+         +      L+ K     E T  + +A T   ++S +LST    PF ++
Sbjct: 173 -VGVSQGALHFTCYDTLKHKLVLKNRDSDEITNLETIAVT---SVSKMLSTSAVYPFQLL 228

Query: 226 KSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTG 285
           KS +Q+        +      P    IY   G    YKG    +LR  P   I   ++  
Sbjct: 229 KSNLQSFQASENDFKLL----PLSKMIYSRSGLLGFYKGLSANLLRSVPSTCITFCIYEN 284

Query: 286 VMDFF 290
              F 
Sbjct: 285 FKSFL 289

>YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to C. elegans mitochondrial
           phosphate carrier protein [903 bp, 300 aa]
          Length = 300

 Score = 60.5 bits (145), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 59/256 (23%), Positives = 113/256 (44%), Gaps = 27/256 (10%)

Query: 29  PLDMVKTVMQLQVSGGSGPQ-YKGVFDCLKQIAAKEGPSRLYKGISSPILMEAPKRATKF 87
           PLD+VK  +Q+       P+ Y       ++I A EG  ++Y G  +  +  + + A K+
Sbjct: 38  PLDLVKCRLQVN------PKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKY 91

Query: 88  ACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESFVVVPFELVKIRLQDVSSKFTSPI 147
              + F+ +Y            + +++ A+A      ++ PFE +K++ Q     F + +
Sbjct: 92  GGYEYFKHLYSSWLSP---GVTVYLMASATAEFLADIMLCPFEAIKVKQQTTMPPFCNNV 148

Query: 148 --AVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFG----IIFQVRALLPKASTKS--- 198
                K   E  G+ A Y G+     R   +    F     I+ ++ ++LPK   +    
Sbjct: 149 VDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNAL 208

Query: 199 EQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWP-ALATIYKEEG 257
           +Q     + G + G L + +S P DV+ S++ +        RK N S   A   IY++ G
Sbjct: 209 QQISVSFVGGYLAGILCAAVSHPADVMVSKINS-------ERKANESMSVASKRIYQKIG 261

Query: 258 FKALYKGFVPKVLRLG 273
           F  L+ G + +++ +G
Sbjct: 262 FTGLWNGLMVRIVMIG 277

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 65/150 (43%), Gaps = 8/150 (5%)

Query: 126 VVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIF 185
           + P +LVK RLQ     +TS +   + I+  EG   +Y G  +T   + +  AG +G   
Sbjct: 36  ITPLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYE 95

Query: 186 QVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWS 245
             + L   +S  S      L+A      L+ ++  PF+ +K + Q T     +P   N  
Sbjct: 96  YFKHLY--SSWLSPGVTVYLMASATAEFLADIMLCPFEAIKVKQQTT-----MPPFCNNV 148

Query: 246 WPALATIYKEE-GFKALYKGFVPKVLRLGP 274
                 +Y E  G KA YKG VP   R  P
Sbjct: 149 VDGWKKMYAESGGMKAFYKGIVPLWCRQIP 178

>YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similarity
           to Grave's disease protein, member of the mitochondrial
           carrier (MCF) family of membrane transporters [1074 bp,
           357 aa]
          Length = 357

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 63/313 (20%), Positives = 126/313 (40%), Gaps = 63/313 (20%)

Query: 14  MAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYK-------GVFDCLKQIAAKEGPS 66
           +AG ++G     ++ PLD +K + Q      S P Y        G+ +  K I   +G  
Sbjct: 38  LAGGISGSCAKTLIAPLDRIKILFQT-----SNPHYTKYTGSLIGLVEAAKHIWINDGVR 92

Query: 67  RLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKL-TQPLSILSGASAGICESFV 125
             ++G S+ +L   P  A KF     +++I   L  +++  +    ++SG+ AG+C  F+
Sbjct: 93  GFFQGHSATLLRIFPYAAVKFVA---YEQIRNTLIPSKEFESHWRRLVSGSLAGLCSVFI 149

Query: 126 VVPFELVKIRLQ-DVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGII 184
             P +LV++RL  +   K      ++K I ++     +        W    W   Y G +
Sbjct: 150 TYPLDLVRVRLAYETEHKRVKLGRIIKKIYKEPASATLIKNDYIPNW-FCHWCNFYRGYV 208

Query: 185 FQVRALLP---------------------------------------KASTKSEQTRNDL 205
             V  ++P                                       K   +  +T  +L
Sbjct: 209 PTVLGMIPYAGVSFFAHDLLHDVLKSPFFAPYSVLELSEDDELERVQKKQRRPLRTWAEL 268

Query: 206 LAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALAT----IYKEEGFKAL 261
           ++G + G  S   + PF++++ R+Q +A+ P     Y+  + +++     I+KE G +  
Sbjct: 269 ISGGLAGMASQTAAYPFEIIRRRLQVSALSPKT--MYDHKFQSISEIAHIIFKERGVRGF 326

Query: 262 YKGFVPKVLRLGP 274
           + G     +++ P
Sbjct: 327 FVGLSIGYIKVTP 339

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/199 (25%), Positives = 92/199 (46%), Gaps = 21/199 (10%)

Query: 113 LSGASAGICESFVVVPFELVKIRLQDVSSKFT----SPIAVV---KNIVEKEGILAMYNG 165
           L+G  +G C   ++ P + +KI  Q  +  +T    S I +V   K+I   +G+   + G
Sbjct: 38  LAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYTGSLIGLVEAAKHIWINDGVRGFFQG 97

Query: 166 LESTMWRHGIWNAGYFGIIFQVR-ALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDV 224
             +T+ R   + A  F    Q+R  L+P    +S   R  L++G++ G  S  ++ P D+
Sbjct: 98  HSATLLRIFPYAAVKFVAYEQIRNTLIPSKEFESHWRR--LVSGSLAGLCSVFITYPLDL 155

Query: 225 VKSRV----QNTAVIPGVPRKYNWSWPALATIYKEE-------GFKALYKGFVPKVLRLG 273
           V+ R+    ++  V  G   K  +  PA AT+ K +        +   Y+G+VP VL + 
Sbjct: 156 VRVRLAYETEHKRVKLGRIIKKIYKEPASATLIKNDYIPNWFCHWCNFYRGYVPTVLGMI 215

Query: 274 PGGGILLVVFTGVMDFFRT 292
           P  G+       + D  ++
Sbjct: 216 PYAGVSFFAHDLLHDVLKS 234

>YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1
           mutant that affects mitochondrial HMG-like DNA-binding
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 59.7 bits (143), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 72/297 (24%), Positives = 128/297 (43%), Gaps = 36/297 (12%)

Query: 3   DQKPLPFVYQFMAGAVAGVSEILVM-YPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAA 61
           ++KP+ F    + GA   +SE+  +  PL++VKT M       +  +     + +K + +
Sbjct: 14  EKKPVSF-SNILLGACLNLSEVTTLGQPLEVVKTTM-------AANRNFTFLESVKHVWS 65

Query: 62  KEGPSRLYKGISSPILMEAP-KRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGI 120
           + G    Y+G+     +EA  K A     + E +  +K L G         IL G + G+
Sbjct: 66  RGGILGYYQGLIPWAWIEASTKGAVLLFVSAEAEYRFKSL-GLNNFAS--GILGGVTGGV 122

Query: 121 CESFVVVPF-------ELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRH 173
            ++++ + F       E+ + +         S  +V KNI +KEGI  +  G+ +   R 
Sbjct: 123 TQAYLTMGFCTCMKTVEITRHKSASAGGVPQSSWSVFKNIYKKEGIRGINKGVNAVAIRQ 182

Query: 174 GIWNAGYFGIIFQVRALLPKASTKSEQTRNDLL-------AGTVGGTLSSLLSTPFDVVK 226
                  FG+   V   + K + K+   ++D L       A  +GG LS+  + P +V++
Sbjct: 183 MTNWGSRFGLSRLVEDGIRKITGKTN--KDDKLNPFEKIGASALGGGLSAW-NQPIEVIR 239

Query: 227 SRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVF 283
             +Q+    P  P+           IY+  G K LY+G  P++     G GI   VF
Sbjct: 240 VEMQSKKEDPNRPKNLTVG-KTFKYIYQSNGLKGLYRGVTPRI-----GLGIWQTVF 290

>YBR192W (RIM2) [375] chr2 (607609..608742) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, required for respiration [1134 bp, 377 aa]
          Length = 377

 Score = 59.7 bits (143), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 79/164 (48%), Gaps = 21/164 (12%)

Query: 29  PLDMVKTVMQLQVSGGSG-PQYKGVFDCLKQIAAKEGPSRLYKGISSP-----------I 76
           P+ ++KT +QL  +G +   QYK  +DCLK +   EG + LYKG+S+            +
Sbjct: 195 PIWLIKTRVQLDKAGKTSVRQYKNSWDCLKSVIRNEGFTGLYKGLSASYLGSVEGILQWL 254

Query: 77  LMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICE---SFVVVPFELVK 133
           L E  KR  K    ++F    +      +  +     SG SAG+ +   S    P E+V+
Sbjct: 255 LYEQMKRLIKERSIEKFGYQAEGTKSTSEKVKEWCQRSG-SAGLAKFVASIATYPHEVVR 313

Query: 134 IRLQDV-----SSKFTSPIAVVKNIVEKEGILAMYNGLESTMWR 172
            RL+         K+T  +   K I+++EG+ +MY+GL   + R
Sbjct: 314 TRLRQTPKENGKRKYTGLVQSFKVIIKEEGLFSMYSGLTPHLMR 357

 Score = 57.4 bits (137), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 76/327 (23%), Positives = 137/327 (41%), Gaps = 66/327 (20%)

Query: 8   PFVYQFMAGAVAGVSEILVMYPLDMVKTVMQ------------LQVSGGS---------- 45
           P+V+ F+AG + G++  +V  P D+VKT +Q            + +S GS          
Sbjct: 52  PWVH-FVAGGIGGMAGAVVTCPFDLVKTRLQSDIFLKAYKSQAVNISKGSTRPKSINYVI 110

Query: 46  --GPQYKGVFDCLKQIAAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGA 103
             G  +K     +  +  +EG   L+KG+   ++   P R+  F      + +Y   F  
Sbjct: 111 QAGTHFKETLGIIGNVYKQEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKDMYAKAFNN 170

Query: 104 EKLTQPLSILSGASAGICESFVVVPFELVKIRLQ-DVSSK-----FTSPIAVVKNIVEKE 157
            + T  + +++ A+AG   +    P  L+K R+Q D + K     + +    +K+++  E
Sbjct: 171 GQETPMIHLMAAATAGWATATATNPIWLIKTRVQLDKAGKTSVRQYKNSWDCLKSVIRNE 230

Query: 158 GILAMYNGLESTMWRHGIWNAGYFG---------IIFQVRALLPKAS----------TKS 198
           G   +Y GL          +A Y G         +  Q++ L+ + S          TKS
Sbjct: 231 GFTGLYKGL----------SASYLGSVEGILQWLLYEQMKRLIKERSIEKFGYQAEGTKS 280

Query: 199 EQTRNDLLAGTVGGT-----LSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIY 253
              +        G       ++S+ + P +VV++R++ T    G  RKY     +   I 
Sbjct: 281 TSEKVKEWCQRSGSAGLAKFVASIATYPHEVVRTRLRQTPKENG-KRKYTGLVQSFKVII 339

Query: 254 KEEGFKALYKGFVPKVLRLGPGGGILL 280
           KEEG  ++Y G  P ++R  P   I+ 
Sbjct: 340 KEEGLFSMYSGLTPHLMRTVPNSIIMF 366

 Score = 36.2 bits (82), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 22/97 (22%), Positives = 43/97 (44%), Gaps = 23/97 (23%)

Query: 217 LLSTPFDVVKSRVQNTAVIPGV-------------PRKYNWSWPA----------LATIY 253
           +++ PFD+VK+R+Q+   +                P+  N+   A          +  +Y
Sbjct: 68  VVTCPFDLVKTRLQSDIFLKAYKSQAVNISKGSTRPKSINYVIQAGTHFKETLGIIGNVY 127

Query: 254 KEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFF 290
           K+EGF++L+KG  P ++ + P   I    +    D +
Sbjct: 128 KQEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKDMY 164

>CAGL0D04774g complement(467712..468680) similar to tr|Q06497
           Saccharomyces cerevisiae YPR128c, start by similarity
          Length = 322

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 77/292 (26%), Positives = 119/292 (40%), Gaps = 56/292 (19%)

Query: 16  GAVAGVSEILVMYPLDMVKTVMQLQV----SGGSGPQ--YKGVFDCLKQIAAKEGPSRLY 69
           GAVA       +YPLD+ KT++Q Q     SG S  +  YK V DC+ +I  K G   LY
Sbjct: 10  GAVASSLAATTVYPLDLAKTLIQTQHKNADSGDSKEEEKYKNVIDCIIKIFKKRGFLGLY 69

Query: 70  KGISSPILMEAPKRATKFACNDEFQKIY----------KDLFGAEKLTQPLSILSGASAG 119
           +G+++ +     +    F      +  Y          KD     +L+    +  G SAG
Sbjct: 70  QGLATNVAANFVQNFIYFFWYSLIRSNYFVFKAGRLQLKDDSKFIELSTIEELALGMSAG 129

Query: 120 ICESFVVVPFELVKIRLQ------DVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRH 173
                V  P  ++  R Q      D S K     AV+K I E+       NG  +  W+ 
Sbjct: 130 AMTQVVTNPISVISTRQQLTKDGEDASLK-----AVIKQIYEES------NGDLTAFWKG 178

Query: 174 -------GIWNAGYFGIIFQVRALL---------PKASTKSEQTRNDLLAGTVGGTLSSL 217
                      A  +G   ++++++          K ST+     N LL G     +S+ 
Sbjct: 179 FKVALVLSTNPAITYGSYQKLKSMILTAKGLSGSQKISTQLSAGENFLL-GMFSKMISTF 237

Query: 218 LSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKV 269
           ++ P  V K  +Q      G   K+      L  IY+ EGF +L+KG +P+V
Sbjct: 238 VTQPLIVAKITLQ------GKGSKFKTFQEVLQHIYQNEGFLSLWKGVIPQV 283

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 77/170 (45%), Gaps = 14/170 (8%)

Query: 6   PLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGP 65
            L  + +   G  AG    +V  P+ ++ T  QL    G     K V   +KQI  +   
Sbjct: 115 ELSTIEELALGMSAGAMTQVVTNPISVISTRQQL-TKDGEDASLKAV---IKQIYEESNG 170

Query: 66  --SRLYKGISSPILMEAPKRATKFACNDEFQKIY---KDLFGAEKLTQPLS----ILSGA 116
             +  +KG    +++ +   A  +    + + +    K L G++K++  LS     L G 
Sbjct: 171 DLTAFWKGFKVALVL-STNPAITYGSYQKLKSMILTAKGLSGSQKISTQLSAGENFLLGM 229

Query: 117 SAGICESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGL 166
            + +  +FV  P  + KI LQ   SKF +   V+++I + EG L+++ G+
Sbjct: 230 FSKMISTFVTQPLIVAKITLQGKGSKFKTFQEVLQHIYQNEGFLSLWKGV 279

 Score = 29.3 bits (64), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 24/102 (23%), Positives = 41/102 (40%), Gaps = 12/102 (11%)

Query: 12  QFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKG 71
            F+ G  + +    V  PL + K  +Q     G G ++K   + L+ I   EG   L+KG
Sbjct: 224 NFLLGMFSKMISTFVTQPLIVAKITLQ-----GKGSKFKTFQEVLQHIYQNEGFLSLWKG 278

Query: 72  ISSPILMEAPKRATKFACNDEFQKI-------YKDLFGAEKL 106
           +   +      +   F   DE  ++       YK++    KL
Sbjct: 279 VIPQVSKGVIVQGLLFTYKDEIVRVIRKLLFLYKNIIARNKL 320

>AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH]
           complement(1114974..1115870) [897 bp, 298 aa]
          Length = 298

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 67/287 (23%), Positives = 118/287 (41%), Gaps = 24/287 (8%)

Query: 1   MSDQKPLPFVYQFMAGAVAGVSEILVMYPLDMV-KTVMQLQVSGGSGPQYKGVFDCLKQI 59
           MS+ +    + + +  A AG+ EI V +P+D + K +M       +  Q   V    ++ 
Sbjct: 1   MSNDQKQSGLARVVGSASAGILEIGVFHPVDTISKRLMSNHTKITNAQQLNDV--VFREH 58

Query: 60  AAKEGPSRLYK---GISSPILMEAPKRATKFA--------CNDEFQKIYKDLFGAEKLTQ 108
           A+K    RL+    G+      +  +R  K+          N  F+  +   FG +    
Sbjct: 59  ASKPFGQRLFTLFPGLGYAATYKIFQRVYKYGGQPFANEFLNKHFKADFDGAFGEKTGKA 118

Query: 109 PLSILSGASAGICESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLES 168
             S  +G+  GI E  V++P +++KI+ Q     F     +   I+  EG + +Y G   
Sbjct: 119 LRSATAGSLIGIGE-IVLLPLDVLKIKRQTNPESFRGRGFL--RILRDEG-MGLYRGWGW 174

Query: 169 TMWRHGIWNAGYFG-IIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKS 227
           T  R+   +   FG   F    +L            + ++   G + S ++S P DV+K+
Sbjct: 175 TAARNAPGSFALFGGNAFAKEYILGLKDYSQATWGQNFVSSIFGASASLIVSAPLDVIKT 234

Query: 228 RVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGP 274
           R+Q+              +  +    K EG  A +KG  PK+L  GP
Sbjct: 235 RIQSRNF-----ESAESGFTIVKNTLKNEGATAFFKGLTPKLLTTGP 276

 Score = 33.5 bits (75), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 37/80 (46%), Gaps = 8/80 (10%)

Query: 12  QFMAGAVAGVSEILVMYPLDMVKTVMQLQ--VSGGSGPQYKGVFDCLKQIAAKEGPSRLY 69
            F++      + ++V  PLD++KT +Q +   S  SG      F  +K     EG +  +
Sbjct: 211 NFVSSIFGASASLIVSAPLDVIKTRIQSRNFESAESG------FTIVKNTLKNEGATAFF 264

Query: 70  KGISSPILMEAPKRATKFAC 89
           KG++  +L   PK    FA 
Sbjct: 265 KGLTPKLLTTGPKLVFSFAI 284

>Kwal_27.11419
          Length = 298

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 64/293 (21%), Positives = 118/293 (40%), Gaps = 43/293 (14%)

Query: 12  QFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKG 71
            F+ G V G++  +++ P D++KT +Q   S         + D ++ I   E P +L+KG
Sbjct: 10  HFIGGFVGGLTSAVILQPFDLLKTRLQQNKS-------SNLLDVVRSI---ETPGQLWKG 59

Query: 72  ISSPILMEAPKRA--------TKFACNDEFQKIYKDLFGAEKLTQPLS----ILSGASAG 119
                L  +   A         + A  D+  K      G+      LS    ++SGA   
Sbjct: 60  TLPSALRTSVGSALFLSTLNIVRSAIADKRVKGIAGKNGSSSFLPQLSMYENLISGAITR 119

Query: 120 ICESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAG 179
                  +P  ++K+R +     + S      +I   EGI  +++G  +T+ R   +   
Sbjct: 120 AAVGVATMPITVLKVRFESTMYNYKSLGEAATHIYRSEGIRGLFSGCGATVMRDAPYAGL 179

Query: 180 YFGIIFQVRALLPKA--------------STKSEQTRNDLLAGTVGGTLSSLLSTPFDVV 225
           Y     Q +  LP+               STK+    N + A +   +L++ +++PFD +
Sbjct: 180 YVLFYEQSKLQLPRILPVWMVEHNESGVFSTKTSTIINSIAAFS-SASLATTITSPFDTI 238

Query: 226 KSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGI 278
           K+R+Q        P +Y        +I + E  + L+ G   ++ R     GI
Sbjct: 239 KTRMQLN------PSQYYGFIQTFKSIIRYERPRNLFDGLSLRLSRKALSAGI 285

 Score = 36.6 bits (83), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 37/79 (46%), Gaps = 11/79 (13%)

Query: 202 RNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKAL 261
           R+  + G VGG  S+++  PFD++K+R+Q            N S   L  +   E    L
Sbjct: 8   RSHFIGGFVGGLTSAVILQPFDLLKTRLQQ-----------NKSSNLLDVVRSIETPGQL 56

Query: 262 YKGFVPKVLRLGPGGGILL 280
           +KG +P  LR   G  + L
Sbjct: 57  WKGTLPSALRTSVGSALFL 75

>CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, hypothetical start
          Length = 307

 Score = 57.4 bits (137), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 74/300 (24%), Positives = 123/300 (41%), Gaps = 38/300 (12%)

Query: 13  FMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGI 72
            +AG+++G+     + PLD VK  ++LQV+    P  K   + L  I  +EG    +KG 
Sbjct: 19  LVAGSLSGLFARTCIAPLDTVK--IKLQVT----PHNKNA-NVLINILKREGIRGFWKGN 71

Query: 73  SSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLT---QPLSILSGASAGICESFVVVPF 129
               +M       +F     +  I   L G   L    Q  S L G+ AG+  S    PF
Sbjct: 72  VPGSIMYIIYGGAQFG---SYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPF 128

Query: 130 ELVKIRLQDVSS-KFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIFQVR 188
           ++++ R    S  +       +  I   EG++  ++G  S+M   G+  A  FG+   ++
Sbjct: 129 DVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIK 188

Query: 189 ALLPKASTKSEQ----TRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNW 244
               + S  S++    T  + LAG + G  S L + P D V+ R+Q    I   P +   
Sbjct: 189 IFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQ----IRNSPNEERH 244

Query: 245 SWPALATIYK----------------EEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMD 288
                  IYK                +EG  +LY+G    +++  P   I L  +   M+
Sbjct: 245 DREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYELFMN 304

 Score = 46.6 bits (109), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 40/187 (21%), Positives = 80/187 (42%), Gaps = 8/187 (4%)

Query: 104 EKLTQPLSILSGASAGICESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMY 163
           E+++   S+++G+ +G+     + P + VKI+LQ       + + +  NI+++EGI   +
Sbjct: 11  EEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLI--NILKREGIRGFW 68

Query: 164 NGLESTMWRHGIWNAGYFGIIFQVRALLPKA-STKSEQTRNDLLAGTVGGTLSSLLSTPF 222
            G       + I+    FG    + + L               L G++ G  SSL S PF
Sbjct: 69  KGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPF 128

Query: 223 DVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVV 282
           DV+++R    +    +  +       +  I+  EG    + G    ++ +G    I+  V
Sbjct: 129 DVLRTRFAANSQGQLIKLR-----DEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGV 183

Query: 283 FTGVMDF 289
           +  +  F
Sbjct: 184 YESIKIF 190

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/184 (21%), Positives = 78/184 (42%), Gaps = 25/184 (13%)

Query: 8   PFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSR 67
           P +Y  + G++AG++  L  YP D+++T    + +  S  Q   + D +  I + EG   
Sbjct: 106 PQLYSCLVGSLAGMTSSLASYPFDVLRT----RFAANSQGQLIKLRDEIMAIWSHEGLMG 161

Query: 68  LYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILS---GASAGICESF 124
            + G  S ++      A  F   +  +   ++         P ++L+   G  +G     
Sbjct: 162 FFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKL 221

Query: 125 VVVPFELVKIRLQDVSS--------KFTSPI----------AVVKNIVEKEGILAMYNGL 166
              P + V+ R+Q  +S        +FT  I           V  ++V++EG L++Y G+
Sbjct: 222 ATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGV 281

Query: 167 ESTM 170
             ++
Sbjct: 282 TMSL 285

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 41/91 (45%), Gaps = 8/91 (8%)

Query: 201 TRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKA 260
           T N L+AG++ G  +     P D VK ++Q   V P     +N +   L  I K EG + 
Sbjct: 15  TTNSLVAGSLSGLFARTCIAPLDTVKIKLQ---VTP-----HNKNANVLINILKREGIRG 66

Query: 261 LYKGFVPKVLRLGPGGGILLVVFTGVMDFFR 291
            +KG VP  +     GG     +T +  F R
Sbjct: 67  FWKGNVPGSIMYIIYGGAQFGSYTYIGSFLR 97

 Score = 34.7 bits (78), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 22/97 (22%), Positives = 44/97 (45%), Gaps = 13/97 (13%)

Query: 1   MSDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQ----YKGVFDCL 56
           +SD++    +   +AG ++G +  L  +PLD V+  +Q++ S           K ++   
Sbjct: 197 LSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSY 256

Query: 57  KQ---------IAAKEGPSRLYKGISSPILMEAPKRA 84
           K          +  +EGP  LY+G++  ++   P  A
Sbjct: 257 KNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTA 293

>CAGL0M05225g 563163..564308 highly similar to sp|P38127
           Saccharomyces cerevisiae YBR192w RIM2 mitochondrial
           carrier protein, start by similarity
          Length = 381

 Score = 57.0 bits (136), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 75/338 (22%), Positives = 142/338 (42%), Gaps = 64/338 (18%)

Query: 8   PFVYQFMAGAVAGVSEILVMYPLDMVKTVMQ------------------------LQVSG 43
           P+V+ F+AG + G++  +V  P D+VKT +Q                        + ++ 
Sbjct: 56  PWVH-FLAGGIGGMAGAVVTCPFDLVKTRLQSDIYQNMYKSQAEALMMNTTRPRIVNLTL 114

Query: 44  GSGPQYKGVFDCLKQIAAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGA 103
            +   +K     +  +  +EG   L+KG+   ++   P R+  F      + IY   F  
Sbjct: 115 QAATHFKETVSIIGNVYRQEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKDIYSKAFNN 174

Query: 104 EKLTQPLSILSGASAGICESFVVVPFELVKIRLQ-DVSSK---FTSPIAVVKNIVEKEGI 159
            +    + +++ A+AG   +    P  +VK R+Q D + K   + +    +K+I+  EGI
Sbjct: 175 GQEAPWIHLMAAATAGWATATATNPIWMVKTRVQLDKAGKTRTYKNSYDCLKSILRNEGI 234

Query: 160 LAMYNGLESTMWRHGIWNAGYFG---------IIFQVRALLPK-------ASTKSEQTRN 203
             +Y GL          +A Y G         +  Q++ L+ K       A  +S  T  
Sbjct: 235 YGLYRGL----------SASYLGSVEGILQWLLYEQLKHLIKKRSIEKFGAHDESTMTTT 284

Query: 204 DLL---AGTVGGT-----LSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKE 255
           D +       GG      ++S+++ P +VV++R++ + +  G   KY     +   I KE
Sbjct: 285 DKIKQWCQRSGGAGLAKFMASIVTYPHEVVRTRLRQSPLENG-KVKYTGLVQSFRVIIKE 343

Query: 256 EGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFFRTV 293
           EG  ++Y G  P ++R  P   I+   +  V+     +
Sbjct: 344 EGLASMYSGLTPHLMRTVPNSIIMFGTWEVVIKLLSDI 381

>AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH]
           complement(1314627..1315508) [882 bp, 293 aa]
          Length = 293

 Score = 56.2 bits (134), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 66/291 (22%), Positives = 128/291 (43%), Gaps = 28/291 (9%)

Query: 12  QFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSR-LYK 70
           + ++G  AG    +  +PLD++K  +QL     +   Y G+   ++ I  ++   R LY+
Sbjct: 11  EVISGLTAGTITTIASHPLDLLKLRLQLSAGNRANTTYTGL---IRDIFERQQWGRELYR 67

Query: 71  GISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLS--------ILSGASAGICE 122
           G+   +L  +   A  F C    + I     G E  T  +         +L+  S+GI  
Sbjct: 68  GLGVNLLGNSVAWALYFGCYRCAKDIALRHLGNESATGIMDRRLPAHAYMLAAGSSGIAT 127

Query: 123 SFVVVPFELVKIRLQDVSSK--FTSPIAVVKNIVEKEGILAMYNGLESTMWRHGI-WNAG 179
           + +  P  ++K R+   S    + S    V  + + EG+LA + G+  ++   G+   A 
Sbjct: 128 AVLTNPIWVIKTRIMATSRAGPYKSTFDGVYKLYQTEGVLAFWRGVVPSLL--GVSQGAI 185

Query: 180 YFGIIFQVRALLPKASTKSEQTR---NDLLAGTVGGTLSSLLST-PFDVVKSRVQNTAVI 235
           YF +   ++     +ST   + R   ++++  T    + S+ S  PF ++KS++Q+    
Sbjct: 186 YFALYDTLKFHYLHSSTDKAERRLSVSEIIGITCISKMISVTSVYPFQLLKSKLQDFGAP 245

Query: 236 PGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGV 286
            G+ +        + T+Y  EG +  Y+G    +LR  P   I   V+  +
Sbjct: 246 SGITQ-------LVQTVYSREGIRGFYRGLSANLLRAVPATCITFFVYENI 289

 Score = 34.7 bits (78), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 87/186 (46%), Gaps = 16/186 (8%)

Query: 102 GAEKLTQPLSILSGASAGICESFVVVPFELVKIRLQDVSSKF--TSPIAVVKNIVEKEGI 159
           G E  +    ++SG +AG   +    P +L+K+RLQ  +     T+   ++++I E++  
Sbjct: 2   GHELTSLQREVISGLTAGTITTIASHPLDLLKLRLQLSAGNRANTTYTGLIRDIFERQQW 61

Query: 160 -LAMYNGLESTMWRHGIWNAGYFGII-----FQVRALLPKASTKSEQTR----NDLLAGT 209
              +Y GL   +  + +  A YFG         +R L  +++T     R      +LA  
Sbjct: 62  GRELYRGLGVNLLGNSVAWALYFGCYRCAKDIALRHLGNESATGIMDRRLPAHAYMLAAG 121

Query: 210 VGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKV 269
             G  +++L+ P  V+K+R+  T+        Y  ++  +  +Y+ EG  A ++G VP +
Sbjct: 122 SSGIATAVLTNPIWVIKTRIMATS----RAGPYKSTFDGVYKLYQTEGVLAFWRGVVPSL 177

Query: 270 LRLGPG 275
           L +  G
Sbjct: 178 LGVSQG 183

>ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH]
           complement(355977..356906) [930 bp, 309 aa]
          Length = 309

 Score = 56.2 bits (134), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 59/281 (20%), Positives = 116/281 (41%), Gaps = 27/281 (9%)

Query: 29  PLDMVKTVMQLQ--VSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGISSPILMEAPKRATK 86
           P++ VKT +QLQ  +  G    Y G    +  I   EG   L +G++     +     ++
Sbjct: 31  PIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLNGSR 90

Query: 87  FACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESFVVV-----PFELVKIRLQDVSS 141
               D  +        +++ T   + L+  +     + ++      P +LVK R+Q ++ 
Sbjct: 91  LGLYDPLRAALGGCVLSDRRTYGTAALAVNATAGAAAGMIGAALGSPLQLVKTRMQALAP 150

Query: 142 KFTSPI-----AVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIFQVRALLPKAST 196
           +   P+       +  + +  G+  +Y G+++ + R G+ +A    +    +  L     
Sbjct: 151 RRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEAL----- 205

Query: 197 KSEQTRNDLLAGTVGGTLSS----LLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATI 252
            S    + +   T+   LSS    +   PFDV  +R+ +     G+   Y      L   
Sbjct: 206 -SRHVPDGMALYTLASALSSVAVCIAMNPFDVAMTRMYHHR--GGL---YRGPLDCLCKT 259

Query: 253 YKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFFRTV 293
            ++EGF ALYKG + ++LR+ P   + L +    +   R V
Sbjct: 260 VRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRVVRLV 300

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 38/82 (46%), Gaps = 4/82 (4%)

Query: 1   MSDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIA 60
           +S   P       +A A++ V+  + M P D+  T M     G     Y+G  DCL +  
Sbjct: 205 LSRHVPDGMALYTLASALSSVAVCIAMNPFDVAMTRMYHHRGG----LYRGPLDCLCKTV 260

Query: 61  AKEGPSRLYKGISSPILMEAPK 82
            +EG S LYKG  + +L  AP 
Sbjct: 261 RQEGFSALYKGHLAQLLRIAPH 282

>Sklu_2194.3 YMR241W, Contig c2194 5245-6183
          Length = 312

 Score = 56.2 bits (134), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 68/307 (22%), Positives = 125/307 (40%), Gaps = 41/307 (13%)

Query: 4   QKPLPFVYQFMAGAVAGVSEILVM-YPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAK 62
           +KP+ F    + GA   + E+  +  PL+++KT M    S          F+ +K + ++
Sbjct: 13  KKPISF-SNILLGAGLNMCEVTTLGQPLEVIKTTMAANRS-------FSFFNAIKHVWSR 64

Query: 63  EGPSRLYKGISSPILMEAPKRAT-----KFACNDEFQKIYKDLFGAEKLTQPLSILSGAS 117
            G    Y+G+     +EA  +             +F+++    FG+        I+ G +
Sbjct: 65  GGVFGFYQGLIPWAWIEASTKGAVLLFVSAESEYQFKRMGLSNFGS-------GIMGGVT 117

Query: 118 AGICESFVVVPF-------ELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTM 170
            G+ ++++ + F       E+ K +     +   S     K I +K+GI  +  G+ +  
Sbjct: 118 GGVAQAYLTMGFCTCMKTVEITKKKSAGAGAIPQSSWGAFKEIYKKDGIKGINKGVNAVA 177

Query: 171 WRHGIWNAGYFGIIFQVRALLPKASTKSE-----QTRNDLLAGTVGGTLSSLLSTPFDVV 225
            R        FG    V   +  A+ K+           + A  +GG LS+  + P +V+
Sbjct: 178 IRQMTNWGSRFGFSRLVEEGIRNATGKTNPDDKLTALEKIAASAIGGGLSAW-NQPIEVI 236

Query: 226 KSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVF-T 284
           +  +Q+    P  P+    S  A   IY+  G K LY+G  P++     G G+   VF  
Sbjct: 237 RVEMQSKKEDPNRPKNLTVS-SAFKYIYQSSGIKGLYRGVAPRI-----GLGVWQTVFMV 290

Query: 285 GVMDFFR 291
           G  D  R
Sbjct: 291 GFGDMAR 297

>KLLA0A00979g complement(92561..93592) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), start by similarity
          Length = 343

 Score = 56.2 bits (134), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 82/352 (23%), Positives = 135/352 (38%), Gaps = 91/352 (25%)

Query: 1   MSDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIA 60
           MSD  P       +AG+ A V +  + +P + +KT  QL  S  +   +  +F  +K   
Sbjct: 1   MSDTNP-SLYSNLLAGSAAAVFQTTLSHPFEFLKTGQQLHRSLPNAEAF-NMFHHVKSYF 58

Query: 61  AKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLS----ILSGA 116
           A  G S L  GI         K AT+FA  D+  ++ KD    E    P+S    I +G+
Sbjct: 59  A--GCSALNIGI-------LLKTATRFATFDKACQLLKD---PENPEAPVSGLRLIAAGS 106

Query: 117 SAGICESFVVVP------------------------------------------------ 128
             G  ES +++P                                                
Sbjct: 107 ITGFMESMLIIPFENIKTRMIENALILSNRYQEEVETGGKDKPRSKSVNNMETKEQIRPK 166

Query: 129 -FELVKIRLQDVSSKF--------TSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAG 179
            ++ VK  +     KF        T+    V+ +V+  G    + G   T++R    +A 
Sbjct: 167 LYKQVKKEINPRYEKFLYYEKHPSTNIFTTVREMVQTRGFTTFFQGSMPTIFRQVGNSAV 226

Query: 180 YFGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVP 239
            F     ++ ++      SE     +  G         L+ P DVVK+R+Q+        
Sbjct: 227 RFTTYTTLKQMISPNKPLSEYYAFGI--GVFSSCAVVALTQPIDVVKTRMQS-------- 276

Query: 240 RKYNWSW--PALATIYK---EEGFKALYKGFVPKVLRLGPGGGILLVVFTGV 286
            KY WS    +L  +Y+   EEG  +L+KG+VP++ ++G  GG+   V+  V
Sbjct: 277 -KYTWSLYRNSLNCVYRTFIEEGLTSLWKGWVPRLFKVGLSGGVSFGVYQYV 327

>CAGL0K07436g complement(734496..735419) highly similar to sp|Q04013
           Saccharomyces cerevisiae YMR241w, hypothetical start
          Length = 307

 Score = 55.8 bits (133), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 75/309 (24%), Positives = 131/309 (42%), Gaps = 42/309 (13%)

Query: 3   DQKPLPFVYQFMAGAVAGVSEILVM-YPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAA 61
           ++KP+ F    + GA   +SE+  +  PL++VKT M       +  +        K + +
Sbjct: 6   EKKPVSF-SNILLGAGLNLSEVTTLGQPLEVVKTTM-------AAHREFNFLQATKHVWS 57

Query: 62  KEGPSRLYKGISSPILMEAP-KRATKFACNDEFQKIYKDL----FGAEKLTQPLSILSGA 116
           + G    Y+G+     +EA  K A     + E +  +K L    FGA        I+ G 
Sbjct: 58  RGGIFGFYQGLIPWAWIEASTKGAVLLFVSAEAEYRFKVLGLNNFGA-------GIMGGI 110

Query: 117 SAGICESFVVVPF-------ELVKIRLQDVSSKF-TSPIAVVKNIVEKEGILAMYNGLES 168
           + G+ ++++ + F       E+ + +  +V      S   V K+I +KEGI  +  G+ +
Sbjct: 111 TGGVTQAYLTMGFCTCMKTVEITRQKAANVPGVIPQSSWQVFKSIYKKEGIRGINKGVNA 170

Query: 169 TMWRHGIWNAGYFGIIFQVRALLPKASTKSEQTR-----NDLLAGTVGGTLSSLLSTPFD 223
              R        FG+   V   + K + K+ +         ++A  +GG LS+  + P +
Sbjct: 171 VAIRQMTNWGSRFGLSRLVEDGIRKLTGKTGKDDKLTALEKIMASAIGGGLSAW-NQPIE 229

Query: 224 VVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVF 283
           V++  +Q+    P  P+           IY+  G K LY+G  P+V     G GI   VF
Sbjct: 230 VIRVEMQSKKEDPNRPKNLTVG-KTFKYIYQSNGLKGLYRGVTPRV-----GLGIWQTVF 283

Query: 284 -TGVMDFFR 291
             G  D  R
Sbjct: 284 MVGFGDMAR 292

>AAR036W [222] [Homologous to ScYGR096W - SH]
           complement(406887..407840) [954 bp, 317 aa]
          Length = 317

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 71/290 (24%), Positives = 116/290 (40%), Gaps = 30/290 (10%)

Query: 10  VYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLY 69
           ++  +AG+V+G+    V  P+D VK   QLQ++  S  +Y G+    + +A +EG   L+
Sbjct: 25  LHAVVAGSVSGLVARSVTAPMDTVKIRRQLQLA--SEHKYHGILHTFRTVAREEGVRALW 82

Query: 70  KGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESFVVVPF 129
           KG      M     + +F     +  +      A    Q  S+  GA AG+  S +  P 
Sbjct: 83  KGNVPASAMYVLYGSLQFGT---YAWLNTAAASAGLPPQAHSLAVGALAGLVSSLLTYPL 139

Query: 130 ELVKIRL-QDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAG----YFGII 184
           +L++ RL  + S+ F S     + I + EG    + G        G W         G+I
Sbjct: 140 DLLRTRLVANRSAHFFSLRRQARVIWDTEGPAGFFRG--------GAWAIAATTLTTGLI 191

Query: 185 FQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQ--NTAVIPGVPRKY 242
           F +      A+           A    G +S     P D V+ R+Q  +   IP   R  
Sbjct: 192 FGIYETCTIAADTYGLPWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDP 251

Query: 243 NWSWPAL---------ATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVF 283
             ++ AL           + + EG  +LYKG    + +  P   I L V+
Sbjct: 252 G-AYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVY 300

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 43/175 (24%), Positives = 70/175 (40%), Gaps = 25/175 (14%)

Query: 8   PFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSR 67
           P  +    GA+AG+   L+ YPLD+++T +    S      +  +    + I   EGP+ 
Sbjct: 117 PQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSA----HFFSLRRQARVIWDTEGPAG 172

Query: 68  LYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESFVVV 127
            ++G +  I          F    E   I  D +G   L    S     +AG+     V 
Sbjct: 173 FFRGGAWAIAATTLTTGLIFGIY-ETCTIAADTYGLPWLAAAAS----PTAGLVSKAAVF 227

Query: 128 PFELVKIRLQDVSSKF----------------TSPIAVVKNIVEKEGILAMYNGL 166
           P + V+ RLQ V +K                 T  + +  ++V  EGI ++Y GL
Sbjct: 228 PLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGL 282

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 33/155 (21%), Positives = 69/155 (44%), Gaps = 12/155 (7%)

Query: 78  MEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESFVVVPFELVKIRLQ 137
           M A   + + A  D  +K        E ++   ++++G+ +G+    V  P + VKIR Q
Sbjct: 1   MAASSGSPQLATEDHLRK-------GEAVSGLHAVVAGSVSGLVARSVTAPMDTVKIRRQ 53

Query: 138 ---DVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIFQVRALLPKA 194
                  K+   +   + +  +EG+ A++ G       + ++ +  FG    +      A
Sbjct: 54  LQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTYAWLNTAAASA 113

Query: 195 STKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRV 229
               +   + L  G + G +SSLL+ P D++++R+
Sbjct: 114 GLPPQA--HSLAVGALAGLVSSLLTYPLDLLRTRL 146

>AGR383W [4694] [Homologous to ScYDL119C - SH]
           complement(1436769..1437650) [882 bp, 293 aa]
          Length = 293

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 81/184 (44%), Gaps = 21/184 (11%)

Query: 109 PLSILSGASAGICESFVVVPFELVKIRLQDV-SSKFTSPIAVVKNIVEKEGILAMYNGLE 167
           P  ++SG   G+     + P +L+K RLQ   +S   S +  V+   E      ++ G  
Sbjct: 9   PAHLVSGFFGGLASVCALQPLDLLKTRLQQAQASSLRSVLREVRTTRE------LWRGTL 62

Query: 168 STMWRHGIWNAGYFGIIFQVRALLPKAS---TKSE-----QTRNDLLAGTVGGTLSSLLS 219
            +  R  I +A Y  ++   R+ L + S   T+S      Q+  +LL G +      L++
Sbjct: 63  PSALRTSIGSALYLSLLNYSRSALARGSEARTRSSLLPRLQSYQNLLTGALSRAAVGLVT 122

Query: 220 TPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGIL 279
            P  V+K R ++T         YN    A   I++ EG +  +KG     LR  P  G+ 
Sbjct: 123 MPITVIKVRYESTLY------AYNGLAEATRHIWRSEGARGFFKGAAATTLRDAPYAGLY 176

Query: 280 LVVF 283
           ++++
Sbjct: 177 VLLY 180

 Score = 50.1 bits (118), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 54/273 (19%), Positives = 107/273 (39%), Gaps = 23/273 (8%)

Query: 12  QFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKG 71
             ++G   G++ +  + PLD++KT +Q Q    S           +++     PS L   
Sbjct: 11  HLVSGFFGGLASVCALQPLDLLKTRLQ-QAQASSLRSVLREVRTTRELWRGTLPSALRTS 69

Query: 72  ISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESFVVVPFEL 131
           I S + +     +          +    L    +L    ++L+GA +      V +P  +
Sbjct: 70  IGSALYLSLLNYSRSALARGSEARTRSSLL--PRLQSYQNLLTGALSRAAVGLVTMPITV 127

Query: 132 VKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIFQVRALL 191
           +K+R +     +       ++I   EG    + G  +T  R   +   Y  +  Q + +L
Sbjct: 128 IKVRYESTLYAYNGLAEATRHIWRSEGARGFFKGAAATTLRDAPYAGLYVLLYEQAKEML 187

Query: 192 PKA----------STKSEQTRNDLLAGT---VGGTLSSLLSTPFDVVKSRVQNTAVIPGV 238
           P+A          S K     + ++ G    +  +L++ L+ PFD +K+R+Q  +   G 
Sbjct: 188 PRALPATLLGADESGKLTAPASAMVNGVSAFLSASLATTLTAPFDTIKTRMQLQSHPVGF 247

Query: 239 PRKYNWSWPALATIYKEEGFKALYKGFVPKVLR 271
            +        L  I  EE  + L+ G   ++ R
Sbjct: 248 VQT-------LRHIVCEERARTLFDGLSLRLCR 273

>YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the
           mitochondrial carrier family (MCF) family of membrane
           transporters [858 bp, 285 aa]
          Length = 285

 Score = 53.1 bits (126), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 49/218 (22%), Positives = 91/218 (41%), Gaps = 48/218 (22%)

Query: 104 EKLTQPLSILSGASAGICESFVVVPFELVKIRL------------------------QDV 139
           ++LT    +++G   GI ES  ++PFE +K  L                          V
Sbjct: 71  QRLTGYNLLIAGTLTGIVESLFIIPFENIKTTLIQSAMIDHKKLEKNQPVVNAKATFHKV 130

Query: 140 SSKFTSPIA-------VVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIFQVRALLP 192
           ++K ++P+A        VK++ +  G  A   G  +T++R     +  F      + LL 
Sbjct: 131 ATK-STPVARIEKLLPAVKHMYQTRGPAAFVQGTTATIFRQIANTSIQFTAYTAFKRLL- 188

Query: 193 KASTKSEQTRNDLLAGTVGGTLSSL----LSTPFDVVKSRVQNTAVIPGVPRKYNWSWPA 248
                  Q RND  +  + G  +S     ++ P DVVK+R+ +         +Y  +   
Sbjct: 189 -------QARNDKASSVITGLATSFTLVAMTQPIDVVKTRMMS----QNAKTEYKNTLNC 237

Query: 249 LATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGV 286
           +  I+ +EG    +KG + + +++G  GG+   V+  V
Sbjct: 238 MYRIFVQEGMATFWKGSIFRFMKVGISGGLTFTVYEQV 275

>AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH]
           complement(1408478..1409410) [933 bp, 310 aa]
          Length = 310

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 61/285 (21%), Positives = 115/285 (40%), Gaps = 35/285 (12%)

Query: 3   DQKPLPFVYQFMAGAVAGVSEILVM-YPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAA 61
            +KP+ F      GA   + E+  +  PL++ KT M       +  Q+ G    ++ + +
Sbjct: 11  QKKPVSF-SNIALGAALNMCEVTTLGQPLEVTKTTM------AANRQF-GFSQAVRHVWS 62

Query: 62  KEGPSRLYKGISSPILMEAPKRATKF-----ACNDEFQKIYKDLFGAEKLTQPLSILSGA 116
           + G    Y+G+     +EA  +             +F+++    FGA        IL G 
Sbjct: 63  RGGVFGFYQGLIPWAWIEASTKGAVLLFVSAEAEYQFRRLGLSNFGA-------GILGGV 115

Query: 117 SAGICESFVVVPFELVKIRLQDVSSKFTSP--------IAVVKNIVEKEGILAMYNGLES 168
           S G+ ++++ + F      ++   SK  S         + V K I   EG+  +  G+ +
Sbjct: 116 SGGVAQAYLTMGFCTCMKTVEITRSKAASAPGVPVPSSLQVFKQIFAAEGLRGINKGVNA 175

Query: 169 TMWRHGIWNAGYFGIIFQV----RALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDV 224
              R        FG+   V    R +  K S +       ++A  +GG LS+  + P +V
Sbjct: 176 VAIRQMTNWGSRFGLSRLVEDGIRRVTHKRSDEKLSAMEKIVASALGGGLSAW-NQPIEV 234

Query: 225 VKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKV 269
           ++  +Q+    P  P+           IY+  G + LY+G  P++
Sbjct: 235 IRVEMQSRTNDPNRPKNLTVG-KTFRYIYENNGLRGLYRGVTPRI 278

>KLLA0F04697g complement(461126..462049) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1 FAD carrier
           protein (MCF), mitochondrial, start by similarity
          Length = 307

 Score = 53.1 bits (126), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 85/183 (46%), Gaps = 22/183 (12%)

Query: 112 ILSGASAGICESFVVVPFELVKIRLQ----DV--SSKFTSPIAVVKNIVEKEGIL-AMYN 164
           I+SG +AG   + V  P +L+K+RLQ    D+  SS +     ++K+    + +L   Y 
Sbjct: 16  IISGLTAGTITTIVTHPLDLIKLRLQLAAIDLKPSSYYNQVQRIIKDGSGTQQLLKEAYR 75

Query: 165 GLESTMWRHGIWNAGYFGIIFQVRALLPKASTK---SEQTRND--------LLAGTVGGT 213
           GL   +  + +    YFG+    + ++   S++     +  ND        L++    G 
Sbjct: 76  GLGINIIGNAVAWGLYFGLYRCSKDVVYSLSSEPALQNKFMNDRKMTSSMYLVSAGASGL 135

Query: 214 LSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLG 273
            ++LL+ P  V+K+R+ +T    G     N    A+  IY EEG K  ++G VP +  + 
Sbjct: 136 ATALLTNPMWVIKTRIMSTKSSQGYTSILN----AITRIYTEEGLKTFWRGLVPSLFGVT 191

Query: 274 PGG 276
            G 
Sbjct: 192 QGA 194

 Score = 50.8 bits (120), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 62/308 (20%), Positives = 122/308 (39%), Gaps = 34/308 (11%)

Query: 8   PFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAK-EGPS 66
           P   + ++G  AG    +V +PLD++K  +QL         Y   ++ +++I     G  
Sbjct: 11  PLQKEIISGLTAGTITTIVTHPLDLIKLRLQLAAIDLKPSSY---YNQVQRIIKDGSGTQ 67

Query: 67  RL----YKGISSPILMEAPKRATKFA---CNDEFQ-------KIYKDLFGAEKLTQPLSI 112
           +L    Y+G+   I+  A      F    C+ +          +        K+T  + +
Sbjct: 68  QLLKEAYRGLGINIIGNAVAWGLYFGLYRCSKDVVYSLSSEPALQNKFMNDRKMTSSMYL 127

Query: 113 LSGASAGICESFVVVPFELVKIRLQDVSSK--FTSPIAVVKNIVEKEGILAMYNGLESTM 170
           +S  ++G+  + +  P  ++K R+    S   +TS +  +  I  +EG+   + GL  ++
Sbjct: 128 VSAGASGLATALLTNPMWVIKTRIMSTKSSQGYTSILNAITRIYTEEGLKTFWRGLVPSL 187

Query: 171 WRHGIWNAGYFGIIFQVRALLPKASTKSEQTRNDLLAGTVG-GTLSSLLST----PFDVV 225
           +  G+     +  I+    L         Q R      T+G  +LS ++S     P  ++
Sbjct: 188 F--GVTQGALYFAIYDTLKLKYLHDRNDIQERRLNAVETIGIISLSKMISVSSVYPLQLL 245

Query: 226 KSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTG 285
           K+ +Q          K N     + +I+   G    YKG    ++R  P   I      G
Sbjct: 246 KTNLQTFRTEHNENSKMN---SLIRSIWHTNGIAGFYKGLFANLVRAIPSTCITF----G 298

Query: 286 VMDFFRTV 293
           V + F+ +
Sbjct: 299 VYEHFKHI 306

>KLLA0E08877g complement(791157..792041) similar to sgd|S0002277
           Saccharomyces cerevisiae YDL119c, start by similarity
          Length = 294

 Score = 53.1 bits (126), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 44/190 (23%), Positives = 87/190 (45%), Gaps = 20/190 (10%)

Query: 103 AEKLTQPLSILSGASAGICESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAM 162
           +E+      ++ G S G+  + ++ PF+L+K RLQ    K ++    +K+I   E    +
Sbjct: 2   SEQRRATTHLIGGFSGGLVSAIILQPFDLLKTRLQQ--DKTSTLWKTLKSI---ETPSQL 56

Query: 163 YNGLESTMWRHGIWNAGYFGIIFQVRALLPK----ASTKSE-----QTRNDLLAGTVGGT 213
           + G   +  R  + +A Y  ++  +R  + K     ST S          ++ +G V   
Sbjct: 57  WRGALPSCIRTSVGSAMYLTMLNSIRQAISKGKNTGSTGSSYLPQLNMYENMFSGAVTRA 116

Query: 214 LSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLG 273
           L+ L++ P  V+K R ++T        +Y     A + I++ EG +  ++GF    LR  
Sbjct: 117 LTGLITMPITVIKVRYESTLY------QYTSLRYATSHIFRTEGLRGFFRGFGATALRDA 170

Query: 274 PGGGILLVVF 283
           P  G+ ++ +
Sbjct: 171 PYAGLYMLFY 180

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 65/312 (20%), Positives = 122/312 (39%), Gaps = 41/312 (13%)

Query: 1   MSDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIA 60
           MS+Q+        + G   G+   +++ P D++KT +Q         +   ++  LK I 
Sbjct: 1   MSEQRRA--TTHLIGGFSGGLVSAIILQPFDLLKTRLQQD-------KTSTLWKTLKSI- 50

Query: 61  AKEGPSRLYKGISSPILMEAPKRATKFA-CNDEFQKIYKDLFGAE-------KLTQPLSI 112
             E PS+L++G     +  +   A      N   Q I K             +L    ++
Sbjct: 51  --ETPSQLWRGALPSCIRTSVGSAMYLTMLNSIRQAISKGKNTGSTGSSYLPQLNMYENM 108

Query: 113 LSGASAGICESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWR 172
            SGA        + +P  ++K+R +    ++TS      +I   EG+   + G  +T  R
Sbjct: 109 FSGAVTRALTGLITMPITVIKVRYESTLYQYTSLRYATSHIFRTEGLRGFFRGFGATALR 168

Query: 173 HGIWNAGYFGIIFQ-----VRALLPKASTK-SEQTRNDLLAGTV--------GGTLSSLL 218
              + AG + + +      V  LLP    K +   R    A T+           +++ +
Sbjct: 169 DAPY-AGLYMLFYDRMKVLVPTLLPSNVVKLNSDNRYSTYASTLINGSSAFSAAVIATSI 227

Query: 219 STPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGI 278
           + PFD VK+R+Q        P K++        I  +E  + L+ G   ++ R     GI
Sbjct: 228 TAPFDTVKTRMQLE------PAKFHSFTSTFWHIATKESVRNLFAGISLRLTRKAFSAGI 281

Query: 279 LLVVFTGVMDFF 290
              ++  ++  F
Sbjct: 282 AWGIYEEIVKKF 293

>YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 53.1 bits (126), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 59/289 (20%), Positives = 115/289 (39%), Gaps = 29/289 (10%)

Query: 12  QFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKG 71
             + G   G++  + + PLD++KT +Q           K + D   Q+     PS L   
Sbjct: 13  HLIGGFFGGLTSAVALQPLDLLKTRIQQDKKATLWKNLKEI-DSPLQLWRGTLPSALRTS 71

Query: 72  ISSPILME---------APKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICE 122
           I S + +          A +R    +  ++   +Y       +LT   ++L+GA A    
Sbjct: 72  IGSALYLSCLNLMRSSLAKRRNAVPSLTNDSNIVYNKSSSLPRLTMYENLLTGAFARGLV 131

Query: 123 SFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFG 182
            ++ +P  ++K+R +     ++S    + +I  KEG+   + G  +T  R   +   Y  
Sbjct: 132 GYITMPITVIKVRYESTLYNYSSLKEAITHIYTKEGLFGFFRGFGATCLRDAPYAGLYVL 191

Query: 183 IIFQVRALLPKASTKSEQTRN-------------DLLAGTVGGTLSSLLSTPFDVVKSRV 229
           +  + + LLP          N             +  +  +  +L++ ++ PFD +K+R+
Sbjct: 192 LYEKSKQLLPMVLPSRFIHYNPEGGFTTYTSTTVNTTSAVLSASLATTVTAPFDTIKTRM 251

Query: 230 QNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGI 278
           Q        P K+  S+    +I K E    L+ G   ++ R     GI
Sbjct: 252 QLE------PSKFTNSFNTFTSIVKNENVLKLFSGLSMRLARKAFSAGI 294

>CAGL0C02013g complement(209930..210919) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1, hypothetical
           start
          Length = 329

 Score = 52.8 bits (125), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 77/329 (23%), Positives = 138/329 (41%), Gaps = 73/329 (22%)

Query: 1   MSDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIA 60
           M+  K    V    AG+V+G+    + YP + +KT +QL  +  +   ++ +   ++   
Sbjct: 1   MTQNKVNDNVTLITAGSVSGLFSATITYPFEFLKTGLQLHRNVVAAKPFEVLGYQVRTYF 60

Query: 61  AKEGPSRLYKGISSPILMEAPKRATKFACNDEFQK---IYKDLFGAEKLTQPLS----IL 113
           A  G S +  G+    +M+   R   F    E+ +   + KD         PLS    ++
Sbjct: 61  A--GCSAVNIGV----VMKTSLRFLAFDKASEWLRPPALAKD--------APLSGVQLLM 106

Query: 114 SGASAGICESFVVVPFELVKI-----------RLQDVSSKFTSPIA--VVKNIVEKEGIL 160
           +GA  G  ES  ++PFE VK+           RL   +S     +A  V K   +K  + 
Sbjct: 107 AGALTGTMESLCIIPFENVKVAMIQNSLLSHERLNTTTSNVQGQVANEVKKTFHKKPTLR 166

Query: 161 AMYNGL------------ESTMWR-HGIWNAGYFG--------------IIFQVRALLPK 193
           + Y  L             + ++R HG+    YF               + F    +L +
Sbjct: 167 SSYEALFPEKLPTNVLTTAAELYRQHGL--RAYFKGTMPTLMRQVGNSVVRFTTFTMLKQ 224

Query: 194 ASTKSEQTRNDLLAGTVGGTLSSLL----STPFDVVKSRVQNTAVIPGVPRKYNWSWPAL 249
            + K  Q  N+    T+ G +SS      + P DV+K+R+Q    +       N ++   
Sbjct: 225 FAPKEYQ--NNEYFATLLGLISSCAVVGATQPLDVIKTRMQAKDSVLLYRNSINCAY--- 279

Query: 250 ATIYKEEGFKALYKGFVPKVLRLGPGGGI 278
             I+ EEGF  L+KG++P+++++G  G +
Sbjct: 280 -RIFVEEGFAMLWKGWLPRLMKVGLSGSV 307

>Kwal_23.3042
          Length = 542

 Score = 53.1 bits (126), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 67/317 (21%), Positives = 126/317 (39%), Gaps = 52/317 (16%)

Query: 13  FMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGI 72
           F+AG V+GV       P D +K  +  +    S       F   K I  ++ P+     I
Sbjct: 228 FIAGGVSGVVSRTCTAPFDRIKVFLIARTDLSS------TFLKSKDIILEKNPNADLSKI 281

Query: 73  SSPILMEA------------------------PKRATKFACNDEFQKIYKDLFGAEK--- 105
            SP++  A                        P+ A KF   +  +++   L G +    
Sbjct: 282 KSPLVKAATTLYRQGGIRAFYVGNGLNAMKVFPESAIKFGSFELAKRLMAQLEGVQDTAG 341

Query: 106 LTQPLSILSGASAGICESFVVVPFELVKIRLQDVSSKFTSP-----IAVVKNIVEKEGIL 160
           L++  + L+G   G+     V P + +K R+Q       S      I+  K++ ++ G+ 
Sbjct: 342 LSRFSTYLAGGLGGVMAQLSVYPIDTLKYRVQCAPLNTESKGRQLLISTAKDMYKEGGLR 401

Query: 161 AMYNGLESTMWRHGIW-----NAGYFGII---FQVRALLPKASTKSEQTRND---LLAGT 209
             Y G+  T+   GI+     + G F  +   +  R        + + T ++   LL G 
Sbjct: 402 IFYRGI--TVGIMGIFPYAAMDLGTFSALKKWYIARQARLTGLPEDQVTMSNMFVLLMGA 459

Query: 210 VGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKV 269
             GT+ +    P +++++R+Q        P +YN     L    + EG++ L+KG VP +
Sbjct: 460 FSGTVGATAVYPVNLLRTRLQAQGTFAH-PHRYNGFRDVLLKTVQREGYQGLFKGLVPNL 518

Query: 270 LRLGPGGGILLVVFTGV 286
            ++ P   I  + +  +
Sbjct: 519 AKVCPAVSISYLCYENL 535

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/93 (22%), Positives = 45/93 (48%)

Query: 3   DQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAK 62
           DQ  +  ++  + GA +G      +YP+++++T +Q Q +     +Y G  D L +   +
Sbjct: 445 DQVTMSNMFVLLMGAFSGTVGATAVYPVNLLRTRLQAQGTFAHPHRYNGFRDVLLKTVQR 504

Query: 63  EGPSRLYKGISSPILMEAPKRATKFACNDEFQK 95
           EG   L+KG+   +    P  +  + C +  ++
Sbjct: 505 EGYQGLFKGLVPNLAKVCPAVSISYLCYENLKR 537

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 47/206 (22%), Positives = 85/206 (41%), Gaps = 28/206 (13%)

Query: 112 ILSGASAGICESFVVVPFELVKIRL---QDVSSKF--TSPIAVVKN-------------- 152
            ++G  +G+       PF+ +K+ L    D+SS F  +  I + KN              
Sbjct: 228 FIAGGVSGVVSRTCTAPFDRIKVFLIARTDLSSTFLKSKDIILEKNPNADLSKIKSPLVK 287

Query: 153 ----IVEKEGILAMY--NGLES-TMWRHGIWNAGYFGIIFQVRALLPKASTKSEQTR-ND 204
               +  + GI A Y  NGL +  ++       G F +  ++ A L      +  +R + 
Sbjct: 288 AATTLYRQGGIRAFYVGNGLNAMKVFPESAIKFGSFELAKRLMAQLEGVQDTAGLSRFST 347

Query: 205 LLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKG 264
            LAG +GG ++ L   P D +K RVQ  A +    +           +YKE G +  Y+G
Sbjct: 348 YLAGGLGGVMAQLSVYPIDTLKYRVQ-CAPLNTESKGRQLLISTAKDMYKEGGLRIFYRG 406

Query: 265 FVPKVLRLGPGGGILLVVFTGVMDFF 290
               ++ + P   + L  F+ +  ++
Sbjct: 407 ITVGIMGIFPYAAMDLGTFSALKKWY 432

>Kwal_34.15907
          Length = 312

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 65/283 (22%), Positives = 117/283 (41%), Gaps = 33/283 (11%)

Query: 4   QKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKE 63
           +KP+ F    +   +       +  PL+++KT M    +   G         +K + ++ 
Sbjct: 13  KKPVSFSNILLGAGLNLCEATTLGQPLEVIKTTMAANRNLNFG-------QSVKHVWSRG 65

Query: 64  GPSRLYKGISSPILMEAP-KRATKFACNDEFQKIYKDL----FGAEKLTQPLSILSGASA 118
           G    Y+G+     +EA  K A     + E +  +K L    FGA        I+ G S 
Sbjct: 66  GVFGFYQGLIPWAWIEASTKGAVLLFVSAEAEYQFKRLGLGNFGA-------GIMGGVSG 118

Query: 119 GICESFVVVPF-------ELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMW 171
           G+ ++++ + F       E+ K +     +   S  +  K I  KEGI  +  G+ +   
Sbjct: 119 GVAQAYLTMGFCTCMKTVEITKAKSAVAGAIPQSSWSAFKEIYSKEGIKGINKGVNAVAI 178

Query: 172 RHGIWNAGYFGI---IFQ-VRALLPKASTKSEQTR-NDLLAGTVGGTLSSLLSTPFDVVK 226
           R        FG+   + Q +R    K +   + T    + A  +GG LS+  + P +V++
Sbjct: 179 RQMTNWGSRFGLSRLVEQGIRDFTGKTNPDDKLTALEKIFASALGGGLSAW-NQPIEVIR 237

Query: 227 SRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKV 269
             +Q+    P  P+K      A   IY+  G K LY+G  P++
Sbjct: 238 VEMQSKKEDPNRPKKLTVG-SAFKYIYQSSGIKGLYRGVAPRI 279

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 53/206 (25%), Positives = 84/206 (40%), Gaps = 32/206 (15%)

Query: 103 AEKLTQPLS---ILSGASAGICESFVV-VPFELVKIRLQDVSSKFTSPIAVVKNIVEKEG 158
           AE   +P+S   IL GA   +CE+  +  P E++K  +   +++  +    VK++  + G
Sbjct: 9   AELKKKPVSFSNILLGAGLNLCEATTLGQPLEVIKTTM--AANRNLNFGQSVKHVWSRGG 66

Query: 159 ILAMYNGLESTMWRHGIWNAGYFGIIFQVRALLPKASTKSEQTRNDL-------LAGTVG 211
           +   Y GL    W      A   G +     L   A  + +  R  L       + G  G
Sbjct: 67  VFGFYQGLIPWAWIE----ASTKGAVL----LFVSAEAEYQFKRLGLGNFGAGIMGGVSG 118

Query: 212 GTLSSLLSTPFDVVKSRVQNT----AVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVP 267
           G   + L+  F      V+ T    AV   +P+    SW A   IY +EG K + KG   
Sbjct: 119 GVAQAYLTMGFCTCMKTVEITKAKSAVAGAIPQS---SWSAFKEIYSKEGIKGINKGVNA 175

Query: 268 KVLR----LGPGGGILLVVFTGVMDF 289
             +R     G   G+  +V  G+ DF
Sbjct: 176 VAIRQMTNWGSRFGLSRLVEQGIRDF 201

>Scas_705.9
          Length = 323

 Score = 52.0 bits (123), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 65/286 (22%), Positives = 121/286 (42%), Gaps = 35/286 (12%)

Query: 14  MAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQY----------KGVFDCLKQIAAKE 63
           + GA+A     +++YPLD+ KTV+Q +       +           + V  CL +I  K 
Sbjct: 8   ITGAIASTMANVIVYPLDVAKTVIQSETKAKETDELSEKDKRILRQENVIRCLIRIFRKR 67

Query: 64  GPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDL-FGAEKLTQPLSILS-------G 115
           G   LY+G+S+ +  +  +    F      ++ Y  L        +P++ +S       G
Sbjct: 68  GLRGLYQGMSTSVFSKFVQSFCYFFWYSFLRRKYFSLKLLRNTQARPINSISTVEELIVG 127

Query: 116 ASAGICESFVVVPFELVKIRLQDVSSKFTSPI-AVVKNI-VEKEGILAMY-NGLESTMWR 172
             A      V  P E++  + Q    K      +V+K I VE  G L+ Y  G + ++  
Sbjct: 128 VGAAALTQVVNNPIEVILTKQQTTDDKDNVDFYSVLKQIYVESNGKLSSYWKGFKVSLI- 186

Query: 173 HGIWNAGYFGIIFQVRALLPKASTKSEQT-------RNDLLAGTVGGTLSSLLSTPFDVV 225
             +  +  F    + + +L K  + SE++         + + G +   +S++++ P  V 
Sbjct: 187 LTVNPSITFAAYQRFKDILLKQVSNSEKSYSGQLTVNQNFILGALAKIISTIITQPLIVA 246

Query: 226 KSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLR 271
           K  +Q +        K+      L  +YKEEG  AL+KG  P++ +
Sbjct: 247 KVSLQRS------NSKFKHFEEVLRYLYKEEGVLALWKGVGPQLTK 286

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 40/90 (44%), Gaps = 5/90 (5%)

Query: 12  QFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKG 71
            F+ GA+A +   ++  PL + K  +Q      S  ++K   + L+ +  +EG   L+KG
Sbjct: 225 NFILGALAKIISTIITQPLIVAKVSLQ-----RSNSKFKHFEEVLRYLYKEEGVLALWKG 279

Query: 72  ISSPILMEAPKRATKFACNDEFQKIYKDLF 101
           +   +      +   FA   E  K +K L 
Sbjct: 280 VGPQLTKGVLVQGLVFAFKGELTKSWKRLL 309

>KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyces
           cerevisiae YPR011c, hypothetical start
          Length = 188

 Score = 50.8 bits (120), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 56/197 (28%), Positives = 83/197 (42%), Gaps = 40/197 (20%)

Query: 99  DLFGAEKLTQPLSILSGASAGICESFVVVPFELVKIRLQ---DVSSKFTSPIAVVKNIVE 155
           DL    K    ++ ++G  AG     VV PFE VKI LQ     S+     I  V  + +
Sbjct: 2   DLKQLAKQESSIAFIAGGVAGAVSRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYK 61

Query: 156 KEGILAMYNGLESTMWRHGIWNAGYFGI-------IFQVRALLPKASTKSEQTRN--DLL 206
           +EG+  ++ G      R   ++A  F +       IF V   + K     EQ  N   L 
Sbjct: 62  EEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGK-----EQLLNWQRLS 116

Query: 207 AGTVGGTLSSLLSTPFDVVKSRV---------------QNTAVIPGVPRKYNWSWPALAT 251
           AG + G +S L + P D+V++R+               ++ A  PGV       W  L  
Sbjct: 117 AGALCGGMSVLATYPLDLVRTRLSIQTANLAKLSKSKAKDIAKPPGV-------WELLVK 169

Query: 252 IYKEE-GFKALYKGFVP 267
            +KEE G + LY+G  P
Sbjct: 170 TFKEEGGIRGLYRGIYP 186

 Score = 47.8 bits (112), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/178 (25%), Positives = 76/178 (42%), Gaps = 26/178 (14%)

Query: 13  FMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGI 72
           F+AG VAG     V+ P + VK ++Q+Q S  +     G+ + + Q+  +EG + L++G 
Sbjct: 15  FIAGGVAGAVSRTVVSPFERVKILLQVQSS--TSAYNHGIINAVGQVYKEEGVAGLFRGN 72

Query: 73  SSPILMEAPKRATKFACNDEFQKIYKDLF------GAEKLTQPLSILSGASAGICESFVV 126
               +   P  A +F     ++   K +F      G E+L     + +GA  G       
Sbjct: 73  GLNCVRIFPYSAVQFVV---YEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLAT 129

Query: 127 VPFELVKIRLQ-------DVSSKFTSPIA--------VVKNIVEKEGILAMYNGLEST 169
            P +LV+ RL         +S      IA        +VK   E+ GI  +Y G+  T
Sbjct: 130 YPLDLVRTRLSIQTANLAKLSKSKAKDIAKPPGVWELLVKTFKEEGGIRGLYRGIYPT 187

 Score = 35.8 bits (81), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 39/80 (48%), Gaps = 5/80 (6%)

Query: 205 LLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSW-PALATIYKEEGFKALYK 263
            +AG V G +S  + +PF+ VK  +Q    +      YN     A+  +YKEEG   L++
Sbjct: 15  FIAGGVAGAVSRTVVSPFERVKILLQ----VQSSTSAYNHGIINAVGQVYKEEGVAGLFR 70

Query: 264 GFVPKVLRLGPGGGILLVVF 283
           G     +R+ P   +  VV+
Sbjct: 71  GNGLNCVRIFPYSAVQFVVY 90

>AFR253W [3445] [Homologous to ScYFR045W - SH]
           complement(892939..892986,893047..894033) [1035 bp, 344
           aa]
          Length = 344

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 75/326 (23%), Positives = 126/326 (38%), Gaps = 68/326 (20%)

Query: 14  MAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLY-KGI 72
           +AGA A V +  + +P + +KT  QL  +          F+ L        P + Y  G 
Sbjct: 25  IAGAAAAVFQTTMSHPFEFLKTGQQLHRALPGA----AAFNMLH-------PFKYYFSGC 73

Query: 73  SSPILMEAPKRATKFACNDEFQKIYKDLFGAEK-LTQPLSILSGASAGICESFVVVPFEL 131
           ++  +    K  T+FA  ++     +D   A++ +  P  +L+GA  G  ES  VVPFE 
Sbjct: 74  AALNVGTLLKTGTRFATFEQACVWLRDPEHADQPIAGPRLLLAGAITGFLESLWVVPFES 133

Query: 132 VKI-----------RLQD-------VSSKFTSPIAV------------------------ 149
           +K            R+Q          SK  +P A                         
Sbjct: 134 IKTTAVENALELSRRVQGEPETRAAAVSKGPAPKATFHAARPVQTAHERWLLHYERQPSS 193

Query: 150 -----VKNIVEKEGILAMYNGLESTMWRH-GIWNAGYFGIIFQVRALLPKASTKSEQTRN 203
                V  I    G+     G   T++R  G     +    + V++L P  +    Q   
Sbjct: 194 HFAGTVLEIYRTRGVRGFLQGAMPTIFRQLGNSVVRFTTYAWIVQSLSPHKALDEYQA-- 251

Query: 204 DLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYK 263
              AG +       L+ P DV+K+R+Q+           N ++     I+ EEGF+ ++K
Sbjct: 252 -FAAGALSSAAVVALTQPIDVIKTRMQSKTAWFTYKSSLNCAY----RIFVEEGFRYMWK 306

Query: 264 GFVPKVLRLGPGGGILLVVFTGVMDF 289
           G+VP++ ++   GGI   V+  V + 
Sbjct: 307 GWVPRLFKVSLSGGISFGVYQYVENL 332

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 38/71 (53%), Gaps = 3/71 (4%)

Query: 1   MSDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIA 60
           +S  K L     F AGA++  + + +  P+D++KT MQ + +  +   YK   +C  +I 
Sbjct: 240 LSPHKALDEYQAFAAGALSSAAVVALTQPIDVIKTRMQSKTAWFT---YKSSLNCAYRIF 296

Query: 61  AKEGPSRLYKG 71
            +EG   ++KG
Sbjct: 297 VEEGFRYMWKG 307

>Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement
          Length = 420

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 66/328 (20%), Positives = 126/328 (38%), Gaps = 67/328 (20%)

Query: 14  MAGAVAGVSEILVMYPLDMVKTVMQLQVS-GGSGPQYKGVFDCLKQIAAKEGPSRLYKGI 72
           +AG+ A V +  + YP + +KT +QL  S   + P     F+ + Q          + G 
Sbjct: 99  VAGSCASVFQTTISYPFEFLKTGLQLHRSLPNAHP-----FNMMHQF------KYYFSGC 147

Query: 73  SSPILMEAPKRATKFACNDEFQKIYKDLFGAEK-LTQPLSILSGASAGICESFVVVPFEL 131
           ++  +    K  T+F   ++  ++ KD       ++ P  +++GA  G  ES  VVPFE 
Sbjct: 148 AALNVGTLFKTVTRFTTFEKACQLLKDPSSPSAFISGPRLLMAGAITGFMESLWVVPFEN 207

Query: 132 VKIRLQD----VSSKFTSPI---------------------------------------- 147
           +K  + +    +S +F   I                                        
Sbjct: 208 IKTTMVENALVLSGRFQKEIEDKGKAETGSKREVRATFHKQTPGISPRERLFLHYEEHPT 267

Query: 148 ----AVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIFQVRALLPKASTKSEQTRN 203
               + VK I    G+     G   T++R    +A  F     ++ L+  +  K      
Sbjct: 268 SRFFSTVKEIYLTRGLRGFVQGTAPTIFRQMGNSAVRFTTYTSLKQLI--SPNKPLNEYY 325

Query: 204 DLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYK 263
             + G +       ++ P DV+K+R+Q+           N ++     I+ EEG    +K
Sbjct: 326 AFVLGFISSCAVVAVTQPIDVIKTRMQSKYAWANYKNSLNCAY----RIFVEEGIPKFWK 381

Query: 264 GFVPKVLRLGPGGGILLVVFTGVMDFFR 291
           G+ P+++++G  GG+   V+  V +  +
Sbjct: 382 GWAPRLMKVGLSGGVSFGVYQYVENLIK 409

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 43/79 (54%), Gaps = 4/79 (5%)

Query: 1   MSDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIA 60
           +S  KPL   Y F+ G ++  + + V  P+D++KT MQ   S  +   YK   +C  +I 
Sbjct: 315 ISPNKPLNEYYAFVLGFISSCAVVAVTQPIDVIKTRMQ---SKYAWANYKNSLNCAYRIF 371

Query: 61  AKEGPSRLYKGISSPILME 79
            +EG  + +KG  +P LM+
Sbjct: 372 VEEGIPKFWKGW-APRLMK 389

>AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 315
           aa]
          Length = 315

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 59/247 (23%), Positives = 102/247 (41%), Gaps = 21/247 (8%)

Query: 29  PLDMVKTVMQLQVSGGS-GPQYKGVFDCLKQIAAKEGPSRLYKGISSPILMEAPKRATKF 87
           PL  + T MQ+       G + K   + +++I  KEG    Y G+ S +   A      +
Sbjct: 36  PLVTLATRMQVSEQDKEPGTRSKSKLEAVREIYRKEGVVGFYYGLESAMYGMAANSLNYY 95

Query: 88  ACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESFVVVPFELVKIRLQDVSSKFTSPI 147
              +   +    + G+ +L    +ILS A AG   +    P  +V  R+  V+    S +
Sbjct: 96  YFYELAARATMRVRGSRRLNTSEAILSSAVAGSMTAIASNPIWVVNTRM-TVAKSEQSTL 154

Query: 148 AVVKNIVEKEGILAMYNGLESTMW--RHGIWNAGYFGIIFQV-------RALLPKASTKS 198
           AV+ +IV K+G+ A++NGL   +    + I     F  +  V         LLP  +   
Sbjct: 155 AVLLDIVRKDGVTALFNGLRPALMLVSNPIIQYTVFEQLKNVVLKWSGSDVLLPSWA--- 211

Query: 199 EQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGF 258
                  L G VG   ++  + P+  +K+R+           + +  W  +  I K+EG 
Sbjct: 212 ------FLLGAVGKLAATGSTYPYITLKTRMHLAKGKEDADTQQS-MWSLMVDIVKKEGI 264

Query: 259 KALYKGF 265
           + LY G 
Sbjct: 265 QGLYHGI 271

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 61/131 (46%), Gaps = 8/131 (6%)

Query: 141 SKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGII-FQVRALLPKASTKSE 199
           ++  S +  V+ I  KEG++  Y GLES M+     +  Y+       RA +    ++  
Sbjct: 55  TRSKSKLEAVREIYRKEGVVGFYYGLESAMYGMAANSLNYYYFYELAARATMRVRGSRRL 114

Query: 200 QTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFK 259
            T   +L+  V G+++++ S P  VV +R+        V +    +   L  I +++G  
Sbjct: 115 NTSEAILSSAVAGSMTAIASNPIWVVNTRMT-------VAKSEQSTLAVLLDIVRKDGVT 167

Query: 260 ALYKGFVPKVL 270
           AL+ G  P ++
Sbjct: 168 ALFNGLRPALM 178

 Score = 30.0 bits (66), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 27/62 (43%)

Query: 11  YQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYK 70
           + F+ GAV  ++     YP   +KT M L          + ++  +  I  KEG   LY 
Sbjct: 210 WAFLLGAVGKLAATGSTYPYITLKTRMHLAKGKEDADTQQSMWSLMVDIVKKEGIQGLYH 269

Query: 71  GI 72
           GI
Sbjct: 270 GI 271

>Sklu_2127.4 , Contig c2127 6322-7293
          Length = 323

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 68/153 (44%), Gaps = 13/153 (8%)

Query: 128 PFELVKIRLQ----DVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGI 183
           P   +  +LQ    D +++  S +  +K I  K+G+L  Y GLES ++   + N  Y+  
Sbjct: 33  PLVTITTKLQTQGNDENNQVKSKLETIKEIYRKDGLLGFYAGLESAIYGMALTNFVYYYF 92

Query: 184 I-FQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKY 242
                R +L     K   T   +L G V G+++++ S P  V  +R+        V +  
Sbjct: 93  YELTSRNVLKVRKHKKLNTLESMLTGCVAGSVTAIASNPIWVANTRMT-------VTKSE 145

Query: 243 NWSWPALATIYKEEGFKALYKGFVPK-VLRLGP 274
             +   +  I K++  K L+ G  P  VL + P
Sbjct: 146 KTALATIIEIVKKDSAKTLFNGLKPALVLVMNP 178

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 62/142 (43%), Gaps = 2/142 (1%)

Query: 26  VMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGISSPILMEAPKRAT 85
           + YPL  + T +Q Q       Q K   + +K+I  K+G    Y G+ S I   A     
Sbjct: 30  LTYPLVTITTKLQTQ-GNDENNQVKSKLETIKEIYRKDGLLGFYAGLESAIYGMALTNFV 88

Query: 86  KFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESFVVVPFELVKIRLQDVSSKFTS 145
            +   +   +    +   +KL    S+L+G  AG   +    P  +   R+    S+ T+
Sbjct: 89  YYYFYELTSRNVLKVRKHKKLNTLESMLTGCVAGSVTAIASNPIWVANTRMTVTKSEKTA 148

Query: 146 PIAVVKNIVEKEGILAMYNGLE 167
            +A +  IV+K+    ++NGL+
Sbjct: 149 -LATIIEIVKKDSAKTLFNGLK 169

 Score = 31.6 bits (70), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 35/74 (47%), Gaps = 12/74 (16%)

Query: 11  YQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSG-----GSGPQYKG-------VFDCLKQ 58
           + F+ GA+  ++     YP   +KT M L  SG      SG + KG       +   + +
Sbjct: 205 WAFLLGALGKLAATGSTYPYITLKTRMHLSESGKHTDDDSGKKAKGHKASSKSMLSLITE 264

Query: 59  IAAKEGPSRLYKGI 72
           I  K+G S LY+G+
Sbjct: 265 IVKKDGVSGLYRGV 278

>Kwal_55.21106
          Length = 328

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 74/292 (25%), Positives = 117/292 (40%), Gaps = 44/292 (15%)

Query: 14  MAGAVAGVSEILVMYPLDMVKTVMQLQ-------VSGGSGPQ----------YKGVFDCL 56
           + GAVA     +V+YPLD+VKT++Q Q          G  PQ          YK   D L
Sbjct: 8   ITGAVASSLANVVVYPLDLVKTLIQTQNKEPNIGSEAGVKPQAKKSRVQEIRYKHSLDAL 67

Query: 57  KQIAAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKI---YKDLFGA-EKLTQPLSI 112
            +I   +G   LY+G+ + I+    +  + F      +K    YK L G   K + P  +
Sbjct: 68  IKIFKTKGVLGLYQGLWTSIIAGFLQSFSYFFWYSIVRKSFFRYKLLRGRLGKFSTPEEL 127

Query: 113 LSGASAGICESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIV--EKEGILAMYNGLESTM 170
           L G  A         P  ++  R Q  +S        V + +  E+  I   + G + ++
Sbjct: 128 LLGIVAAAVSQIFTSPIGVISTRQQTSTSGSKGGFREVLHQIYSEQNNITGFWRGFKVSL 187

Query: 171 W---RHGIWNAGYFGI----IFQVRA------LLPKASTKSEQTRNDLLAGTVGGTLSSL 217
                  I  A Y  +    I   RA      LL  +   S   R + L G     +S+L
Sbjct: 188 ILTVNPSITFASYEKLQDIFITSKRAVDENGQLLETSGQLSP--RQNFLLGVFSKVISTL 245

Query: 218 LSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKV 269
           ++ P  V K+ +Q T         +      L  +YK+EG  +L+KG  P++
Sbjct: 246 ITQPLIVSKAYLQRTG------SNFQSFQQVLLYLYKQEGLISLWKGLAPQL 291

 Score = 34.7 bits (78), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 53/224 (23%), Positives = 93/224 (41%), Gaps = 52/224 (23%)

Query: 106 LTQPLSILSGASAGICESFVVVPFELVKI------------------------RLQDVSS 141
           +T   S ++GA A    + VV P +LVK                         R+Q++  
Sbjct: 1   MTSLESAITGAVASSLANVVVYPLDLVKTLIQTQNKEPNIGSEAGVKPQAKKSRVQEI-- 58

Query: 142 KFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYF---GIIFQ-------VRALL 191
           ++   +  +  I + +G+L +Y GL +++    + +  YF    I+ +       +R  L
Sbjct: 59  RYKHSLDALIKIFKTKGVLGLYQGLWTSIIAGFLQSFSYFFWYSIVRKSFFRYKLLRGRL 118

Query: 192 PKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQ-NTAVIPGVPRKYNWSWPALA 250
            K ST  E     LL G V   +S + ++P  V+ +R Q +T+   G  R+       L 
Sbjct: 119 GKFSTPEE-----LLLGIVAAAVSQIFTSPIGVISTRQQTSTSGSKGGFRE------VLH 167

Query: 251 TIYKEE-GFKALYKGF-VPKVLRLGPGGGILLVVFTGVMDFFRT 292
            IY E+      ++GF V  +L + P   I    +  + D F T
Sbjct: 168 QIYSEQNNITGFWRGFKVSLILTVNP--SITFASYEKLQDIFIT 209

>KLLA0D04312g 367160..367471 highly similar to sgd|S0006215
          Saccharomyces cerevisiae YPR011c, hypothetical start
          Length = 103

 Score = 46.6 bits (109), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 43/83 (51%), Gaps = 2/83 (2%)

Query: 7  LPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGS--GPQYKGVFDCLKQIAAKEG 64
          L  +Y+   GA++G     ++YP D+++   Q+   GG+  G +YK V D L  I   EG
Sbjct: 8  LANLYKLAMGAISGGVAQTLVYPFDLLRRRFQVLAMGGNELGFRYKSVSDALITIGKTEG 67

Query: 65 PSRLYKGISSPILMEAPKRATKF 87
          P   YKG+++ +    P  A  +
Sbjct: 68 PKGYYKGLTANLFKVIPSTAVSW 90

>YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1638 bp, 545 aa]
          Length = 545

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 65/294 (22%), Positives = 125/294 (42%), Gaps = 30/294 (10%)

Query: 17  AVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGISSPI 76
           A   +S IL+    D++       ++  S P  K V    K +  + G    Y G    +
Sbjct: 257 ARTDLSSILLNSKTDLLAKNPNADINKISSPLAKAV----KSLYRQGGIKAFYVGNGLNV 312

Query: 77  LMEAPKRATKFACNDEFQKIYKDLFGA---EKLTQPLSILSGASAGICESFVVVPFELVK 133
           +   P+ + KF   +  +KI   L G    + L++  + ++G  AG+   F V P + +K
Sbjct: 313 IKVFPESSIKFGSFEVTKKIMTKLEGCRDTKDLSKFSTYIAGGLAGMAAQFSVYPIDTLK 372

Query: 134 IRLQ----DVSSKFTSPI-AVVKNIVEKEGILAMYNGLESTM---WRHGIWNAGYFG--- 182
            R+Q    D   K  + +    K++  + G+   Y G+   +   + +   + G F    
Sbjct: 373 FRVQCAPLDTKLKGNNLLFQTAKDMFREGGLRLFYRGVTVGIVGIFPYAALDLGTFSALK 432

Query: 183 ---IIFQVRAL-LPKASTKSEQTRNDLLA---GTVGGTLSSLLSTPFDVVKSRVQNTAVI 235
              I  Q + L LP+     + T ++L+    G   GT+ + +  P +++++R+Q     
Sbjct: 433 KWYIAKQAKTLNLPQ----DQVTLSNLVVLPMGAFSGTVGASVVYPINLLRTRLQAQGTY 488

Query: 236 PGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDF 289
              P  YN     L    + EG++ L+KG VP + ++ P   I  + +  +  F
Sbjct: 489 AH-PYVYNGFKDVLLKTLEREGYQGLFKGLVPTLAKVCPAVSISYLCYENLKKF 541

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 43/93 (46%)

Query: 3   DQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAK 62
           DQ  L  +     GA +G     V+YP+++++T +Q Q +      Y G  D L +   +
Sbjct: 448 DQVTLSNLVVLPMGAFSGTVGASVVYPINLLRTRLQAQGTYAHPYVYNGFKDVLLKTLER 507

Query: 63  EGPSRLYKGISSPILMEAPKRATKFACNDEFQK 95
           EG   L+KG+   +    P  +  + C +  +K
Sbjct: 508 EGYQGLFKGLVPTLAKVCPAVSISYLCYENLKK 540

 Score = 37.4 bits (85), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 75/185 (40%), Gaps = 17/185 (9%)

Query: 3   DQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAK 62
           D K L     ++AG +AG++    +YP+D +K  +Q             +F   K +  +
Sbjct: 341 DTKDLSKFSTYIAGGLAGMAAQFSVYPIDTLKFRVQCAPLDTKLKGNNLLFQTAKDMFRE 400

Query: 63  EGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILS-------- 114
            G    Y+G++  I+   P  A         +K Y     A+ L  P   ++        
Sbjct: 401 GGLRLFYRGVTVGIVGIFPYAALDLGTFSALKKWYI-AKQAKTLNLPQDQVTLSNLVVLP 459

Query: 115 -GASAGICESFVVVPFELVKIRLQDVSSKFTSPIA------VVKNIVEKEGILAMYNGLE 167
            GA +G   + VV P  L++ RLQ     +  P        V+   +E+EG   ++ GL 
Sbjct: 460 MGAFSGTVGASVVYPINLLRTRLQ-AQGTYAHPYVYNGFKDVLLKTLEREGYQGLFKGLV 518

Query: 168 STMWR 172
            T+ +
Sbjct: 519 PTLAK 523

>Kwal_55.21338
          Length = 323

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 64/140 (45%), Gaps = 8/140 (5%)

Query: 132 VKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWN-AGYFGIIFQVRAL 190
            K++ QD   +  S    +K+I  K+G +  + GLES ++   + N   Y+      R +
Sbjct: 48  TKLQTQDAKGEKLSLADTIKDIYRKDGAMGFFAGLESALFGTTLSNFVYYYCYEASSRCV 107

Query: 191 LPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALA 250
           L    T+   T   +L G++ G+L++  + P  V  +R+        V +    +   + 
Sbjct: 108 LRARHTQRLTTAESMLVGSIAGSLNATAANPLWVANTRMT-------VQKSDRGTLSTIF 160

Query: 251 TIYKEEGFKALYKGFVPKVL 270
            I K+EG   L+KG  P ++
Sbjct: 161 DIVKDEGISGLFKGLNPALI 180

 Score = 47.0 bits (110), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 57/260 (21%), Positives = 105/260 (40%), Gaps = 31/260 (11%)

Query: 26  VMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGISSPILMEAPKRAT 85
           + YPL +V T +Q Q + G   +   + D +K I  K+G    + G+ S +         
Sbjct: 39  LTYPLIVVTTKLQTQDAKG---EKLSLADTIKDIYRKDGAMGFFAGLESALFGTTLSNFV 95

Query: 86  KFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESFVVVPFELVKIRLQDVSSKFTS 145
            + C +   +        ++LT   S+L G+ AG   +    P  +   R+  V      
Sbjct: 96  YYYCYEASSRCVLRARHTQRLTTAESMLVGSIAGSLNATAANPLWVANTRMT-VQKSDRG 154

Query: 146 PIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGII-----FQVRALLPKASTKSEQ 200
            ++ + +IV+ EGI  ++ GL          N     +I     + V   L      S Q
Sbjct: 155 TLSTIFDIVKDEGISGLFKGL----------NPALILVINPIIQYTVYEQLKNWILSSRQ 204

Query: 201 TRN-----DLLAGTVGGTLSSLLSTPFDVVKSRV----QNTAVIPGVPRKYNWSWPALAT 251
           TR        + G VG   ++  + P+  +K+R+    ++ +     PR        +A 
Sbjct: 205 TRTLSPSWAFILGAVGKLAATGSTYPYVTMKARMHLLGEHKSSTAAPPRSL---LSLMAE 261

Query: 252 IYKEEGFKALYKGFVPKVLR 271
           I K++G   LY+G   K+++
Sbjct: 262 IIKKDGILGLYRGIGIKLVQ 281

>Scas_696.9
          Length = 312

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 69/282 (24%), Positives = 116/282 (41%), Gaps = 31/282 (10%)

Query: 16  GAVAGVSEILVM-YPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGISS 74
           GA   ++E+  +  PL++VKT M       +  +     + +K + ++ G    Y+G+  
Sbjct: 24  GATINMAEVTSLGQPLEVVKTTM-------AANRNLNFVNSMKYVWSRGGIVGFYQGLIP 76

Query: 75  PILMEAP-KRATKFACNDEFQKIYKDLFGAEKLTQPLSIL-------SGASAGICESFVV 126
              +EA  K A     + E +  +K L G    T  +          S  + G C     
Sbjct: 77  WAWIEASTKGAVLLFVSAESEYRFK-LLGMGNFTSGILGGVLGGVTQSYLTMGFCTCMKT 135

Query: 127 VPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIFQ 186
           V  E+ +++     +   S   V ++I  KEG+  +Y G+ +   R        FG    
Sbjct: 136 V--EITRLKSASAGAPVQSSWNVFRSIYAKEGLRGIYKGVNAVAIRQMTNWGSRFGFSRL 193

Query: 187 VRALLPKAS--TKSEQTRN---DLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRK 241
           V   + KA+  TK E   N    + A  VGG LS+  + P +V++  +Q+    P  P+ 
Sbjct: 194 VEDWVRKATGKTKPEDRLNAWEKIGATAVGGGLSA-WNQPIEVIRVEMQSKKEDPNRPKN 252

Query: 242 YNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVF 283
              +      I K  G K LY+G  P++     G GI   VF
Sbjct: 253 LTVA-KTFKYIMKTNGVKGLYRGVTPRI-----GLGIWQTVF 288

>KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida
           albicans peroxisomal membrane protein (by homology),
           start by similarity
          Length = 304

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 56/262 (21%), Positives = 114/262 (43%), Gaps = 17/262 (6%)

Query: 14  MAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGIS 73
           +AG++ G + I V YPL  + T +Q +    + P+     + +K+I  K G    + G+ 
Sbjct: 16  IAGSLGGAASIAVTYPLVTITTNLQTK-ENEARPK----LETIKEIYNKNGIIGYFLGLE 70

Query: 74  SPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESFVVVPFELVK 133
           S +   A      +   +   K  + L   + L+   SIL+   AG   +    P  +  
Sbjct: 71  SAVYGMATTNFVYYYFYEWCAKTARTLTTKQYLSTWESILASTIAGSMTAVASNPIWVAN 130

Query: 134 IRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAG---YFGIIFQVRAL 190
            R+    S   S +  V +IV+ +G L + NGL+  +    +  +     + +  Q++ L
Sbjct: 131 TRMTVAKSNH-STLRTVIDIVKTDGPLTLLNGLKPAL----VLVSNPIIQYTVYEQLKNL 185

Query: 191 LPKASTKSEQTRN-DLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPAL 249
           + +   K   + +   L G +G   ++  + P+  +K+R+    ++   P+     W  +
Sbjct: 186 VLRLQRKKVLSPSWAFLLGAIGKLAATGTTYPYITLKTRMH---LMQNDPKHQKSMWSLI 242

Query: 250 ATIYKEEGFKALYKGFVPKVLR 271
             I K++G   LY G   K+++
Sbjct: 243 VEIVKKDGVSGLYNGVAVKLVQ 264

 Score = 32.0 bits (71), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 38/74 (51%), Gaps = 4/74 (5%)

Query: 1   MSDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQY-KGVFDCLKQI 59
           +  +K L   + F+ GA+  ++     YP   +KT M L     + P++ K ++  + +I
Sbjct: 189 LQRKKVLSPSWAFLLGAIGKLAATGTTYPYITLKTRMHLM---QNDPKHQKSMWSLIVEI 245

Query: 60  AAKEGPSRLYKGIS 73
             K+G S LY G++
Sbjct: 246 VKKDGVSGLYNGVA 259

>Scas_613.24
          Length = 177

 Score = 47.0 bits (110), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 84/181 (46%), Gaps = 24/181 (13%)

Query: 1   MSDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKG--VFDCLKQ 58
           MSD+ P   V+  ++G + G+S  + + PLD++KT +Q         Q+KG  ++  +K 
Sbjct: 1   MSDKSPKTSVH-LVSGFIGGLSSAVTLQPLDLLKTRIQ---------QHKGATLWSAIKD 50

Query: 59  IAAKEGPSRLYKGISSPILMEAPKRATKFACND--EFQKIYKDLFGAE-------KLTQP 109
           I   + P + ++G     L  +   A   +C +    Q ++     A        +LT  
Sbjct: 51  I---KDPIQFWRGTLPSALRTSIGSALYLSCLNIMRTQLVHGKKGSAASKSSSLPQLTMY 107

Query: 110 LSILSGASAGICESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLEST 169
            ++L+GA A     ++ +P  ++K+R +     + S    +K+I + EGI   + G   T
Sbjct: 108 ENLLTGAMARGLVGYITMPITILKVRYESTYYSYKSMNEAIKDIYKMEGISGFFKGFGPT 167

Query: 170 M 170
           +
Sbjct: 168 V 168

 Score = 37.7 bits (86), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 71/170 (41%), Gaps = 21/170 (12%)

Query: 110 LSILSGASAGICESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLEST 169
           + ++SG   G+  +  + P +L+K R+Q    K  +  + +K+I +    +  + G   +
Sbjct: 10  VHLVSGFIGGLSSAVTLQPLDLLKTRIQQ--HKGATLWSAIKDIKDP---IQFWRGTLPS 64

Query: 170 MWRHGIWNAGYFGIIFQVRALLPKASTKSEQTR----------NDLLAGTVGGTLSSLLS 219
             R  I +A Y   +  +R  L      S  ++           +LL G +   L   ++
Sbjct: 65  ALRTSIGSALYLSCLNIMRTQLVHGKKGSAASKSSSLPQLTMYENLLTGAMARGLVGYIT 124

Query: 220 TPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKV 269
            P  ++K R ++T         Y     A+  IYK EG    +KGF P V
Sbjct: 125 MPITILKVRYESTYY------SYKSMNEAIKDIYKMEGISGFFKGFGPTV 168

 Score = 34.3 bits (77), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 40/86 (46%), Gaps = 11/86 (12%)

Query: 195 STKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYK 254
           S KS +T   L++G +GG  S++   P D++K+R+Q          K    W A+  I  
Sbjct: 2   SDKSPKTSVHLVSGFIGGLSSAVTLQPLDLLKTRIQQ--------HKGATLWSAIKDIKD 53

Query: 255 EEGFKALYKGFVPKVLRLGPGGGILL 280
              F   ++G +P  LR   G  + L
Sbjct: 54  PIQF---WRGTLPSALRTSIGSALYL 76

>KLLA0C11363g complement(975442..976995) similar to sp|P48233
           Saccharomyces cerevisiae YNL083w singleton, start by
           similarity
          Length = 517

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 68/318 (21%), Positives = 126/318 (39%), Gaps = 54/318 (16%)

Query: 13  FMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGI 72
           F+AG  +GV       P D +K  +  +    S      + +    + AK   + L K I
Sbjct: 203 FIAGGCSGVVSRTCTAPFDRIKVFLIARTDLSST-----LLNSKDTLLAKNPNADLSK-I 256

Query: 73  SSPILMEA------------------------PKRATKFACNDEFQKIYKDLFGAEKLTQ 108
            SP++  A                        P+ A KF   +  ++I   L    K T 
Sbjct: 257 KSPLIKAATTLYRQGGLRAFYVGNGLNVVKVFPESAIKFGSFEMAKRIMARLENV-KDTS 315

Query: 109 PLSILS----GASAGICESFVVVPFELVKIRLQ----DVSSKFTSPI-AVVKNIVEKEGI 159
            LS LS    G   G+   F V P + +K R+Q    + + K +S +    K + ++ GI
Sbjct: 316 ELSRLSTYIAGGLGGVAAQFSVYPIDTLKYRIQCAPLNTNLKKSSILLQTAKEMYQQGGI 375

Query: 160 LAMYNGLE---STMWRHGIWNAGYFGIIFQVRALLPKASTKSEQTRNDLL--------AG 208
              Y G+      ++ +   + G F  +   +  + K + K+    ++++         G
Sbjct: 376 RLFYRGVHIGVMGIFPYAALDLGTFSAL--KKWYIKKEAKKTGLPEDEVIISNLIVLPMG 433

Query: 209 TVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPK 268
              GT+ + L  P +++++R+Q        P  YN     L    + EG++ L+KG VP 
Sbjct: 434 AFSGTVGATLVYPINLLRTRLQAQGTYAH-PHTYNGFSDVLKKTIQREGYQGLFKGLVPN 492

Query: 269 VLRLGPGGGILLVVFTGV 286
           + ++ P   I  + +  +
Sbjct: 493 LAKVCPAVSISYLCYENL 510

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 42/83 (50%)

Query: 16  GAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGISSP 75
           GA +G     ++YP+++++T +Q Q +      Y G  D LK+   +EG   L+KG+   
Sbjct: 433 GAFSGTVGATLVYPINLLRTRLQAQGTYAHPHTYNGFSDVLKKTIQREGYQGLFKGLVPN 492

Query: 76  ILMEAPKRATKFACNDEFQKIYK 98
           +    P  +  + C +  +++ K
Sbjct: 493 LAKVCPAVSISYLCYENLKRLMK 515

 Score = 37.0 bits (84), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 39/180 (21%), Positives = 74/180 (41%), Gaps = 15/180 (8%)

Query: 1   MSDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIA 60
           + D   L  +  ++AG + GV+    +YP+D +K  +Q      +  +   +    K++ 
Sbjct: 311 VKDTSELSRLSTYIAGGLGGVAAQFSVYPIDTLKYRIQCAPLNTNLKKSSILLQTAKEMY 370

Query: 61  AKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIY-KDLFGAEKLTQPLSILS----- 114
            + G    Y+G+   ++   P  A         +K Y K       L +   I+S     
Sbjct: 371 QQGGIRLFYRGVHIGVMGIFPYAALDLGTFSALKKWYIKKEAKKTGLPEDEVIISNLIVL 430

Query: 115 --GASAGICESFVVVPFELVKIRLQDVSSKFTSPIA------VVKNIVEKEGILAMYNGL 166
             GA +G   + +V P  L++ RLQ     +  P        V+K  +++EG   ++ GL
Sbjct: 431 PMGAFSGTVGATLVYPINLLRTRLQ-AQGTYAHPHTYNGFSDVLKKTIQREGYQGLFKGL 489

>Scas_328.1
          Length = 227

 Score = 46.6 bits (109), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 36/69 (52%), Gaps = 2/69 (2%)

Query: 9   FVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRL 68
           F+  F+ G    +S     YPLD V+  M +  + G   +YKG  DC +QI ++EG   L
Sbjct: 136 FLPSFLLGWAVTISASTTSYPLDTVRRRMMM--TSGQAVKYKGAIDCFQQIVSQEGVYSL 193

Query: 69  YKGISSPIL 77
           +KG  + I 
Sbjct: 194 FKGCGANIF 202

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 54/214 (25%), Positives = 90/214 (42%), Gaps = 24/214 (11%)

Query: 81  PKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGI-----CESFVVVPF-ELVKI 134
           P +A  FA  D+     K +FG ++  + L  +     GI     C   +V  F  L K 
Sbjct: 7   PTQALNFAFKDKI----KAMFGFQQGKRRLYQMVYGECGIRWMCRCSFPIVCLFLRLCKN 62

Query: 135 RL-QDVSS-------KFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIFQ 186
            +  D  S       KF   + V K  +  +G+L +Y G   ++    ++   YFG+   
Sbjct: 63  EIGSDAKSIKSGAPRKFNGILDVYKKTLFTDGVLGLYRGFLPSVVGIMVYRGLYFGLYDS 122

Query: 187 VRALLPKASTKSEQTRNDLLAGTVGGTLS-SLLSTPFDVVKSRVQNTAVIPGVPRKYNWS 245
           ++ +L   S ++    + LL   V  T+S S  S P D V+ R+  T+   G   KY  +
Sbjct: 123 LKPVLLTGSFENAFLPSFLLGWAV--TISASTTSYPLDTVRRRMMMTS---GQAVKYKGA 177

Query: 246 WPALATIYKEEGFKALYKGFVPKVLRLGPGGGIL 279
                 I  +EG  +L+KG    + R     G++
Sbjct: 178 IDCFQQIVSQEGVYSLFKGCGANIFRGVAAAGVI 211

>Scas_578.3*
          Length = 524

 Score = 47.0 bits (110), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 61/302 (20%), Positives = 118/302 (39%), Gaps = 40/302 (13%)

Query: 13  FMAGAVAGVSEILVMYPLDMVKTV---------------MQLQVSGGSGPQYKG-VFDCL 56
           F+AG ++GV       PLD +K                 M L++ G +  + +  +   +
Sbjct: 212 FIAGGLSGVISRTCTAPLDRIKVFLIARTDLSSTLLNPKMHLRIQGLNLAKIRSPIIKAI 271

Query: 57  KQIAAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSIL--- 113
           + +  + G    Y G    +    P+ + KF   +  +++  +L G +KL   LS L   
Sbjct: 272 RSLYRQGGLRAFYVGNGLSVFKICPESSIKFGTFELAKRLMANLSG-DKLVNDLSKLQTY 330

Query: 114 -SGASAGICESFVVVPFELVKIRLQDVSSKFTSP-----IAVVKNIVEKEGILAMYNGL- 166
            +G  AG+     + P + +K R+Q    +         I+  K + ++ GI   Y G+ 
Sbjct: 331 VAGGIAGVMAQISIYPIDTLKFRIQCAPLEGNLKGNALLISTAKEMYKEGGIRVFYRGVL 390

Query: 167 --ESTMWRHGIWNAGYFGIIFQVRALLPKASTKSEQTRNDLL--------AGTVGGTLSS 216
                ++ +   + G F  +   +  + + S K      D++         G   GT+ +
Sbjct: 391 LGALGIFPYAALDLGTFSAL--KKWYIKRQSKKLNIPEKDVMLSYLLVLPMGAFSGTVGA 448

Query: 217 LLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGG 276
               P +++++R+Q        P  Y           K EG    YKG VP ++++ P  
Sbjct: 449 TAVYPINLLRTRLQAQGTYAH-PYTYTGFRDVFMQTLKREGVPGFYKGLVPTLVKVCPAV 507

Query: 277 GI 278
            I
Sbjct: 508 SI 509

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 38/79 (48%)

Query: 16  GAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGISSP 75
           GA +G      +YP+++++T +Q Q +      Y G  D   Q   +EG    YKG+   
Sbjct: 440 GAFSGTVGATAVYPINLLRTRLQAQGTYAHPYTYTGFRDVFMQTLKREGVPGFYKGLVPT 499

Query: 76  ILMEAPKRATKFACNDEFQ 94
           ++   P  +  + C ++F+
Sbjct: 500 LVKVCPAVSIGYLCYEKFK 518

 Score = 37.4 bits (85), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 41/205 (20%), Positives = 86/205 (41%), Gaps = 30/205 (14%)

Query: 113 LSGASAGICESFVVVPFELVKIRL---QDVSSKFTSP------------------IAVVK 151
           ++G  +G+       P + +K+ L    D+SS   +P                  I  ++
Sbjct: 213 IAGGLSGVISRTCTAPLDRIKVFLIARTDLSSTLLNPKMHLRIQGLNLAKIRSPIIKAIR 272

Query: 152 NIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIFQVRALLPKASTKSEQTRNDL------ 205
           ++  + G+ A Y G   ++++    ++  FG     + L+  A+   ++  NDL      
Sbjct: 273 SLYRQGGLRAFYVGNGLSVFKICPESSIKFGTFELAKRLM--ANLSGDKLVNDLSKLQTY 330

Query: 206 LAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGF 265
           +AG + G ++ +   P D +K R+Q  A + G  +           +YKE G +  Y+G 
Sbjct: 331 VAGGIAGVMAQISIYPIDTLKFRIQ-CAPLEGNLKGNALLISTAKEMYKEGGIRVFYRGV 389

Query: 266 VPKVLRLGPGGGILLVVFTGVMDFF 290
           +   L + P   + L  F+ +  ++
Sbjct: 390 LLGALGIFPYAALDLGTFSALKKWY 414

>CAGL0J05522g complement(524930..526489) highly similar to sp|P48233
           Saccharomyces cerevisiae YNL083w, hypothetical start
          Length = 519

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/202 (23%), Positives = 89/202 (44%), Gaps = 23/202 (11%)

Query: 105 KLTQPLSILS----GASAGICESFVVVPFELVKIRLQ--DVSSKFTSP---IAVVKNIVE 155
           K T+ LS LS    G  AG+C  F V P + +K R+Q   ++++       I   K +  
Sbjct: 313 KDTKDLSKLSTFIAGGLAGVCAQFSVYPIDTLKFRMQCAPLNAELKGRKLMIQTAKEMYT 372

Query: 156 KEGILAMYNGLESTMWRHGIW-----NAGYFGII--FQVRALLPKASTKSEQTRNDLLA- 207
           + G+   Y G+  T+   GI+     + G F ++  + + +   K + K E      L  
Sbjct: 373 EGGLKLFYRGV--TVGVLGIFPYAALDLGTFSMLKKWYISSKAKKLNKKEEDVELSNLVV 430

Query: 208 ---GTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKG 264
              G   GT  + +  P +++++R+Q        P +Y+     L    + EG+  L+KG
Sbjct: 431 LPMGAFSGTFGATVVYPINLLRTRLQAQGTFAH-PYRYDGFRDVLLKTIQREGYPGLFKG 489

Query: 265 FVPKVLRLGPGGGILLVVFTGV 286
            VP + ++ P   I  + +  +
Sbjct: 490 LVPTLAKVCPAVSISYLCYENL 511

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 78/184 (42%), Gaps = 15/184 (8%)

Query: 3   DQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAK 62
           D K L  +  F+AG +AGV     +YP+D +K  MQ           K +    K++  +
Sbjct: 314 DTKDLSKLSTFIAGGLAGVCAQFSVYPIDTLKFRMQCAPLNAELKGRKLMIQTAKEMYTE 373

Query: 63  EGPSRLYKGISSPILMEAPKRATKFACNDEFQKIY-----KDLFGAE---KLTQPLSILS 114
            G    Y+G++  +L   P  A         +K Y     K L   E   +L+  + +  
Sbjct: 374 GGLKLFYRGVTVGVLGIFPYAALDLGTFSMLKKWYISSKAKKLNKKEEDVELSNLVVLPM 433

Query: 115 GASAGICESFVVVPFELVKIRLQDVSSKFTSPI------AVVKNIVEKEGILAMYNGLES 168
           GA +G   + VV P  L++ RLQ     F  P        V+   +++EG   ++ GL  
Sbjct: 434 GAFSGTFGATVVYPINLLRTRLQ-AQGTFAHPYRYDGFRDVLLKTIQREGYPGLFKGLVP 492

Query: 169 TMWR 172
           T+ +
Sbjct: 493 TLAK 496

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 42/83 (50%)

Query: 16  GAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGISSP 75
           GA +G     V+YP+++++T +Q Q +     +Y G  D L +   +EG   L+KG+   
Sbjct: 434 GAFSGTFGATVVYPINLLRTRLQAQGTFAHPYRYDGFRDVLLKTIQREGYPGLFKGLVPT 493

Query: 76  ILMEAPKRATKFACNDEFQKIYK 98
           +    P  +  + C +  +K+ K
Sbjct: 494 LAKVCPAVSISYLCYENLKKLMK 516

 Score = 28.9 bits (63), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 42/200 (21%), Positives = 78/200 (39%), Gaps = 30/200 (15%)

Query: 113 LSGASAGICESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLES---- 168
           ++G  +G+       PF+ +K+ L   +   ++ +   ++++ K    A  N L S    
Sbjct: 205 IAGGISGVISRTCTAPFDRLKVFLIARTDLSSTLLNSTEDVLAKNP-HAKPNKLRSPLVK 263

Query: 169 ---TMWRHGIWNAGYFGIIFQVRALLPKAS-------------TKSEQTRN--DL----- 205
              +++R G   + Y G       + P++S             TK E  ++  DL     
Sbjct: 264 AIISLYRQGGIKSFYVGNGLNALKVFPESSIKFGSFEITKKLMTKVENCKDTKDLSKLST 323

Query: 206 -LAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKG 264
            +AG + G  +     P D +K R+Q  A +    +           +Y E G K  Y+G
Sbjct: 324 FIAGGLAGVCAQFSVYPIDTLKFRMQ-CAPLNAELKGRKLMIQTAKEMYTEGGLKLFYRG 382

Query: 265 FVPKVLRLGPGGGILLVVFT 284
               VL + P   + L  F+
Sbjct: 383 VTVGVLGIFPYAALDLGTFS 402

>Kwal_23.2913
          Length = 320

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 76/185 (41%), Gaps = 18/185 (9%)

Query: 2   SDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAA 61
           S   PL      +AG  + +   L+  P + VK V+Q   SG         F    +   
Sbjct: 134 SKLTPLTTSQLALAGFFSAIPTTLITAPTERVKVVLQTSESGS--------FLGAARTLI 185

Query: 62  KEGPSR-LYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILS----GA 116
           +EG  R L++G  + +  + P  A  FA  +    + K      + T  LS++S    G 
Sbjct: 186 REGGVRSLFQGTLATLARDGPGSALYFASYE----VSKRFLSRNQDTDALSVVSICVAGG 241

Query: 117 SAGICESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIW 176
            AG+     V P + +K +LQ  SS+  S +   + I  + G+   + GL   + R    
Sbjct: 242 VAGMSMWIGVFPIDTIKTKLQS-SSRSQSMVQAAREIYTRAGLRGFFPGLGPALMRSFPA 300

Query: 177 NAGYF 181
           NA  F
Sbjct: 301 NAATF 305

 Score = 35.0 bits (79), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 22/96 (22%), Positives = 44/96 (45%), Gaps = 6/96 (6%)

Query: 3   DQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAK 62
           D   L  V   +AG VAG+S  + ++P+D +KT +Q      S  + + +    ++I  +
Sbjct: 227 DTDALSVVSICVAGGVAGMSMWIGVFPIDTIKTKLQ------SSSRSQSMVQAAREIYTR 280

Query: 63  EGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYK 98
            G    + G+   ++   P  A  F   +   +++K
Sbjct: 281 AGLRGFFPGLGPALMRSFPANAATFLGVEFTHQLFK 316

 Score = 30.0 bits (66), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 35/75 (46%), Gaps = 4/75 (5%)

Query: 203 NDLLAGTVGGTLSSLLSTPFDVVKSRVQN---TAVIPGVPRKYNWSWPALATIYKEEGFK 259
             L AG VGG  + L   PFD++K R Q+   +  +  + R  + +      +   +  K
Sbjct: 30  ESLAAGGVGGVCAVLTGHPFDLLKVRCQSNQASGTLDAISRVLHEAKSKSGPLPLNQ-IK 88

Query: 260 ALYKGFVPKVLRLGP 274
             Y+G +P +L + P
Sbjct: 89  GFYRGVIPPLLGVTP 103

>ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH]
           (771097..772119) [1023 bp, 340 aa]
          Length = 340

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 66/311 (21%), Positives = 114/311 (36%), Gaps = 72/311 (23%)

Query: 16  GAVAGVSEILVMYPLDMVKTVMQLQV------------------------------SGGS 45
           GA A     + +YPLD+ KT++Q Q+                              S  +
Sbjct: 9   GATASSLANIAVYPLDLAKTLVQTQLKDEFVEAGEEAGEERAGSRRQNRIKPIALRSPQA 68

Query: 46  GPQYKGVFDCLKQIAAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLF---- 101
             QYKG  D L++I   EG + LY+G+ S  +    +  + F      +K Y  L     
Sbjct: 69  AEQYKGALDALQRIYGAEGVAGLYRGLGSSTVAGFIQSFSYFFWYTLVRKHYFRLKQARG 128

Query: 102 GAEKLTQPLSILSGASAGICESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILA 161
           G  + + P  ++ G  A       V P  +V  R Q   ++  +  A     V +E  + 
Sbjct: 129 GDARFSTPEELVLGIVAAATSQLFVNPINVVATRQQ---TRGQAAGAADMRTVARE--VH 183

Query: 162 MYNGLESTMWRHGIWNAGYFGIIFQV-------------RALLPKASTKSEQTRN----- 203
             NG     WR G W      ++  V              AL P  +  S    +     
Sbjct: 184 AENG-----WR-GFWAGLKVSLVLTVNPSITYATYERLREALFPTPAAASHLVDSAALLS 237

Query: 204 ---DLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKA 260
              + + G +   +S++L+ P  + K+ +Q +         +      L  +Y  EG  +
Sbjct: 238 PGQNFVMGVLSKIVSTVLTQPLIIAKASLQRSGSC------FQDFHQVLHHLYSTEGPLS 291

Query: 261 LYKGFVPKVLR 271
           L+KG  P++ +
Sbjct: 292 LWKGLGPQITK 302

 Score = 32.0 bits (71), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 34/153 (22%), Positives = 59/153 (38%), Gaps = 18/153 (11%)

Query: 132 VKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIFQVRALL 191
           + +R    + ++   +  ++ I   EG+  +Y GL S+     I +  YF     VR   
Sbjct: 61  IALRSPQAAEQYKGALDALQRIYGAEGVAGLYRGLGSSTVAGFIQSFSYFFWYTLVR--- 117

Query: 192 PKASTKSEQTR---------NDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKY 242
            K   + +Q R          +L+ G V    S L   P +VV +R Q      G     
Sbjct: 118 -KHYFRLKQARGGDARFSTPEELVLGIVAAATSQLFVNPINVVATRQQTRGQAAGAADMR 176

Query: 243 NWSWPALATIYKEEGFKALYKGF-VPKVLRLGP 274
             +      ++ E G++  + G  V  VL + P
Sbjct: 177 TVA----REVHAENGWRGFWAGLKVSLVLTVNP 205

 Score = 28.9 bits (63), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 20/89 (22%), Positives = 37/89 (41%), Gaps = 5/89 (5%)

Query: 12  QFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKG 71
            F+ G ++ +   ++  PL + K  +Q      SG  ++     L  + + EGP  L+KG
Sbjct: 241 NFVMGVLSKIVSTVLTQPLIIAKASLQR-----SGSCFQDFHQVLHHLYSTEGPLSLWKG 295

Query: 72  ISSPILMEAPKRATKFACNDEFQKIYKDL 100
           +   I      +   F    E  K+ + L
Sbjct: 296 LGPQITKGVLVQGLLFMFKGELTKMLRKL 324

>AER419W [2919] [Homologous to ScYNL083W - SH]
           complement(1442595..1444076) [1482 bp, 493 aa]
          Length = 493

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 47/228 (20%), Positives = 96/228 (42%), Gaps = 18/228 (7%)

Query: 81  PKRATKFACNDEFQKIYKDLFGAEK---LTQPLSILSGASAGICESFVVVPFELVKIRLQ 137
           P+ A KF   +  +++   L G  +   L++  + ++G   GI   F V P + +K R+Q
Sbjct: 265 PESAMKFGSFELAKRVLAGLEGCGETGELSRLSTYVAGGLGGIMAQFSVYPIDTLKFRIQ 324

Query: 138 ----DVSSK-FTSPIAVVKNIVEKEGILAMYNGLESTM---WRHGIWNAGYFGII---FQ 186
               D   +     I   K++  + G+   Y GL   +   + +   + G F  +   + 
Sbjct: 325 CAPLDTRCRGLPLLIKTAKDMYREGGLRLFYRGLGVGILGVFPYAALDLGTFSALKRWYI 384

Query: 187 VRALLPKASTKSEQTRNDLLA---GTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYN 243
            R       +++E   ++L+    G   GT+ + +  P +++++R+Q        P +Y+
Sbjct: 385 TRRANALGISENEVVMSNLVVLPMGAFSGTVGATVVYPINLLRTRLQAQGTY-AHPHRYD 443

Query: 244 WSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFFR 291
                     + EG   LYKG VP + ++ P   I  + +  +    R
Sbjct: 444 GFQDVFRKTVQREGLPGLYKGLVPTLAKVCPAVAISYLCYENLKRAMR 491

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 41/83 (49%)

Query: 16  GAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGISSP 75
           GA +G     V+YP+++++T +Q Q +     +Y G  D  ++   +EG   LYKG+   
Sbjct: 409 GAFSGTVGATVVYPINLLRTRLQAQGTYAHPHRYDGFQDVFRKTVQREGLPGLYKGLVPT 468

Query: 76  ILMEAPKRATKFACNDEFQKIYK 98
           +    P  A  + C +  ++  +
Sbjct: 469 LAKVCPAVAISYLCYENLKRAMR 491

 Score = 35.4 bits (80), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 38/171 (22%), Positives = 69/171 (40%), Gaps = 13/171 (7%)

Query: 13  FMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGI 72
           ++AG + G+     +YP+D +K  +Q             +    K +  + G    Y+G+
Sbjct: 299 YVAGGLGGIMAQFSVYPIDTLKFRIQCAPLDTRCRGLPLLIKTAKDMYREGGLRLFYRGL 358

Query: 73  SSPILMEAPKRATKFACNDEFQKIY----KDLFGAEKLTQPLSIL----SGASAGICESF 124
              IL   P  A         ++ Y     +  G  +    +S L     GA +G   + 
Sbjct: 359 GVGILGVFPYAALDLGTFSALKRWYITRRANALGISENEVVMSNLVVLPMGAFSGTVGAT 418

Query: 125 VVVPFELVKIRLQDVSS-----KFTSPIAVVKNIVEKEGILAMYNGLESTM 170
           VV P  L++ RLQ   +     ++     V +  V++EG+  +Y GL  T+
Sbjct: 419 VVYPINLLRTRLQAQGTYAHPHRYDGFQDVFRKTVQREGLPGLYKGLVPTL 469

 Score = 33.1 bits (74), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 46/209 (22%), Positives = 82/209 (39%), Gaps = 20/209 (9%)

Query: 89  CNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESFVVVPFELVKIRLQDVSSKFTSP-I 147
           C   F +I   L     L+ PL              +  P +L+    +   +K  SP +
Sbjct: 192 CTAPFDRIKVFLIARTDLSSPL--------------LHTPEQLLHHNPRADPAKIRSPLV 237

Query: 148 AVVKNIVEKEGILAMY--NGLES-TMWRHGIWNAGYFGIIFQVRALLPKASTKSEQTR-N 203
               ++  + G+ A Y  NGL    ++       G F +  +V A L       E +R +
Sbjct: 238 KAATSLYRQGGLRAFYLGNGLNVIKVFPESAMKFGSFELAKRVLAGLEGCGETGELSRLS 297

Query: 204 DLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYK 263
             +AG +GG ++     P D +K R+Q  A +    R           +Y+E G +  Y+
Sbjct: 298 TYVAGGLGGIMAQFSVYPIDTLKFRIQ-CAPLDTRCRGLPLLIKTAKDMYREGGLRLFYR 356

Query: 264 GFVPKVLRLGPGGGILLVVFTGVMDFFRT 292
           G    +L + P   + L  F+ +  ++ T
Sbjct: 357 GLGVGILGVFPYAALDLGTFSALKRWYIT 385

>Kwal_47.19228
          Length = 281

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 64/152 (42%), Gaps = 16/152 (10%)

Query: 147 IAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIFQVRALLPKASTKSEQTRNDLL 206
           +  V+ I    GI     G   T+ R    +A  F     ++ ++      +E     L 
Sbjct: 132 LTTVQEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSLKQMISPNKPLNEYYAFAL- 190

Query: 207 AGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWS-----WPALATIYKEEGFKAL 261
            G +       ++ P DV+K+R+Q+         KY WS           I+ EEGF   
Sbjct: 191 -GFISSCAVVAVTQPIDVIKTRMQS---------KYTWSNYKNSLNCAYRIFVEEGFTKF 240

Query: 262 YKGFVPKVLRLGPGGGILLVVFTGVMDFFRTV 293
           +KG+ P+++++G  GG+   V+  V +  + V
Sbjct: 241 WKGWAPRLMKVGLSGGVSFGVYQYVDNLMKAV 272

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 43/79 (54%), Gaps = 4/79 (5%)

Query: 1   MSDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIA 60
           +S  KPL   Y F  G ++  + + V  P+D++KT MQ   S  +   YK   +C  +I 
Sbjct: 176 ISPNKPLNEYYAFALGFISSCAVVAVTQPIDVIKTRMQ---SKYTWSNYKNSLNCAYRIF 232

Query: 61  AKEGPSRLYKGISSPILME 79
            +EG ++ +KG  +P LM+
Sbjct: 233 VEEGFTKFWKGW-APRLMK 250

>Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement
          Length = 513

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 42/83 (50%)

Query: 16  GAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGISSP 75
           GA +G     V+YP+++++T +Q Q +      Y G  D L +   +EG   L+KG+   
Sbjct: 429 GAFSGTVGATVVYPINLLRTRLQAQGTYAHPHTYTGFRDVLWKTVQREGYQGLFKGLVPN 488

Query: 76  ILMEAPKRATKFACNDEFQKIYK 98
           +    P  +  + C + F+++ K
Sbjct: 489 LAKVCPAVSISYLCYENFKRLMK 511

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 49/239 (20%), Positives = 99/239 (41%), Gaps = 22/239 (9%)

Query: 64  GPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAE---KLTQPLSILSGASAGI 120
           G    Y G    ++   P+ A KF   +  +++   L G     +L++  + ++G   G+
Sbjct: 268 GIRAFYVGNGLNVIKVFPESAMKFGSFELAKQLMAHLEGVHHTSELSKFSTYIAGGMGGV 327

Query: 121 CESFVVVPFELVKIRLQ----DVSSKFTSP-IAVVKNIVEKEGILAMYNGLESTMWRHGI 175
              F V P + +K R+Q    D + K     I+  + +    G+   Y G+  T+   GI
Sbjct: 328 VAQFSVYPIDTLKYRVQCAPLDTALKGNELLISTARQMYRDGGLKLFYRGV--TVGVMGI 385

Query: 176 W-----NAGYFGII---FQVRALLPKASTKSEQTRNDLLA---GTVGGTLSSLLSTPFDV 224
           +     + G F  +   +  R          + T ++ +    G   GT+ + +  P ++
Sbjct: 386 FPYAALDLGTFSALKKWYIARQAKMTGVPVDQVTISNFIVLPMGAFSGTVGATVVYPINL 445

Query: 225 VKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVF 283
           +++R+Q        P  Y      L    + EG++ L+KG VP + ++ P   I  + +
Sbjct: 446 LRTRLQAQGTYAH-PHTYTGFRDVLWKTVQREGYQGLFKGLVPNLAKVCPAVSISYLCY 503

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 47/205 (22%), Positives = 82/205 (40%), Gaps = 28/205 (13%)

Query: 113 LSGASAGICESFVVVPFELVKIRL---QDVSS-------------------KFTSP-IAV 149
           ++G  +G+       PF+ +K+ L    D+SS                   K  SP I  
Sbjct: 200 IAGGCSGVISRTCTAPFDRIKVFLIARTDLSSTLLNSKDKVLMKNPNADISKIKSPLIKA 259

Query: 150 VKNIVEKEGILAMY--NGLES-TMWRHGIWNAGYFGIIFQVRALLPKASTKSEQTR-NDL 205
              +  + GI A Y  NGL    ++       G F +  Q+ A L      SE ++ +  
Sbjct: 260 ATTLYRQGGIRAFYVGNGLNVIKVFPESAMKFGSFELAKQLMAHLEGVHHTSELSKFSTY 319

Query: 206 LAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGF 265
           +AG +GG ++     P D +K RVQ  A +    +           +Y++ G K  Y+G 
Sbjct: 320 IAGGMGGVVAQFSVYPIDTLKYRVQ-CAPLDTALKGNELLISTARQMYRDGGLKLFYRGV 378

Query: 266 VPKVLRLGPGGGILLVVFTGVMDFF 290
              V+ + P   + L  F+ +  ++
Sbjct: 379 TVGVMGIFPYAALDLGTFSALKKWY 403

 Score = 32.3 bits (72), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 37/169 (21%), Positives = 71/169 (42%), Gaps = 17/169 (10%)

Query: 13  FMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGI 72
           ++AG + GV     +YP+D +K  +Q      +    + +    +Q+    G    Y+G+
Sbjct: 319 YIAGGMGGVVAQFSVYPIDTLKYRVQCAPLDTALKGNELLISTARQMYRDGGLKLFYRGV 378

Query: 73  SSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQ-PLSILS---------GASAGICE 122
           +  ++   P  A         +K Y  +    K+T  P+  ++         GA +G   
Sbjct: 379 TVGVMGIFPYAALDLGTFSALKKWY--IARQAKMTGVPVDQVTISNFIVLPMGAFSGTVG 436

Query: 123 SFVVVPFELVKIRLQDVSS-----KFTSPIAVVKNIVEKEGILAMYNGL 166
           + VV P  L++ RLQ   +      +T    V+   V++EG   ++ GL
Sbjct: 437 ATVVYPINLLRTRLQAQGTYAHPHTYTGFRDVLWKTVQREGYQGLFKGL 485

>Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement
          Length = 344

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 63/311 (20%), Positives = 121/311 (38%), Gaps = 63/311 (20%)

Query: 14  MAGAVAGVSEILVMYPLDMVKTVMQLQV-------------------------------- 41
           ++GAVA      V+YPLD+VKT++Q Q+                                
Sbjct: 8   LSGAVASAMANTVVYPLDLVKTLVQTQLKQDEQLKQLETEPQSQDKDEPVKDIPPVPIKL 67

Query: 42  SGGSGPQYKGVFDCLKQIAAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDL- 100
           +  +  QY   FD + +I  +EG   LY+G+++ ++    +  + F      +K Y  + 
Sbjct: 68  NENNYLQYNSTFDAIYKIYKQEGIRGLYQGLTTSVMAGFFQTFSYFFWYSFVRKCYFRVK 127

Query: 101 ---FGAEKLTQPLSILSGASAGICESFVVVPFELVKIRLQ-----DVSSKFTSPIAVVKN 152
                  K T    +L G  A         P  L+  R Q     D  + F   + V K 
Sbjct: 128 LINRKNTKFTTIEELLLGIVAAATSQIFTNPISLISARQQTRQGIDGDNDF---LTVAKE 184

Query: 153 IV-EKEGILAMYNGLESTMW-----------RHGIWNAGYFGIIFQVRALLPKASTKSEQ 200
           I  E+  I   + GL+ ++               + +A +      ++  L  +S++   
Sbjct: 185 IYKEQRSIKGFWKGLKVSLMLTINPSITYTSYEKLKDALFTTDTMNLKKELVDSSSQLSP 244

Query: 201 TRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKA 260
            +N  L G +   +S++++ P  + K+ +Q           ++     L  +YK EG ++
Sbjct: 245 YQNFTL-GVLSKMISAIITMPLIISKAWLQRNG------SNFSSFQQVLYYLYKNEGLRS 297

Query: 261 LYKGFVPKVLR 271
            +KG  P++ +
Sbjct: 298 WWKGLSPQLAK 308

>KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyces
           cerevisiae YPR128c, start by similarity
          Length = 355

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 67/319 (21%), Positives = 121/319 (37%), Gaps = 74/319 (23%)

Query: 16  GAVAGVSEILVMYPLDMVKTVMQLQV--------------------SGGSGP-------- 47
           GAV+     L +YPLD+ KTV+Q Q+                    +G S P        
Sbjct: 10  GAVSSGFANLAVYPLDLAKTVIQTQLKQGDLYPSSDVQADVSTKESTGSSKPKKHGIQQI 69

Query: 48  ----------------QYKGVFDCLKQIAAKEGPSRLYKGISSPILMEAPKRATKFACND 91
                           +YK   D + ++   EG   LY G+S+ +L    +  + F    
Sbjct: 70  KPKPEPPTATKESLEQRYKHALDVIVKVYRNEGFGGLYHGLSASLLGTFIQSFSYFFWYT 129

Query: 92  EFQKIY---KDLFG-AEKLTQPLSILSGASAGICESFVVVPFELVKIRLQ-------DVS 140
             ++ Y   K + G A + +    +L    A         P  +V  + Q       D S
Sbjct: 130 LIRRHYFRVKKVKGEAARFSTIEELLLSMLAAATSQLFTNPINIVSTKQQTRRGLEGDNS 189

Query: 141 SKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFG------IIFQVRALLPKA 194
            K     A+ K + +++GI   +  L+ ++      +  Y        I++ V       
Sbjct: 190 FK-----AIAKEVYDEDGITGFWKSLKVSLVLTINPSITYASAEKLKDILYHVEWNAKDL 244

Query: 195 STKSEQTR--NDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATI 252
           +  S Q +   + L G +   +S+ L+ P  V K+ +Q ++       K+      L  +
Sbjct: 245 NDSSLQLKPGQNFLIGVLSKIISTCLTHPLIVAKASLQRSS------SKFTSFQEVLTYL 298

Query: 253 YKEEGFKALYKGFVPKVLR 271
           Y+ EG  AL+KG +P++ +
Sbjct: 299 YRHEGAHALWKGLLPQLTK 317

 Score = 35.8 bits (81), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 33/147 (22%), Positives = 66/147 (44%), Gaps = 16/147 (10%)

Query: 137 QDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYF-------GIIFQVRA 189
           + +  ++   + V+  +   EG   +Y+GL +++    I +  YF          F+V+ 
Sbjct: 81  ESLEQRYKHALDVIVKVYRNEGFGGLYHGLSASLLGTFIQSFSYFFWYTLIRRHYFRVKK 140

Query: 190 LLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPAL 249
           +  +A+  S  T  +LL   +    S L + P ++V ++ Q    + G     + S+ A+
Sbjct: 141 VKGEAARFS--TIEELLLSMLAAATSQLFTNPINIVSTKQQTRRGLEG-----DNSFKAI 193

Query: 250 A-TIYKEEGFKALYKGF-VPKVLRLGP 274
           A  +Y E+G    +K   V  VL + P
Sbjct: 194 AKEVYDEDGITGFWKSLKVSLVLTINP 220

 Score = 35.0 bits (79), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 36/165 (21%), Positives = 72/165 (43%), Gaps = 12/165 (7%)

Query: 10  VYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLY 69
           + + +   +A  +  L   P+++V T  Q +        +K +    K++  ++G +  +
Sbjct: 151 IEELLLSMLAAATSQLFTNPINIVSTKQQTRRGLEGDNSFKAI---AKEVYDEDGITGFW 207

Query: 70  KGISSPILMEAPKRATKFACNDEFQKIY-------KDLFGAEKLTQP-LSILSGASAGIC 121
           K +   +++      T +A  ++ + I        KDL  +    +P  + L G  + I 
Sbjct: 208 KSLKVSLVLTINPSIT-YASAEKLKDILYHVEWNAKDLNDSSLQLKPGQNFLIGVLSKII 266

Query: 122 ESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGL 166
            + +  P  + K  LQ  SSKFTS   V+  +   EG  A++ GL
Sbjct: 267 STCLTHPLIVAKASLQRSSSKFTSFQEVLTYLYRHEGAHALWKGL 311

>Scas_671.1*
          Length = 123

 Score = 32.3 bits (72), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 38/86 (44%), Gaps = 7/86 (8%)

Query: 193 KASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATI 252
           K ST +    N + +     +L++ ++ PFD +K+R+Q        P+ +   +  L  I
Sbjct: 32  KFSTSTSTVVNSV-SAIASASLATAITAPFDTIKTRMQLK------PKVFTNFFTTLVLI 84

Query: 253 YKEEGFKALYKGFVPKVLRLGPGGGI 278
            K E    L+ G   ++ R     GI
Sbjct: 85  TKNESIFQLFSGLSMRLTRKALSAGI 110

 Score = 30.8 bits (68), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 36/73 (49%), Gaps = 1/73 (1%)

Query: 111 SILSGASAGICESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTM 170
           S+ + ASA +  + +  PF+ +K R+Q     FT+    +  I + E I  +++GL   +
Sbjct: 43  SVSAIASASLATA-ITAPFDTIKTRMQLKPKVFTNFFTTLVLITKNESIFQLFSGLSMRL 101

Query: 171 WRHGIWNAGYFGI 183
            R  +     +GI
Sbjct: 102 TRKALSAGIAWGI 114

>Sklu_1809.2 YDR194C, Contig c1809 1564-3570 reverse complement
          Length = 668

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 37/69 (53%), Gaps = 5/69 (7%)

Query: 80  APKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGAS--AGICESFVVVPFELVKI--R 135
           AP R      + E QKI+K+ +G +K  + + ++ G +  + I + F   P  +V    R
Sbjct: 200 APTRDLALQIDSEIQKIHKNNYGLQKF-KSVCLIGGTNFDSSIKKMFKERPNIIVATPGR 258

Query: 136 LQDVSSKFT 144
           LQDV SKF+
Sbjct: 259 LQDVMSKFS 267

>AER138C [2642] [Homologous to ScYML069W (POB3) - SH]
           (897283..898911) [1629 bp, 542 aa]
          Length = 542

 Score = 30.4 bits (67), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 24/41 (58%)

Query: 90  NDEFQKIYKDLFGAEKLTQPLSILSGASAGICESFVVVPFE 130
           +DEF+++YKD    +   +   +LS    G+ ++ VVVP E
Sbjct: 321 DDEFERLYKDKLKKQYDAKTHVVLSHVLKGLTDTRVVVPGE 361

>YBR054W (YRO2) [244] chr2 (343061..344095) Protein paralog of
           Mrh1p, has similarity to heat shock protein Hsp30 [1035
           bp, 344 aa]
          Length = 344

 Score = 29.6 bits (65), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 23/36 (63%)

Query: 115 GASAGICESFVVVPFELVKIRLQDVSSKFTSPIAVV 150
           GA+  +C S +   F LVK R +DVS+ F + ++V+
Sbjct: 176 GAAIVVCISLMTTTFNLVKARGKDVSNVFITFMSVI 211

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.138    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,847,568
Number of extensions: 352159
Number of successful extensions: 2697
Number of sequences better than 10.0: 212
Number of HSP's gapped: 1486
Number of HSP's successfully gapped: 574
Length of query: 293
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 192
Effective length of database: 13,099,691
Effective search space: 2515140672
Effective search space used: 2515140672
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 61 (28.1 bits)