Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0D07051g32331816860.0
YOR221C (MCT1)3842934926e-59
ACR108C2963114734e-57
Kwal_26.86643143224693e-56
CAGL0J04136g3443304442e-52
Scas_650.13342703754e-42
YNL326C336115760.14
Sklu_2324.511340660.83
CAGL0D00528g208162681.7
YOR245C (DGA1)41895653.7
CAGL0I03828g171530653.9
KLLA0B02717g204762644.8
CAGL0L04202g24351625.8
AFR376W45087635.9
YMR066W89876628.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D07051g
         (318 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D07051g complement(604505..605476) weakly similar to sgd|S0...   654   0.0  
YOR221C (MCT1) [5013] chr15 complement(756476..757536,757738..75...   194   6e-59
ACR108C [1155] [Homologous to ScYOR221C (MCT1) - SH] (545576..54...   186   4e-57
Kwal_26.8664                                                          185   3e-56
CAGL0J04136g 385772..386806 similar to tr|Q12283 Saccharomyces c...   175   2e-52
Scas_650.1                                                            149   4e-42
YNL326C (YNL326C) [4289] chr14 complement(27336..28346) Protein ...    34   0.14 
Sklu_2324.5 YFR049W, Contig c2324 7464-7805                            30   0.83 
CAGL0D00528g 64404..70649 highly similar to sp|P07149 Saccharomy...    31   1.7  
YOR245C (DGA1) [5034] chr15 complement(794076..795332) Diacylgly...    30   3.7  
CAGL0I03828g complement(328922..334069) highly similar to sp|P04...    30   3.9  
KLLA0B02717g 240125..246268 highly similar to sp|P07149 Saccharo...    29   4.8  
CAGL0L04202g complement(490762..491493) similar to sp|P53915 Sac...    28   5.8  
AFR376W [3568] [Homologous to ScYHR009C - SH] complement(1114930...    29   5.9  
YMR066W (YMR066W) [4025] chr13 (401540..404236) Protein of unkno...    28   8.3  

>KLLA0D07051g complement(604505..605476) weakly similar to
           sgd|S0005747 Saccharomyces cerevisiae YOR221c MCT1
           malonyl-CoA:ACP transferase, start by similarity
          Length = 323

 Score =  654 bits (1686), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/318 (100%), Positives = 318/318 (100%)

Query: 1   MSGRLLSFPGQGSKVLLDRLQRWAANVSGFKDVSLIDRFTGTLEQPETIAACSNLLYSNW 60
           MSGRLLSFPGQGSKVLLDRLQRWAANVSGFKDVSLIDRFTGTLEQPETIAACSNLLYSNW
Sbjct: 1   MSGRLLSFPGQGSKVLLDRLQRWAANVSGFKDVSLIDRFTGTLEQPETIAACSNLLYSNW 60

Query: 61  LTDNANQNSNGKTYVIGHSLGELNALNASVNGLAFGCKDIIEIASFRNQLMVEATQRYLE 120
           LTDNANQNSNGKTYVIGHSLGELNALNASVNGLAFGCKDIIEIASFRNQLMVEATQRYLE
Sbjct: 61  LTDNANQNSNGKTYVIGHSLGELNALNASVNGLAFGCKDIIEIASFRNQLMVEATQRYLE 120

Query: 121 KCRITDDSFELWAVTNVRSKNLRKDLSAVLDSNITNSSVDKPCSIKLANDNAVNQCVITG 180
           KCRITDDSFELWAVTNVRSKNLRKDLSAVLDSNITNSSVDKPCSIKLANDNAVNQCVITG
Sbjct: 121 KCRITDDSFELWAVTNVRSKNLRKDLSAVLDSNITNSSVDKPCSIKLANDNAVNQCVITG 180

Query: 181 LSNDIQKLVETCKMENLRHKFTKLDSPFSIPFHNINVLRSIQEPLYDFIWDTLKENGKHH 240
           LSNDIQKLVETCKMENLRHKFTKLDSPFSIPFHNINVLRSIQEPLYDFIWDTLKENGKHH
Sbjct: 181 LSNDIQKLVETCKMENLRHKFTKLDSPFSIPFHNINVLRSIQEPLYDFIWDTLKENGKHH 240

Query: 241 FINEKVENGIFSNIDGKLTYQFDTALENFVAGSCNIVNFVDSCKNISSLSSVEKAYHFGP 300
           FINEKVENGIFSNIDGKLTYQFDTALENFVAGSCNIVNFVDSCKNISSLSSVEKAYHFGP
Sbjct: 241 FINEKVENGIFSNIDGKLTYQFDTALENFVAGSCNIVNFVDSCKNISSLSSVEKAYHFGP 300

Query: 301 GTSIGKLIERNLKTCDIS 318
           GTSIGKLIERNLKTCDIS
Sbjct: 301 GTSIGKLIERNLKTCDIS 318

>YOR221C (MCT1) [5013] chr15
           complement(756476..757536,757738..757831) Malonyl
           CoA:acyl carrier protein transferase [1155 bp, 384 aa]
          Length = 384

 Score =  194 bits (492), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 115/293 (39%), Positives = 173/293 (59%), Gaps = 30/293 (10%)

Query: 46  PETIAACSNLLYSNWLT------------------DNANQNSNGKTYVIGHSLGELNALN 87
           P +IA CSNL Y  +                    D+ ++  N + Y++GHSLGEL  L 
Sbjct: 78  PGSIAVCSNLFYQLYQILSNPSDPQDQAPKNMTKIDSPDKKDNEQCYLLGHSLGELTCL- 136

Query: 88  ASVNGLAFGCKDIIEIASFRNQLMVEATQRYLEKCRIT-DDSFELWAVTNVRSKNLRKDL 146
            SVN L F  KD+ +IA+FRN+LMV +T++YL    I   + FE+WA+++ R+ +L +++
Sbjct: 137 -SVNSL-FSLKDLFDIANFRNKLMVTSTEKYLVAHNINRSNKFEMWALSSPRATDLPQEV 194

Query: 147 SAVLDS-NITNSSVDKPCSIKLANDNAVNQCVITGLSNDIQKLVETCKMENLRHKFTKLD 205
             +L+S N+ +SS +   +I +AN N+V QCV+TGL +D++ L     +   R + T+L 
Sbjct: 195 QKLLNSPNLLSSSQN---TISVANANSVKQCVVTGLVDDLESLRTELNLRFPRLRITELT 251

Query: 206 SPFSIPFHNINVLRSIQEPLYDFIWDTLKENGKHHFINEKVENGIFSNIDGKLTYQFDTA 265
           +P++IPFHN  VLR +QEPLYD+IWD LK+NG H  +  ++ + I +N+DG ++Y    A
Sbjct: 252 NPYNIPFHNSTVLRPVQEPLYDYIWDILKKNGTHTLM--ELNHPIIANLDGNISYYIHHA 309

Query: 266 LENFVAGSCNIVNFVDSCKNISSLSSVE--KAYHFGPGTSIGKLIERNLKTCD 316
           L+ FV  S   V F      I+S + VE  K+  FGPG  I  LI RN    D
Sbjct: 310 LDRFVKCSSRTVQFTMCYDTINSGTPVEIDKSICFGPGNVIYNLIRRNCPQVD 362

>ACR108C [1155] [Homologous to ScYOR221C (MCT1) - SH]
           (545576..546466) [891 bp, 296 aa]
          Length = 296

 Score =  186 bits (473), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 112/311 (36%), Positives = 159/311 (51%), Gaps = 29/311 (9%)

Query: 4   RLLSFPGQGSKVLLDRLQRWAANVSGFKDVSLIDRFTGTLEQPET---IAACSNLLYSNW 60
           RL++FPGQGS VL   L RW  + +GF+  S+ D       QP     IAACS LLY  W
Sbjct: 2   RLVTFPGQGSAVLASSLARWCESRAGFQHSSVADVVAYVERQPAAPGAIAACSTLLYQCW 61

Query: 61  LTDNANQNSNGKTYVIGHSLGELNALNASVNGLAFGCKDIIEIASFRNQLMVEATQRYLE 120
           L     Q   G+  ++GHSLGEL+ALNAS +    G  D++E+A  R+ LM EA   +  
Sbjct: 62  LERGPEQ---GEAMMLGHSLGELSALNASGSNALLGVHDVLEVAQRRHALMREAAAAHAR 118

Query: 121 KCRITDDSFELWAVTNVRSKNLRKDLSAVLDSNITNSSVDKPCSIKLANDNAVNQCVITG 180
              +    F    VT  R+ +LR  L             +   +++LAN N++ QC++TG
Sbjct: 119 AHGVR--GFVARVVTLRRAGDLRAQL-------------ELRGTLRLANHNSLRQCIVTG 163

Query: 181 LSNDIQKLVETCKMENLRHKFTKLDSPFSIPFHNINVLRSIQEPLYDFIWDTLKENGKHH 240
            ++D               +   L +P  IPFHN  VLR IQ PLYD +W+ L  NG   
Sbjct: 164 AADDPAWAALPAGA-----RVDALLNPDGIPFHNDAVLRPIQGPLYDLLWERLARNGVSR 218

Query: 241 FINEKVENGIFSNIDGKLTYQFDTALENFVAGSCNIVNFVDSCKNISSLSSVEKAYHFGP 300
                ++  + S +DG  T + D A+E FV  S N+V FV +C+     +    A H GP
Sbjct: 219 --ARSLDRPLLSCLDGAATDRLDVAVEKFVRSSTNVVEFVAACRTAVQ-AGATAALHVGP 275

Query: 301 GTSIGKLIERN 311
           G ++G L++RN
Sbjct: 276 GRAVGALVDRN 286

>Kwal_26.8664
          Length = 314

 Score =  185 bits (469), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 120/322 (37%), Positives = 171/322 (53%), Gaps = 38/322 (11%)

Query: 4   RLLSFPGQGSKVLLDRLQRWAANVSG-FKDV-------SLIDRFTGTLEQPETIAACSNL 55
           + ++FPGQG+ V L   + + A  S  F+ V       S++        +P +IAACS L
Sbjct: 2   KAVTFPGQGTAVGLSVFRCYLAETSRRFQSVFGRPGRASVLASIERKPAEPASIAACSYL 61

Query: 56  LYSNWLTDNANQNSNGKTYVIGHSLGELNALNASVNGLAFGCKDIIEIASFRNQLMVEAT 115
           L+  +        S+ +   +GHSLGEL  L A  NGL FG  + +E+A++RN+LMVEA 
Sbjct: 62  LFDLY---RQFSRSDEQLVFLGHSLGELGCLGAG-NGL-FGLTETMEVAAYRNRLMVEA- 115

Query: 116 QRYLEKCRITDDSFELWAVTNVRSKNLRKDLSAVLDSNITNSSVDKPCSIKLANDNAVNQ 175
                   +    + +WAV+  RS+NL  +L  +L SN+          I LAN N   Q
Sbjct: 116 --------VHGTQYGMWAVSAPRSRNLALELRPLL-SNL---------GIALANVNTNTQ 157

Query: 176 CVITGLSNDIQKLVETCKMENLRHKFTKLDSPFSIPFHNINVLRSIQEPLYDFIWDTLKE 235
           CV+TGL  D +           R +  KL++P+ IPFHN ++L SIQEPL DF+W  LK 
Sbjct: 158 CVVTGLELDGEHWTRELSQHIPRCRIQKLENPYHIPFHNRDILGSIQEPLLDFMWKKLKR 217

Query: 236 NGKHHFINEKVENGIFSNIDGKLTYQFDTALENFVAGSCNIVNFVDSCKNISSLSSVEKA 295
           +G        +   + SN  G+L    D ALE+F A SCN+V FV  C  ++ L  V +A
Sbjct: 218 DGG--LTPTSLRYLMISNATGELITNVDRALESFAASSCNVVEFVSCCNTLNKL-GVHEA 274

Query: 296 YHFGPGTSIGKLIERNLKTCDI 317
            H GPGT + KL+ RN   CD+
Sbjct: 275 MHLGPGTVVSKLVRRN---CDL 293

>CAGL0J04136g 385772..386806 similar to tr|Q12283 Saccharomyces
           cerevisiae YOR221c MCT1 malonyl-CoA:ACP transferase,
           hypothetical start
          Length = 344

 Score =  175 bits (444), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 111/330 (33%), Positives = 171/330 (51%), Gaps = 27/330 (8%)

Query: 4   RLLSFPGQGSKVLLDRLQRWAANVS---------GFKDVSLIDRFTGTLEQPETIAACSN 54
           +L++FPGQG+ + +  L+    N           G     L++        P +IA CSN
Sbjct: 2   KLVTFPGQGTPIPVAVLKALIRNKDAQFNTILNRGLHRRDLLEYIFRNPSSPGSIAVCSN 61

Query: 55  LLYSNW--LTDNANQNSNGKTYVIGHSLGELNALNASVNGLAFGCKDIIEIASFRNQLMV 112
            LY  +  ++++   +      ++GHSLGEL  L   VN L F  K++ EIA++RN LMV
Sbjct: 62  FLYEMYGLISEDLRPHHRDSLILLGHSLGELTCL--KVNEL-FTTKELFEIANYRNDLMV 118

Query: 113 EATQRYLEKCRITDDSFELWAVTNVRSKNLRKDLSAVLDSNITNSSVDKPCSIKLANDNA 172
           + T++YL         FE+WA+++ ++ +L  ++  +L  + T        +I +AN N+
Sbjct: 119 KYTEQYLRAYNRRGSKFEMWALSSPKATDLPYEIHKLLTESPTFPGSH---TISVANANS 175

Query: 173 VNQCVITGLSNDIQKLVETCKMENLRHKFTKLDSPFSIPFHNINVLRSIQEPLYDFIWDT 232
           V QCV+TGL  D++ L     +   R + ++L +P ++PFHN  VLR IQEPLYDFIW  
Sbjct: 176 VKQCVVTGLVEDLEALRTELHLNIPRLRISELTNPHNLPFHNNTVLRPIQEPLYDFIWKI 235

Query: 233 LKENGKHHFINEKVENGIFSNIDGKLTYQFDTALENFVAGSCNIVNFVDSCKNISSLSSV 292
           +K NG H +    + + I SN+DGK T     AL+ FV  S   V F      I+ ++  
Sbjct: 236 MKNNGTHTWTT--LNHPIVSNLDGKETKFIHHALDKFVKCSSTTVQFTKCYDTINRIAEA 293

Query: 293 EK--------AYHFGPGTSIGKLIERNLKT 314
            K        A   GPG  I  LI RN+ +
Sbjct: 294 TKDQEDPLDAAICIGPGNVIYNLIRRNVPS 323

>Scas_650.1
          Length = 334

 Score =  149 bits (375), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 95/270 (35%), Positives = 152/270 (56%), Gaps = 15/270 (5%)

Query: 46  PETIAACSNLLYSNW-LTDNANQNSNGKTYVIGHSLGELNALNASVNGLAFGCKDIIEIA 104
           P +IA CS+LLY  + ++      ++    ++GHSLGEL  L  S+N L F   D+ +I+
Sbjct: 46  PGSIAVCSSLLYQLYKISSLTPTPADEPPLLLGHSLGELTCL--SINNL-FTLNDLFKIS 102

Query: 105 SFRNQLMVEATQRYLEKCRITDDS-FELWAVTNVRSKNLRKDLSAVLDS-NITNSSVDKP 162
           ++RN LM++ T++YL   +I   S FE+WA+++  + +L + +  +L S  I N +V   
Sbjct: 103 NYRNDLMIKYTEKYLIAHKINHSSKFEMWALSSPNASDLPEQVYQLLTSLPIPNGTVS-- 160

Query: 163 CSIKLANDNAVNQCVITGLSNDIQKLVETCKMENLRHKFTKLDSPFSIPFHNINVLRSIQ 222
               +AN N+  QCV T L  D++ L     +   + + T+L +P +IPFHN  +LR IQ
Sbjct: 161 ----IANANSPKQCVATELVEDLESLRTELHISFPKLRITELTNPSNIPFHNDRILRPIQ 216

Query: 223 EPLYDFIWDTLKENGKHHFINEKVENGIFSNIDGKLTYQFDTALENFVAGSCNIVNFVDS 282
           EPLYD+IW  LK+N        ++  GI +N+DG ++     ALE F+  S N V F   
Sbjct: 217 EPLYDYIWSILKQNNTQTM--TELPMGIIANLDGGVSRFVHHALEKFIKCSSNTVEFTKC 274

Query: 283 CKNISSLS-SVEKAYHFGPGTSIGKLIERN 311
            + I++ + +V  +   GPG  I  L+ RN
Sbjct: 275 YETINNKAFNVTDSVCIGPGNVIFNLVRRN 304

>YNL326C (YNL326C) [4289] chr14 complement(27336..28346) Protein
           with similarity to Akr1p and Swf1p [1011 bp, 336 aa]
          Length = 336

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 50/115 (43%), Gaps = 6/115 (5%)

Query: 17  LDRLQRWAANVSGFKDVSLIDRFTGTLEQPETIAACSNLLYSNW-LTDNANQNSNGKTYV 75
           +D    W A  +GF++     +F        T+ A   L+Y+ + L    N  S  +  +
Sbjct: 130 MDHHCPWFAECTGFRNQKFFIQFLMY----TTLYAFLVLIYTCYELGTWFNSGSFNRELI 185

Query: 76  IGHSLG-ELNALNASVNGLAFGCKDIIEIASFRNQLMVEATQRYLEKCRITDDSF 129
             H LG  L A+   ++ LAF C  I ++   +  + V   +RY     I +DS+
Sbjct: 186 DFHLLGVALLAVAVFISVLAFTCFSIYQVCKNQTTIEVHGMRRYRRDLEILNDSY 240

>Sklu_2324.5 YFR049W, Contig c2324 7464-7805
          Length = 113

 Score = 30.0 bits (66), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 22/40 (55%)

Query: 71  GKTYVIGHSLGELNALNASVNGLAFGCKDIIEIASFRNQL 110
           G  + I    GE++A   +VNGL  G KD +  A F ++L
Sbjct: 6   GTRHPIPKGTGEIHAHPCTVNGLLPGSKDCVNAADFLSKL 45

>CAGL0D00528g 64404..70649 highly similar to sp|P07149 Saccharomyces
            cerevisiae YKL182w FAS1 fatty-acyl-CoA synthase,
            hypothetical start
          Length = 2081

 Score = 30.8 bits (68), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 32/62 (51%), Gaps = 3/62 (4%)

Query: 58   SNWLTDNANQNSNGKTYVIGHSLGELNALNASVNGLAFGCKDIIEIASFRNQLMVEATQR 117
            + WL +  N N   + YV   + G+L AL+   N L F     I+IA  ++++ +E  + 
Sbjct: 1913 TEWLLEIVNYNVENQQYV---AAGDLRALDTLTNVLNFIKIQKIDIAKLQDEMSLEKVEE 1969

Query: 118  YL 119
            +L
Sbjct: 1970 HL 1971

>YOR245C (DGA1) [5034] chr15 complement(794076..795332)
           Diacylglycerol acyltransferase, involved in biosynthesis
           of triacylglycerol [1257 bp, 418 aa]
          Length = 418

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 36/95 (37%), Gaps = 9/95 (9%)

Query: 56  LYSNWLTDNANQNSNGKTYVIG---HSLGELNALNASVNGLAFGCKDIIEIASFRNQLMV 112
           L SN   D  NQ   G TY+ G   H +G L A  A       GC            LM 
Sbjct: 170 LKSNSTIDYRNQECTGPTYLFGYHPHGIGALGAFGAFATE---GCNYSKIFPGIPISLMT 226

Query: 113 EATQRYLEKCRITDDSFELWAVTNVRSKNLRKDLS 147
             TQ ++   R   D      +++V  KN  + LS
Sbjct: 227 LVTQFHIPLYR---DYLLALGISSVSRKNALRTLS 258

>CAGL0I03828g complement(328922..334069) highly similar to sp|P04050
            Saccharomyces cerevisiae YDL140c RPO21 DNA-directed RNA
            polymerase II, start by similarity
          Length = 1715

 Score = 29.6 bits (65), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 22/30 (73%), Gaps = 1/30 (3%)

Query: 114  ATQRYLEKCRITDDSFELWAVTNVRSKNLR 143
            AT+R L++ R+T ++FE W + NV ++ LR
Sbjct: 1027 ATRRVLQEYRLTKEAFE-WVLNNVEAQFLR 1055

>KLLA0B02717g 240125..246268 highly similar to sp|P07149 Saccharomyces
            cerevisiae YKL182w FAS1 fatty-acyl-CoA synthase, beta
            chain singleton, start by similarity
          Length = 2047

 Score = 29.3 bits (64), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 3/62 (4%)

Query: 58   SNWLTDNANQNSNGKTYVIGHSLGELNALNASVNGLAFGCKDIIEIASFRNQLMVEATQR 117
            + WL +  N N   + YV   + G+L AL+   N L F     I+IA  +  L +E  + 
Sbjct: 1879 TGWLLEIVNYNVENQQYV---AAGDLRALDTLTNVLNFVKLQKIDIAKLQETLSLEEVES 1935

Query: 118  YL 119
            +L
Sbjct: 1936 HL 1937

>CAGL0L04202g complement(490762..491493) similar to sp|P53915
           Saccharomyces cerevisiae YNL129w, hypothetical start
          Length = 243

 Score = 28.5 bits (62), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 28/51 (54%), Gaps = 10/51 (19%)

Query: 221 IQEPLY--DFIWDTLKENGKHHFINEKVENGIFSNIDGKLTYQFDTALENF 269
           +  P Y  DF++   KE   H FI+        +N++G+L Y+ + ++++F
Sbjct: 174 VDPPYYFDDFVYKNYKEAHAHLFID--------NNVEGQLKYELNDSIKDF 216

>AFR376W [3568] [Homologous to ScYHR009C - SH]
           complement(1114930..1116282) [1353 bp, 450 aa]
          Length = 450

 Score = 28.9 bits (63), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 39/87 (44%), Gaps = 16/87 (18%)

Query: 239 HHFINEKVENGIFSNIDGKLT-YQFDTALENFVAGSCNIVNFVDS------CKNISSLSS 291
           H+ +N+ +E G    I GK+T   FD   + FVA   + +  VDS       K +S L +
Sbjct: 205 HYLLNKAMETGAVDLILGKVTQILFD---DRFVARGVSYMPNVDSPEEQTEVKEVSILGT 261

Query: 292 VEKAYHFGPGTSIGKLIERNLKTCDIS 318
            +     GP TS      R L  C IS
Sbjct: 262 QQVVLCMGPWTS------RILPDCPIS 282

>YMR066W (YMR066W) [4025] chr13 (401540..404236) Protein of unknown
           function [2697 bp, 898 aa]
          Length = 898

 Score = 28.5 bits (62), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 33/76 (43%), Gaps = 2/76 (2%)

Query: 244 EKVENGIFSNIDGKLTYQFDTALENFVA--GSCNIVNFVDSCKNISSLSSVEKAYHFGPG 301
           E++EN + SN   +     DT  E F+     CN  NF  S KN++ L    ++      
Sbjct: 61  EEIENNLLSNKKFQEINPLDTIQETFIQYLKFCNETNFKRSNKNLNRLKKTLESKDSNST 120

Query: 302 TSIGKLIERNLKTCDI 317
             I  +    L+ CD+
Sbjct: 121 VKINAVFNYLLEECDL 136

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.133    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,684,192
Number of extensions: 474220
Number of successful extensions: 1502
Number of sequences better than 10.0: 29
Number of HSP's gapped: 1473
Number of HSP's successfully gapped: 29
Length of query: 318
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 216
Effective length of database: 13,065,073
Effective search space: 2822055768
Effective search space used: 2822055768
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 61 (28.1 bits)