Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0D07029g53450825520.0
YPL133C (RDS2)44637611561e-155
ACR107W38432211291e-152
CAGL0M02651g46237911231e-149
Scas_700.4040720810161e-134
Kwal_26.86623552089991e-132
Kwal_14.16364561742473e-22
AFL031W5171742342e-20
YBR239C5292002315e-20
KLLA0F10417g5071662299e-20
CAGL0K06985g5962222228e-19
Scas_597.25401742211e-18
KLLA0F13904g5792052084e-17
Sklu_2207.45322011977e-16
YJL103C6182291853e-14
CAGL0L03674g6292231674e-12
AFR081C4821461559e-11
Scas_711.185092011541e-10
CAGL0K05841g137252910.007
KLLA0F22990g125328900.009
KLLA0D00484g100430860.022
KLLA0F10835g75624840.036
KLLA0A02585g37026810.079
CAGL0B03421g135528820.082
AFR117C115252810.11
YLR256W (HAP1)150228800.15
Scas_573.4147828790.17
YOR162C (YRR1)81024790.18
ACR028C60123770.29
AFR108W54831770.29
CAGL0L04576g86532750.45
CAGL0L04400g98751750.51
Sklu_2384.683169740.62
Kwal_23.351457926730.83
Scas_657.385632730.85
Scas_663.1294420711.3
KLLA0E18194g86535701.8
KLLA0F19602g60330701.8
Scas_542.890223702.0
Sklu_2434.1098323702.2
ADR405C80727692.5
AGL361C69655692.8
Scas_709.5175922683.0
YNR063W60719683.3
ADR403C97023674.0
YBR297W (MAL33)46820674.3
KLLA0C19228g59122674.3
KLLA0D09977g63432665.3
CAGL0M05907g89126666.1
YPR196W47022648.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D07029g
         (526 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D07029g 602763..604367 some similarities with sp|P19541 Sac...   987   0.0  
YPL133C (RDS2) [5312] chr16 complement(299887..301227) Protein w...   449   e-155
ACR107W [1154] [Homologous to ScYPL133C - SH] complement(544402....   439   e-152
CAGL0M02651g complement(304583..305971) similar to sp|P19541 Sac...   437   e-149
Scas_700.40                                                           395   e-134
Kwal_26.8662                                                          389   e-132
Kwal_14.1636                                                          100   3e-22
AFL031W [3162] [Homologous to ScYBR239C - SH] complement(376161....    95   2e-20
YBR239C (YBR239C) [418] chr2 complement(698311..699900) Protein ...    94   5e-20
KLLA0F10417g 961004..962527 similar to sp|P38140 Saccharomyces c...    93   9e-20
CAGL0K06985g 681115..682905 similar to sp|P38140 Saccharomyces c...    90   8e-19
Scas_597.2                                                             90   1e-18
KLLA0F13904g complement(1287758..1289497) some similarities with...    85   4e-17
Sklu_2207.4 YJL103C, Contig c2207 6715-8313 reverse complement         80   7e-16
YJL103C (YJL103C) [2812] chr10 complement(228942..230798) Protei...    76   3e-14
CAGL0L03674g 420574..422463 some similarities with sp|P42950 Sac...    69   4e-12
AFR081C [3273] [Homologous to ScYJL103C - SH] (574366..575814) [...    64   9e-11
Scas_711.18                                                            64   1e-10
CAGL0K05841g 572315..576433 similar to sp|P12351 Saccharomyces c...    40   0.007
KLLA0F22990g 2134385..2138146 similar to sp|P12351 Saccharomyces...    39   0.009
KLLA0D00484g 44879..47893 no similarity, hypothetical start            38   0.022
KLLA0F10835g 997512..999782 no similarity, hypothetical start          37   0.036
KLLA0A02585g complement(226562..227674) some similarities with c...    36   0.079
CAGL0B03421g complement(336071..340138) similar to sp|P12351 Sac...    36   0.082
AFR117C [3309] [Homologous to ScYLR256W (HAP1) - SH] (646832..65...    36   0.11 
YLR256W (HAP1) [3650] chr12 (646417..650925) Transcription facto...    35   0.15 
Scas_573.4                                                             35   0.17 
YOR162C (YRR1) [4961] chr15 complement(639560..641992) Transcrip...    35   0.18 
ACR028C [1076] [Homologous to NOHBY] (408701..410506) [1806 bp, ...    34   0.29 
AFR108W [3300] [Homologous to ScYGL045W - SH; ScYGL046W - SH] co...    34   0.29 
CAGL0L04576g 526960..529557 similar to tr|Q12340 Saccharomyces c...    33   0.45 
CAGL0L04400g complement(511762..514725) similar to tr|Q12340 Sac...    33   0.51 
Sklu_2384.6 YKL015W, Contig c2384 10929-13424                          33   0.62 
Kwal_23.3514                                                           33   0.83 
Scas_657.3                                                             33   0.85 
Scas_663.12                                                            32   1.3  
KLLA0E18194g 1613115..1615712 similar to sp|P25502 Saccharomyces...    32   1.8  
KLLA0F19602g complement(1814949..1816760) similar to sp|P43634 S...    32   1.8  
Scas_542.8                                                             32   2.0  
Sklu_2434.10 YAL051W, Contig c2434 22765-25716                         32   2.2  
ADR405C [2145] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C (...    31   2.5  
AGL361C [3951] [Homologous to NOHBY] (24101..26191) [2091 bp, 69...    31   2.8  
Scas_709.51                                                            31   3.0  
YNR063W (YNR063W) [4646] chr14 (746940..748763) Protein with sim...    31   3.3  
ADR403C [2143] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C (...    30   4.0  
YBR297W (MAL33) [474] chr2 (800479..801885) Maltose fermentation...    30   4.3  
KLLA0C19228g 1713787..1715562 similar to sp|P53749 Saccharomyces...    30   4.3  
KLLA0D09977g complement(841852..843756) weakly similar to sp|P40...    30   5.3  
CAGL0M05907g 622029..624704 similar to sp|P36023 Saccharomyces c...    30   6.1  
YPR196W (YPR196W) [5609] chr16 (931370..932782) Positive regulat...    29   8.0  

>KLLA0D07029g 602763..604367 some similarities with sp|P19541
           Saccharomyces cerevisiae YPL133c, hypothetical start
          Length = 534

 Score =  987 bits (2552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/508 (94%), Positives = 478/508 (94%)

Query: 19  FCRRSHMVCDEQRPCSRCVKRSIGHLCRDEDPEGALPGTVEHSSSSGLELRVPKVDVDNT 78
           FCRRSHMVCDEQRPCSRCVKRSIGHLCRDEDPEGALPGTVEHSSSSGLELRVPKVDVDNT
Sbjct: 19  FCRRSHMVCDEQRPCSRCVKRSIGHLCRDEDPEGALPGTVEHSSSSGLELRVPKVDVDNT 78

Query: 79  AGLVDSSRVSLSAPHQLPTAHDHNHDRSLDXXXXXXXXXXXXXXXXXXXXPIPAHLAQVM 138
           AGLVDSSRVSLSAPHQLPTAHDHNHDRSLD                    PIPAHLAQVM
Sbjct: 79  AGLVDSSRVSLSAPHQLPTAHDHNHDRSLDHQREVQQAQQQQHQHHLDIQPIPAHLAQVM 138

Query: 139 PEHQGSHNPSHTAHGNTTTAGPAAVVHPAHEGVPSINNTTGNNLNSVHGSNMHHALSGTS 198
           PEHQGSHNPSHTAHGNTTTAGPAAVVHPAHEGVPSINNTTGNNLNSVHGSNMHHALSGTS
Sbjct: 139 PEHQGSHNPSHTAHGNTTTAGPAAVVHPAHEGVPSINNTTGNNLNSVHGSNMHHALSGTS 198

Query: 199 LGRISSLNQPLFLSEHIGSEFSSLNEFLTMLEDPMLIEPGTPIQHHMNAQITAADHPAQA 258
           LGRISSLNQPLFLSEHIGSEFSSLNEFLTMLEDPMLIEPGTPIQHHMNAQITAADHPAQA
Sbjct: 199 LGRISSLNQPLFLSEHIGSEFSSLNEFLTMLEDPMLIEPGTPIQHHMNAQITAADHPAQA 258

Query: 259 TDQPEYHSQQPLVAHEVTTQPNNMNNSQHPMHTQMQSPVHSNVQNAGGMSXXXXXXXXXX 318
           TDQPEYHSQQPLVAHEVTTQPNNMNNSQHPMHTQMQSPVHSNVQNAGGMS          
Sbjct: 259 TDQPEYHSQQPLVAHEVTTQPNNMNNSQHPMHTQMQSPVHSNVQNAGGMSPPLLPDDQQP 318

Query: 319 TPKENFFLTAADPSTEINPEDRLKLVINAKLEAGLLQPYNYAKGYSRLQKFMDKYMNQSS 378
           TPKENFFLTAADPSTEINPEDRLKLVINAKLEAGLLQPYNYAKGYSRLQKFMDKYMNQSS
Sbjct: 319 TPKENFFLTAADPSTEINPEDRLKLVINAKLEAGLLQPYNYAKGYSRLQKFMDKYMNQSS 378

Query: 379 KQRILKPLSIIRPAFRAIARSLKDVDLVLVEESFERMLLSYDRVFTSMSMPACLWRRTGE 438
           KQRILKPLSIIRPAFRAIARSLKDVDLVLVEESFERMLLSYDRVFTSMSMPACLWRRTGE
Sbjct: 379 KQRILKPLSIIRPAFRAIARSLKDVDLVLVEESFERMLLSYDRVFTSMSMPACLWRRTGE 438

Query: 439 IYRGNKEFASLVDCKVDELRDGKLAIYELMSEESAVNFWEKYGSIAFDKGQKAVLTSCNL 498
           IYRGNKEFASLVDCKVDELRDGKLAIYELMSEESAVNFWEKYGSIAFDKGQKAVLTSCNL
Sbjct: 439 IYRGNKEFASLVDCKVDELRDGKLAIYELMSEESAVNFWEKYGSIAFDKGQKAVLTSCNL 498

Query: 499 RTRDGRQRRPCCFSFTIRRDRYNIPICI 526
           RTRDGRQRRPCCFSFTIRRDRYNIPICI
Sbjct: 499 RTRDGRQRRPCCFSFTIRRDRYNIPICI 526

>YPL133C (RDS2) [5312] chr16 complement(299887..301227) Protein with
           similarity to transcription factors, has Zn[2]-Cys[6]
           fungal-type binuclear cluster domain in the N-terminal
           region, involved in resistance to the antifungal drug
           ketoconazole [1341 bp, 446 aa]
          Length = 446

 Score =  449 bits (1156), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 238/376 (63%), Positives = 274/376 (72%), Gaps = 24/376 (6%)

Query: 164 VHPAHEGVPS-INNTTGNNLNSVHGSNMHHALSGTSLGRISSL---NQPLFLSEHIGSEF 219
            + AH G+PS   N   N   S +G  +   L  + +   +SL    QP+F+SE++GSEF
Sbjct: 74  ANKAHTGIPSDYQNEPVNKSGSTYGEELSPKLDSSLVNDTTSLLLPQQPVFVSENVGSEF 133

Query: 220 SSLNEFLTMLEDPMLIEPGTPIQHHMNAQITAADHPAQATDQP-EYHSQ----QPLVAHE 274
           SSLNEFL+MLE+P+L +         N  +   ++ +Q T  P EY +     +  VA +
Sbjct: 134 SSLNEFLSMLENPLLTQTSLSSSSASNVHL---ENGSQTTQSPLEYQNDNRRDEIGVARQ 190

Query: 275 VTTQPNNMNNSQHPM---HTQMQSPVHSNV-QNAGGMSXXXXXXXXXXTPKENFFLTAAD 330
               P  M+ S + +     Q Q    S +  NA   S          TPKE FFLTAAD
Sbjct: 191 ENRSPTIMSGSSNSISKGDKQDQEKEESRILANANENSAP--------TPKEQFFLTAAD 242

Query: 331 PSTEINPEDRLKLVINAKLEAGLLQPYNYAKGYSRLQKFMDKYMNQSSKQRILKPLSIIR 390
           PSTE+ PE RLKLVINAKLEAGLL+PYNYAKGY+RLQ +MDKYMNQSSKQRILKPLS IR
Sbjct: 243 PSTEMTPEHRLKLVINAKLEAGLLKPYNYAKGYARLQDYMDKYMNQSSKQRILKPLSTIR 302

Query: 391 PAFRAIARSLKDVDLVLVEESFERMLLSYDRVFTSMSMPACLWRRTGEIYRGNKEFASLV 450
           PAFR IARSLKDVDLVLVEESFERMLLSYDRVFTSMSMPACL RRTGEIYR NKEFASLV
Sbjct: 303 PAFRTIARSLKDVDLVLVEESFERMLLSYDRVFTSMSMPACLCRRTGEIYRANKEFASLV 362

Query: 451 DCKVDELRDGKLAIYELMSEESAVNFWEKYGSIAFDKGQKAVLTSCNLRTRDGRQRRPCC 510
           DC VD+LRDGKLAIYELM+EESAVNFWEKYGSIAFDKGQKAVLTSC+LRT+DG ++RPCC
Sbjct: 363 DCTVDDLRDGKLAIYELMTEESAVNFWEKYGSIAFDKGQKAVLTSCSLRTKDGIRKRPCC 422

Query: 511 FSFTIRRDRYNIPICI 526
           FSFTIRRDRYNIPICI
Sbjct: 423 FSFTIRRDRYNIPICI 438

 Score = 65.5 bits (158), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 29/31 (93%)

Query: 19 FCRRSHMVCDEQRPCSRCVKRSIGHLCRDED 49
          FC+RSH+VCD+QRPCSRCVKR I HLCR++D
Sbjct: 19 FCKRSHVVCDKQRPCSRCVKRDIAHLCREDD 49

>ACR107W [1154] [Homologous to ScYPL133C - SH]
           complement(544402..545556) [1155 bp, 384 aa]
          Length = 384

 Score =  439 bits (1129), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 227/322 (70%), Positives = 244/322 (75%), Gaps = 46/322 (14%)

Query: 205 LNQPLFLSEHIGSEFSSLNEFLTMLEDPMLIEPGTPIQHHMNAQITAADHPAQATDQPEY 264
           +N P F+SEHIGSEFSSLNEFLT+LEDP+L+E  TP     N Q  AAD  A+    P  
Sbjct: 101 INHPKFVSEHIGSEFSSLNEFLTLLEDPLLME-ATP-SPGCNGQ--AADPGARG---PGE 153

Query: 265 HSQQPLVAHEVTTQPNNMNNSQHPMHTQMQSPVHSNVQNAGGMSXXXXXXXXXXTPKENF 324
                L       QP                                       T KENF
Sbjct: 154 LVGGVLAGAAPQEQP---------------------------------------TAKENF 174

Query: 325 FLTAADPSTEINPEDRLKLVINAKLEAGLLQPYNYAKGYSRLQKFMDKYMNQSSKQRILK 384
           FLTAADPSTE+ PEDRLKLVINAKLEAGLLQPYNY++GY+RLQ +MDKYMNQSS+QRILK
Sbjct: 175 FLTAADPSTEVEPEDRLKLVINAKLEAGLLQPYNYSQGYARLQNYMDKYMNQSSRQRILK 234

Query: 385 PLSIIRPAFRAIARSLKDVDLVLVEESFERMLLSYDRVFTSMSMPACLWRRTGEIYRGNK 444
           PLS IRPAFRAIARSLKDVDLVLVEE FERMLLSYDRVFTSMSMPACLWRRTGEIYRGNK
Sbjct: 235 PLSTIRPAFRAIARSLKDVDLVLVEEGFERMLLSYDRVFTSMSMPACLWRRTGEIYRGNK 294

Query: 445 EFASLVDCKVDELRDGKLAIYELMSEESAVNFWEKYGSIAFDKGQKAVLTSCNLRTRDGR 504
           EFASLVDC VD+LRDG LAIYELM+EESAVNFWEKYGSIAFDKGQKAVLTSCNLR++DGR
Sbjct: 295 EFASLVDCTVDDLRDGNLAIYELMTEESAVNFWEKYGSIAFDKGQKAVLTSCNLRSKDGR 354

Query: 505 QRRPCCFSFTIRRDRYNIPICI 526
           +RRPCCFSFTIRRDRYNIPICI
Sbjct: 355 KRRPCCFSFTIRRDRYNIPICI 376

 Score = 61.2 bits (147), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 30/57 (52%), Positives = 35/57 (61%), Gaps = 5/57 (8%)

Query: 19 FCRRSHMVCDEQRPCSRCVKRSIGHLCRDEDPEGALPGTVEHSSSSGLELRVPKVDV 75
           CRRSHM+CD++RPCSRC+KR IGH C DE  +   PG     S S   LR    DV
Sbjct: 25 LCRRSHMICDDRRPCSRCIKRDIGHFCCDEKLQ---PGAERLQSQS--PLRTETFDV 76

>CAGL0M02651g complement(304583..305971) similar to sp|P19541
           Saccharomyces cerevisiae YPL133c, hypothetical start
          Length = 462

 Score =  437 bits (1123), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 228/379 (60%), Positives = 266/379 (70%), Gaps = 25/379 (6%)

Query: 171 VPSINNTTGNNLNSVHGSNMHHALSGTSLGRISSLN------QPLFLSEHIGSEFSSLNE 224
           +P+     G+   ++ GSN   ++ GT     SS N      QP F+SE++GSEFSSLNE
Sbjct: 71  IPNAEINIGDETRAIQGSN--SSVYGTETPISSSNNNLLLPPQPNFVSENVGSEFSSLNE 128

Query: 225 FLTMLEDPMLIEPGTPIQHHMNAQITA-------ADHPAQATDQPEYHSQQPLVAHEVTT 277
           FL MLE+P+  E     Q +   + TA        ++  + TD  E       V  E++ 
Sbjct: 129 FLMMLENPIPGESENTSQSNKEQERTAHSNMEDSIENTQEQTDNNEGIIGSVSVNQEISQ 188

Query: 278 QPN----------NMNNSQHPMHTQMQSPVHSNVQNAGGMSXXXXXXXXXXTPKENFFLT 327
             N           +N+ Q     Q  +    N Q +              T KE FFLT
Sbjct: 189 DINEASSKANGTKTVNDGQGQEQDQEHNRQKLNKQESSNSKAQSDKYDDTPTSKEQFFLT 248

Query: 328 AADPSTEINPEDRLKLVINAKLEAGLLQPYNYAKGYSRLQKFMDKYMNQSSKQRILKPLS 387
           AADPSTE+NP DRLKLVINAKLEAGLL+PY+YAKGY+RLQ++MDKYMN ++KQRILKPL 
Sbjct: 249 AADPSTEMNPVDRLKLVINAKLEAGLLKPYDYAKGYARLQEYMDKYMNDTNKQRILKPLM 308

Query: 388 IIRPAFRAIARSLKDVDLVLVEESFERMLLSYDRVFTSMSMPACLWRRTGEIYRGNKEFA 447
            IRPAFR IA+SLKDVDLVLVEESFERMLLSYDRVFTSMSMPACLWRRTGEIYR NKEFA
Sbjct: 309 SIRPAFRTIAKSLKDVDLVLVEESFERMLLSYDRVFTSMSMPACLWRRTGEIYRANKEFA 368

Query: 448 SLVDCKVDELRDGKLAIYELMSEESAVNFWEKYGSIAFDKGQKAVLTSCNLRTRDGRQRR 507
           SLVDC VD+LRDGKLAIYELM+EESAVNFWEKYGSIAFDKGQKAVLTSC+LRT+DG ++R
Sbjct: 369 SLVDCTVDDLRDGKLAIYELMTEESAVNFWEKYGSIAFDKGQKAVLTSCSLRTKDGLKKR 428

Query: 508 PCCFSFTIRRDRYNIPICI 526
           PCCFSFTIRRDRYNIPICI
Sbjct: 429 PCCFSFTIRRDRYNIPICI 447

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 24/27 (88%)

Query: 19 FCRRSHMVCDEQRPCSRCVKRSIGHLC 45
          FCRRSH+ CD QRPCSRC+KR IGHLC
Sbjct: 18 FCRRSHVNCDHQRPCSRCIKREIGHLC 44

>Scas_700.40
          Length = 407

 Score =  395 bits (1016), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 183/208 (87%), Positives = 196/208 (94%)

Query: 319 TPKENFFLTAADPSTEINPEDRLKLVINAKLEAGLLQPYNYAKGYSRLQKFMDKYMNQSS 378
           T KE FFLTAADPSTE+ PEDRLKLVINAKLEAGLL+PYNYAKGY+RLQK+MD+ M QSS
Sbjct: 192 TLKEQFFLTAADPSTEMTPEDRLKLVINAKLEAGLLKPYNYAKGYARLQKYMDENMEQSS 251

Query: 379 KQRILKPLSIIRPAFRAIARSLKDVDLVLVEESFERMLLSYDRVFTSMSMPACLWRRTGE 438
           KQRILKPLS IRPAFR IARSLKDVDL+LVEE+FER+LLSYDRVFTSMSMPACLWRRTGE
Sbjct: 252 KQRILKPLSTIRPAFRTIARSLKDVDLILVEENFERLLLSYDRVFTSMSMPACLWRRTGE 311

Query: 439 IYRGNKEFASLVDCKVDELRDGKLAIYELMSEESAVNFWEKYGSIAFDKGQKAVLTSCNL 498
           IYR NKEFA+LVDC VDELRDGKLAIYELMSEESAVNFWEKYGSIAFDKGQK VLTSCNL
Sbjct: 312 IYRANKEFATLVDCTVDELRDGKLAIYELMSEESAVNFWEKYGSIAFDKGQKTVLTSCNL 371

Query: 499 RTRDGRQRRPCCFSFTIRRDRYNIPICI 526
           +TRDG +++ CCFSFTIRRDRYNIPICI
Sbjct: 372 QTRDGSRKKNCCFSFTIRRDRYNIPICI 399

 Score = 51.6 bits (122), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 23/27 (85%)

Query: 19 FCRRSHMVCDEQRPCSRCVKRSIGHLC 45
          FCRRSH+ CD +RPCSRC+KR I +LC
Sbjct: 24 FCRRSHVNCDGKRPCSRCLKRGISNLC 50

>Kwal_26.8662
          Length = 355

 Score =  389 bits (999), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 180/208 (86%), Positives = 197/208 (94%)

Query: 319 TPKENFFLTAADPSTEINPEDRLKLVINAKLEAGLLQPYNYAKGYSRLQKFMDKYMNQSS 378
           T KENFFLTAADPS E+ PEDRLK VINAKLEAGLLQPYNYA+GY+RLQ +MD +M+ +S
Sbjct: 138 TLKENFFLTAADPSAEMTPEDRLKSVINAKLEAGLLQPYNYARGYARLQTYMDDHMDLAS 197

Query: 379 KQRILKPLSIIRPAFRAIARSLKDVDLVLVEESFERMLLSYDRVFTSMSMPACLWRRTGE 438
           KQRIL+PLSIIRP FRAIAR+L+DVDL+LVEESFERMLLSYDRVFTSMSMPACLWRRTGE
Sbjct: 198 KQRILRPLSIIRPEFRAIARTLRDVDLILVEESFERMLLSYDRVFTSMSMPACLWRRTGE 257

Query: 439 IYRGNKEFASLVDCKVDELRDGKLAIYELMSEESAVNFWEKYGSIAFDKGQKAVLTSCNL 498
           IYRGNKEFASLVDCKVD+LRDGKLAIYELM+EES VNFWEKYGSIAFDK QKAVLTSC+L
Sbjct: 258 IYRGNKEFASLVDCKVDDLRDGKLAIYELMTEESVVNFWEKYGSIAFDKDQKAVLTSCHL 317

Query: 499 RTRDGRQRRPCCFSFTIRRDRYNIPICI 526
           R+RDG ++RPCCFSFTIRRDRYNIPICI
Sbjct: 318 RSRDGSKKRPCCFSFTIRRDRYNIPICI 345

 Score = 69.7 bits (169), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 28/36 (77%), Positives = 32/36 (88%)

Query: 19 FCRRSHMVCDEQRPCSRCVKRSIGHLCRDEDPEGAL 54
          +CRRSHM+C+EQRPCSRCVKR IGHLCRDE+   AL
Sbjct: 18 YCRRSHMICNEQRPCSRCVKRDIGHLCRDEELRLAL 53

 Score = 61.2 bits (147), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 59/127 (46%), Gaps = 14/127 (11%)

Query: 180 NNLNSVH--GSNMHHALSGTSLGRISSLNQPLFLSEHIGSEFSSLNEFLTMLEDPMLIE- 236
            +L  V+  GS     L   + G + S  QP F+SEH+GSEFSSLNEFL MLEDP+++E 
Sbjct: 64  TDLGQVYKSGSVPQQPLKSGAYGGLLS-QQPTFVSEHVGSEFSSLNEFLNMLEDPLILEP 122

Query: 237 PGTPIQHHMNAQ----------ITAADHPAQATDQPEYHSQQPLVAHEVTTQPNNMNNSQ 286
           P  P     N Q          +TAAD  A+ T +    S           QP N     
Sbjct: 123 PAIPKLPPRNPQDQPTLKENFFLTAADPSAEMTPEDRLKSVINAKLEAGLLQPYNYARGY 182

Query: 287 HPMHTQM 293
             + T M
Sbjct: 183 ARLQTYM 189

>Kwal_14.1636
          Length = 456

 Score = 99.8 bits (247), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 94/174 (54%), Gaps = 3/174 (1%)

Query: 355 QPYNYAKGYSRLQKFMDKYMNQSSKQRILKPLSIIRPAFRAIARSLKDVDLVLVEESFER 414
           +P+++  G+  L +++    N+     + + L+  RP F AIA +L + D++ +E+ ++R
Sbjct: 273 RPFSHTSGFHSLLQYLRARFNREDVVEMCRSLAEFRPTFIAIAVTLTEEDMIFMEQCYQR 332

Query: 415 MLLSYDRVFTSMSMPACLWRRTGEIYRGNKEFASLVDCKVDELRDGKLAIYELMSEESAV 474
            LL YD+  + +  P C+WRR G+I   + EF+ L      +L      I ELM +ES  
Sbjct: 333 TLLEYDQFISQLGTPTCVWRRNGQISYVSDEFSLLTGWTRADLLFKMTFIVELMDDESVR 392

Query: 475 NFWEKYGSIAFD--KGQKAVLTSCNLRTRDGRQRRPCCFSFTIRRDRYNIPICI 526
            +++ +  +A+   KG + + T   L    GRQ   CC  +T++RD + +P+ I
Sbjct: 393 EYFKTFNRVAYRDFKGSERMKTCRLLTPVKGRQIECCCI-WTLKRDVFGLPLMI 445

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 10/54 (18%)

Query: 20 CRRSHMVCDEQRPCSRCVKRSIGHLCRD----------EDPEGALPGTVEHSSS 63
          C +SH+ C  +RPC+RCVK+ +   C D          + P+  LP  ++  S+
Sbjct: 15 CSKSHVTCQAERPCTRCVKKGLEASCVDAPRKRRKYLADVPDEQLPAAIKRGST 68

>AFL031W [3162] [Homologous to ScYBR239C - SH]
           complement(376161..377714) [1554 bp, 517 aa]
          Length = 517

 Score = 94.7 bits (234), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 50/174 (28%), Positives = 89/174 (51%), Gaps = 3/174 (1%)

Query: 355 QPYNYAKGYSRLQKFMDKYMNQSSKQRILKPLSIIRPAFRAIARSLKDVDLVLVEESFER 414
           +P+ +  G+  L K++    ++     + + ++  RP F A A  L + D++ +E+S++R
Sbjct: 311 EPFCHTSGFHSLLKYLHSRFHRHDLVEMCRSIAEFRPIFIASAVDLTEEDMIFMEQSYQR 370

Query: 415 MLLSYDRVFTSMSMPACLWRRTGEIYRGNKEFASLVDCKVDELRDGKLAIYELMSEESAV 474
            LL YDR  T +  P C+WRR G+I   N EF  L     +EL      I EL+ + S  
Sbjct: 371 TLLEYDRFITQIGTPTCVWRRNGQISYLNDEFCLLTGWTREELLSKMTFIVELLDDNSVR 430

Query: 475 NFWEKYGSIAFD--KGQKAVLTSCNLRTRDGRQRRPCCFSFTIRRDRYNIPICI 526
            +++ +  +A+   KG + + T   L   +GR     C  +T +RD + +P+ I
Sbjct: 431 EYFKTFSKVAYKDFKGFEQMETCVLLSPIEGRTIECSCM-WTWKRDVFGMPMMI 483

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 19/26 (73%)

Query: 20 CRRSHMVCDEQRPCSRCVKRSIGHLC 45
          C RSH+ C+ QRPC+RCVK+ +   C
Sbjct: 22 CSRSHVTCESQRPCTRCVKKGLEMSC 47

>YBR239C (YBR239C) [418] chr2 complement(698311..699900) Protein
           with similarity to transcription factors, has
           Zn[2]-Cys[6] fungal-type binuclear cluster domain in the
           N-terminal region [1590 bp, 529 aa]
          Length = 529

 Score = 93.6 bits (231), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 49/200 (24%), Positives = 99/200 (49%), Gaps = 1/200 (0%)

Query: 328 AADPSTEINPEDRLKLVINAKLEAGLLQPYNYAKGYSRLQKFMDKYMNQSSKQRILKPLS 387
           AA+  + +  E  L+     ++   +  P+++  G+  L  ++    NQ    ++ + ++
Sbjct: 321 AANIKSNVEWEHSLRYSTPMEIYTSINAPFSHTPGFHHLLVYLKHRFNQQDLVKMCRSIA 380

Query: 388 IIRPAFRAIARSLKDVDLVLVEESFERMLLSYDRVFTSMSMPACLWRRTGEIYRGNKEFA 447
             RP F A + +L + D++ +E+ ++R LL Y +    +  P C+WRR G+I   N+EF 
Sbjct: 381 EFRPIFIACSVTLTEEDMIFMEQCYQRTLLEYVKFIAQIGTPTCIWRRNGQISYVNEEFE 440

Query: 448 SLVDCKVDELRDGKLAIYELMSEESAVNFWEKYGSIAF-DKGQKAVLTSCNLRTRDGRQR 506
            L     +EL +    I E+M +ES  ++++    +A+ D      +  C L +    + 
Sbjct: 441 ILCGWTREELLNKMTFIVEIMDDESVRDYFKTLSKVAYRDFRGSEKMKVCRLLSPIKGKI 500

Query: 507 RPCCFSFTIRRDRYNIPICI 526
             CC  +T++RD   +P+ I
Sbjct: 501 IHCCCMWTLKRDVSGLPLMI 520

 Score = 34.7 bits (78), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 17/28 (60%)

Query: 20 CRRSHMVCDEQRPCSRCVKRSIGHLCRD 47
          C R H+ C+ +RPC RC+ + +   C D
Sbjct: 43 CSRLHVSCEAKRPCLRCISKGLTATCVD 70

>KLLA0F10417g 961004..962527 similar to sp|P38140 Saccharomyces
           cerevisiae YBR239c, start by similarity
          Length = 507

 Score = 92.8 bits (229), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 88/166 (53%), Gaps = 1/166 (0%)

Query: 362 GYSRLQKFMDKYMNQSSKQRILKPLSIIRPAFRAIARSLKDVDLVLVEESFERMLLSYDR 421
           G+  L +++ +  +++    + + L+ +RP F A    L D D++ +E+S +R LL Y++
Sbjct: 326 GFHALLRYLKRRFDKNQLVEMCRCLAELRPIFIASTIDLTDEDMIFMEKSHQRTLLEYEK 385

Query: 422 VFTSMSMPACLWRRTGEIYRGNKEFASLVDCKVDELRDGKLAIYELMSEESAVNFWEKYG 481
             + +  P C+WRR G+I   N EF+ L      EL +    I ELM  ++ + +++ + 
Sbjct: 386 FISQVGTPTCVWRRNGQISYVNDEFSLLTGWNRLELLNKMTFIVELMDGDTVMEYFQTFT 445

Query: 482 SIAFDKGQKA-VLTSCNLRTRDGRQRRPCCFSFTIRRDRYNIPICI 526
            +A+   + A  +  CNL T        CC  +T++RD + +P+ I
Sbjct: 446 RVAYQGFRGAETMRICNLLTPIKGSVIKCCCLWTLKRDAFGLPMMI 491

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 40/85 (47%), Gaps = 19/85 (22%)

Query: 20  CRRSHMVCDEQRPCSRCVKRSIGHLCRD----------EDPEGALPGTVEHSSS----SG 65
           C +SH+ CD+ RPC+RC+++ +   C D          + PE  LP  +  +      + 
Sbjct: 16  CAKSHVTCDDNRPCTRCIRKGLEESCIDAPRKKVKYLRDVPEDQLPSVLRSTKQVPPVNA 75

Query: 66  LELR-----VPKVDVDNTAGLVDSS 85
           ++L+     +P + +D   G +  S
Sbjct: 76  VKLKMEPGILPNIPLDYDGGTIRQS 100

>CAGL0K06985g 681115..682905 similar to sp|P38140 Saccharomyces
           cerevisiae YBR239c, hypothetical start
          Length = 596

 Score = 90.1 bits (222), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 59/222 (26%), Positives = 106/222 (47%), Gaps = 18/222 (8%)

Query: 319 TPKENFFLTAADPSTEINPEDRLKLVINAKLEAGLL------------QPYNYAKGYSRL 366
           T  EN+   A   S E  P D  +L  N + +  L             +P+++  G+  L
Sbjct: 371 TDTENY---AVSVSVECPPPDGSRLYNNVEWDHSLKYGTPVEIYKLINEPFSHTPGFRHL 427

Query: 367 QKFMDKYMNQSSKQRILKPLSIIRPAFRAIARSLKDVDLVLVEESFERMLLSYDRVFTSM 426
            +++ K  +Q     + + ++  RP F A + +L + D++ +E+ ++R LL Y +    +
Sbjct: 428 LQYLRKRFSQKDLVSMCQNMAYFRPIFIACSITLTEEDMIFMEQCYQRTLLQYVKFIQEI 487

Query: 427 SMPACLWRRTGEIYRGNKEFASLVDCKVDELRDGKLAIYELMSEESAVNFWEKYGSIAFD 486
             P  +WRR G+I   N EF  L   K +EL D    I E++ +ES   +++ +  IA++
Sbjct: 488 GTPTVVWRRNGQISYVNDEFEILSGWKREELLDKMSFIVEIIDDESVREYFKTFARIAYN 547

Query: 487 --KGQKAVLTSCNLRTRDGRQRRPCCFSFTIRRDRYNIPICI 526
             KG +  +  C L T    Q   C   +T++RD   +P+ I
Sbjct: 548 NIKGSEQ-MDVCRLLTPIRNQVIECKCIWTLKRDMSGLPLMI 588

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 21/28 (75%)

Query: 20 CRRSHMVCDEQRPCSRCVKRSIGHLCRD 47
          C R+H  C+++RPCSRC+K+ I + C D
Sbjct: 71 CSRNHSSCEQKRPCSRCIKKGIANTCVD 98

>Scas_597.2
          Length = 540

 Score = 89.7 bits (221), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 91/174 (52%), Gaps = 3/174 (1%)

Query: 355 QPYNYAKGYSRLQKFMDKYMNQSSKQRILKPLSIIRPAFRAIARSLKDVDLVLVEESFER 414
           +P+ +  G+  L  ++    NQ     + + ++  RP F A + +L + D++ +E+ ++R
Sbjct: 359 EPFCHTMGFRHLLLYLRNRFNQKDIVSMCRSMTEFRPIFIACSMTLTEEDMIFMEQCYQR 418

Query: 415 MLLSYDRVFTSMSMPACLWRRTGEIYRGNKEFASLVDCKVDELRDGKLAIYELMSEESAV 474
            LL Y +    +  P C+WRR G+I   N+EF  L     +EL +    I E++ ++S  
Sbjct: 419 TLLEYSKFIGQIGTPTCVWRRNGQISYINEEFEILTGWTREELLNKMTFIVEILDDDSVR 478

Query: 475 NFWEKYGSIAFD--KGQKAVLTSCNLRTRDGRQRRPCCFSFTIRRDRYNIPICI 526
           ++++ + S+A+   KG + + T C L T    Q   C   +T++RD   +P+ I
Sbjct: 479 DYFKTFSSVAYKDFKGCEQMKT-CRLLTPLEGQVVNCGCMWTLKRDISGLPLMI 531

 Score = 38.5 bits (88), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 19/29 (65%)

Query: 20 CRRSHMVCDEQRPCSRCVKRSIGHLCRDE 48
          C +SH  CD  RPCSRC+K+ +   C D+
Sbjct: 46 CAKSHSSCDSCRPCSRCIKKELQDSCVDK 74

>KLLA0F13904g complement(1287758..1289497) some similarities with
           sp|P42950 Saccharomyces cerevisiae YJL103c, hypothetical
           start
          Length = 579

 Score = 84.7 bits (208), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 60/205 (29%), Positives = 97/205 (47%), Gaps = 31/205 (15%)

Query: 352 GLLQPYNYAKGYSRLQKFMD-KYMNQ----SSKQRILKPLSI----------IRPAFRAI 396
            L+QP+NY   Y  L +F+  +++N     S K +   P  +            P F  +
Sbjct: 365 ALIQPHNYKSAYLELLRFLRWRFINSDKPSSGKSQRDGPEQLQNIAHSIKTHYAPIFVTL 424

Query: 397 ARSLKDVDLVLVEESFERMLLSYDRVFTSMS-MPACLWRRTGEIYRGNKEFASLVDCKVD 455
             SL   DL L E   +R LL Y+ +   ++  P C+WRR+GEI   + EF SL      
Sbjct: 425 TNSLIAQDLKLQEIILQRALLEYESMAKLVNCTPMCIWRRSGEICFASNEFISLTGFNKK 484

Query: 456 ELRDGKLAIYELMSEESAVNFWEKYGS-IAFDKGQ-------------KAVLTSCNLRTR 501
           E+ + +  I E M  ES V++++ +   +AF   Q             +A+ + CNL  +
Sbjct: 485 EILNKRKFIMEFMDNESIVDYYDIFHEYLAFGSTQSGPFNSSTGTSDGQAIFSECNLLLK 544

Query: 502 DGRQRRPCCFSFTIRRDRYNIPICI 526
           +G   R  C  +T++RD +NIP+ I
Sbjct: 545 NGCYLRCACI-WTVKRDAFNIPMLI 568

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 19/31 (61%)

Query: 19 FCRRSHMVCDEQRPCSRCVKRSIGHLCRDED 49
          FC   H+ CD  RPC  C KR IG  CRD++
Sbjct: 22 FCHEKHLQCDLGRPCQNCSKRGIGDTCRDKE 52

>Sklu_2207.4 YJL103C, Contig c2207 6715-8313 reverse complement
          Length = 532

 Score = 80.5 bits (197), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 55/201 (27%), Positives = 97/201 (48%), Gaps = 29/201 (14%)

Query: 353 LLQPYNYAKGYSRLQKFM-DKYMNQSSKQR--------------ILKPLSI-IRPAFRAI 396
           L++P+NY   Y  L  ++ D++++    Q+              I   ++    P F  +
Sbjct: 321 LIKPHNYRAAYRDLLMYLRDRFLDSRGSQKNTSKNRDGPQHLQHIAHSIATHYAPIFVTL 380

Query: 397 ARSLKDVDLVLVEESFERMLLSYDRVFTSMS-MPACLWRRTGEIYRGNKEFASLVDCKVD 455
             +L + DL L E   +R LL Y+ +   ++  P C+WRR+GEI   + EF SL      
Sbjct: 381 TTNLIENDLKLQELILQRTLLEYENMAKLVNCTPMCIWRRSGEICYVSNEFVSLTGFPRK 440

Query: 456 ELRDGKLAIYELMSEESAVNFWE----------KYGSIAFDKGQKAVLTSCNLRTRDGRQ 505
           ++   +  I E + +ES V++++          K G+     GQ AV + CNL  ++G  
Sbjct: 441 DMLSKRRFILEFLDDESVVDYFDIFHEYLAFGSKEGAGGTSDGQ-AVFSECNLLLKNGTY 499

Query: 506 RRPCCFSFTIRRDRYNIPICI 526
            +  C  +T++RD YNIP+ +
Sbjct: 500 LKCACI-WTVKRDGYNIPLLV 519

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 20/29 (68%)

Query: 19 FCRRSHMVCDEQRPCSRCVKRSIGHLCRD 47
          FC   H+ CD  RPC  C++R+IGH CRD
Sbjct: 22 FCHEKHLQCDVGRPCQNCLRRNIGHECRD 50

>YJL103C (YJL103C) [2812] chr10 complement(228942..230798) Protein
           with similarity to transcription factors, contains a
           Zn[2]-Cys[6] fungal-type binuclear cluster domain in the
           N-terminal region [1857 bp, 618 aa]
          Length = 618

 Score = 75.9 bits (185), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 56/229 (24%), Positives = 100/229 (43%), Gaps = 56/229 (24%)

Query: 353 LLQPYNYAKGYSRL-----QKFMD----------KYMNQSSKQRILKPLSII-------- 389
           L++P+NY   Y++L     +KF++          K  + + K  +   L +I        
Sbjct: 380 LIKPHNYKLAYTKLLTTLRKKFLEGAEIDKSASVKDEHSTQKHNLRYDLEVIIRSILERY 439

Query: 390 RPAFRAIARSLKDVDLVLVEESFERMLLSYDRVFTSMS-MPACLWRRTGEIYRGNKEFAS 448
            P F ++  ++ + DL+L E + +R LL  + +   +S  P C+WRR+GEI   + EF S
Sbjct: 440 APIFISLTSNMIEEDLLLQEVTLQRALLDLENMAKLVSCTPMCIWRRSGEICFVSNEFYS 499

Query: 449 LVDCKVDELRDGKLAIYELMSEESAVNFWEKYGSI------------------------- 483
           L     + L D    I+E +  +S  N+++ +  +                         
Sbjct: 500 LTGFNKNLLLDRTSFIFEYLDHKSVSNYFQIFNELLAFGYNDINKRKKLLMLNACSSTSS 559

Query: 484 ------AFDKGQKAVLTSCNLRTRDGRQRRPCCFSFTIRRDRYNIPICI 526
                 +F    KA+ T CNL   +G   +  C  +T++RD +NIPI +
Sbjct: 560 KITEGFSFTTDGKAIFTKCNLLLSNGLYLKCAC-CWTVKRDSFNIPILV 607

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 17/27 (62%)

Query: 19 FCRRSHMVCDEQRPCSRCVKRSIGHLC 45
          FC   H+ CD  RPC  C+KR+IG  C
Sbjct: 22 FCHTKHIQCDVGRPCQNCLKRNIGKFC 48

>CAGL0L03674g 420574..422463 some similarities with sp|P42950
           Saccharomyces cerevisiae YJL103c, hypothetical start
          Length = 629

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 56/223 (25%), Positives = 101/223 (45%), Gaps = 52/223 (23%)

Query: 353 LLQPYNYAKGYSRLQKFMDK-YMNQSSKQRILKPLSIIR-------PAFRAIARSLKDVD 404
           L++P+NY   Y +L + ++K +++ +S +R  +  SI++       P F A+  ++ + D
Sbjct: 399 LIKPHNYRHTYKKLLEQLEKIFLSDNSPKRRGQLQSIVKCILEDYVPTFIALTSNMIESD 458

Query: 405 LVLVEESFERMLLSYDRVFTSMSM-PACLWRRTGEIYRGNKEFASLVDCKVDELRDGKLA 463
           L L E + +R LL  + +   ++  P C+WRR+GEI   + EF  L   K  E+   +  
Sbjct: 459 LYLQELTLQRTLLELESMAKLVNCSPICIWRRSGEISYVSDEFLQLTGFKRKEILASRRF 518

Query: 464 IYELMSEESAVNFWEKYGS-IAFDKGQKAVLTS--------------------------- 495
           I+E +   S VN++  +   +AF  G K  +TS                           
Sbjct: 519 IFEFLDPTSIVNYFTNFHEYLAF--GSKNQMTSNISLIKQGLLVNGAVVRKSNPIVSSSP 576

Query: 496 ------------CNLRTRDGRQRRPCCFSFTIRRDRYNIPICI 526
                       C+L   +G   + C   +T++RD +NIP+ I
Sbjct: 577 MCGTNTDGIFDECHLLLSNGYYLK-CATCWTVKRDSFNIPLLI 618

 Score = 48.5 bits (114), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 26/43 (60%)

Query: 19 FCRRSHMVCDEQRPCSRCVKRSIGHLCRDEDPEGALPGTVEHS 61
          FC   H+ CD  RPC  CVKR+ G LCRD++ + +    VE S
Sbjct: 7  FCHEKHLHCDPGRPCINCVKRNRGQLCRDKERKKSKKSGVEKS 49

>AFR081C [3273] [Homologous to ScYJL103C - SH] (574366..575814)
           [1449 bp, 482 aa]
          Length = 482

 Score = 64.3 bits (155), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 72/146 (49%), Gaps = 11/146 (7%)

Query: 391 PAFRAIARSLKDVDLVLVEESFERMLLSYDRVFTSMS-MPACLWRRTGEIYRGNKEFASL 449
           P F  +  +L + DL + E   +R LL Y+ +   ++ +P C+WRR+GEI   + EF SL
Sbjct: 325 PIFVTLTSNLIESDLKMHELILQRTLLEYENMSKMVNCIPMCIWRRSGEICYVSNEFISL 384

Query: 450 VDCKVDELRDGKLAIYELMSEESAVNFWEKYGS-IAFDKGQ--------KAVLTSCNLRT 500
                 EL   +  I E       V++++ +   +AF   +        +AV + CNL  
Sbjct: 385 TGFSRRELLMRRRFIMEFFDNHGIVDYFKLFNEYLAFSSKEGFSSTSDGQAVFSECNLLM 444

Query: 501 RDGRQRRPCCFSFTIRRDRYNIPICI 526
            +    +  C  +T++RD +NIP+ +
Sbjct: 445 ANNSFLKCACI-WTVKRDSFNIPMLV 469

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 18/29 (62%)

Query: 19 FCRRSHMVCDEQRPCSRCVKRSIGHLCRD 47
          FC   H+ CD  RPC  C KR+IG  CRD
Sbjct: 22 FCHEKHLQCDVGRPCQNCEKRNIGESCRD 50

>Scas_711.18
          Length = 509

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 56/201 (27%), Positives = 87/201 (43%), Gaps = 30/201 (14%)

Query: 354 LQPYNYAKGYSRLQKFMDKY--MNQSSKQ---RILKPLSIIR-------PAFRAIARSLK 401
           ++ +NY   Y  + + + K   + Q S Q    +LK  SI++       P   A+   + 
Sbjct: 303 IKAFNYMLSYYGMIRCLKKLFAIKQESAQGDKDVLK--SIVKEISEEFAPVILALETGMI 360

Query: 402 DVDLVLVEESFERMLLSYDRVFT-SMSMPACLWRRTGEIYRGNKEFASLVDCKVDELRDG 460
             D    E + +RMLL  + + T S   P  +WRRTGEI   N EF SL      EL   
Sbjct: 361 PDDFQFQELTLQRMLLDLEDMATFSNCTPLVIWRRTGEICFANNEFLSLTGYTDVELTSR 420

Query: 461 KLAIYELMSEESAVNFWEKYGS-IAF----DKGQKAVLTSCNLRTRDGRQRRP------- 508
           +  I+E    +S  N+++K+ S +AF     +GQ            +   R         
Sbjct: 421 QRFIFEFWDRQSVFNYFKKFHSMLAFGPIEKEGQTETYPGRRWSFNNSVDRSKILLKNGF 480

Query: 509 ---CCFSFTIRRDRYNIPICI 526
              C   +TIRRD +NIP+ +
Sbjct: 481 HLNCATCWTIRRDTFNIPLLV 501

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 20/29 (68%)

Query: 19 FCRRSHMVCDEQRPCSRCVKRSIGHLCRD 47
          FC   H+ CD  RPC  C+KR+IG+ C+D
Sbjct: 36 FCHIKHLQCDVGRPCKNCIKRNIGNTCKD 64

>CAGL0K05841g 572315..576433 similar to sp|P12351 Saccharomyces
           cerevisiae YLR256w HAP1 transcription factor,
           hypothetical start
          Length = 1372

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 27/52 (51%), Gaps = 3/52 (5%)

Query: 19  FCRRSHMVCDEQRP-CSRCVKRSIGHLCRDEDPEGALPGTVEHSSSSGLELR 69
            CRR  + CD+ RP C++CVK  + HLC     E A     E   S  +EL+
Sbjct: 73  ICRRRKVKCDKSRPNCTQCVKTGVAHLCHYM--EQAWAEEAEKEISKEMELK 122

>KLLA0F22990g 2134385..2138146 similar to sp|P12351 Saccharomyces
          cerevisiae YLR256w HAP1 transcription factor singleton,
          hypothetical start
          Length = 1253

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 19/28 (67%), Gaps = 1/28 (3%)

Query: 19 FCRRSHMVCDEQRP-CSRCVKRSIGHLC 45
           CR+  + CD+ RP C +CVK  +GHLC
Sbjct: 27 ICRKRKVKCDKGRPQCQQCVKTGVGHLC 54

>KLLA0D00484g 44879..47893 no similarity, hypothetical start
          Length = 1004

 Score = 37.7 bits (86), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 22/30 (73%), Gaps = 1/30 (3%)

Query: 20  CRRSHMVCDEQRP-CSRCVKRSIGHLCRDE 48
           C+++H  CDE++P CSRC KRSI    R++
Sbjct: 74  CKKAHTKCDERKPKCSRCEKRSIDCTYRNQ 103

>KLLA0F10835g 997512..999782 no similarity, hypothetical start
          Length = 756

 Score = 37.0 bits (84), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 19/24 (79%), Gaps = 1/24 (4%)

Query: 20 CRRSHMVCDEQRP-CSRCVKRSIG 42
          C+RSH+ CDE +P C +CVKR+I 
Sbjct: 27 CKRSHLKCDEGQPKCGKCVKRNIS 50

>KLLA0A02585g complement(226562..227674) some similarities with
          ca|CA5890|CaFCR1 Candida albicans Zinc cluster
          transcription factor, hypothetical start
          Length = 370

 Score = 35.8 bits (81), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 18/26 (69%), Gaps = 2/26 (7%)

Query: 20 CRRSHMVCDEQRPCSRCVKRSIGHLC 45
          CR+S   CD +RPCSRC+K +   LC
Sbjct: 25 CRKSKTKCDGERPCSRCLKEN--KLC 48

>CAGL0B03421g complement(336071..340138) similar to sp|P12351
          Saccharomyces cerevisiae YLR256w HAP1 transcription
          factor, hypothetical start
          Length = 1355

 Score = 36.2 bits (82), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 18/28 (64%), Gaps = 1/28 (3%)

Query: 19 FCRRSHMVCDEQRP-CSRCVKRSIGHLC 45
           CR+  + CD+ RP C++C K  + HLC
Sbjct: 25 ICRKRKVKCDKTRPHCNQCTKTGVAHLC 52

>AFR117C [3309] [Homologous to ScYLR256W (HAP1) - SH]
          (646832..650290) [3459 bp, 1152 aa]
          Length = 1152

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 3/52 (5%)

Query: 19 FCRRSHMVCDEQRP-CSRCVKRSIGHLCRDEDPEGALPGTVEHSSSSGLELR 69
           CR+  + CD+ RP C++C K  + HLC   +   A  G  E   S   EL+
Sbjct: 21 ICRKRKVKCDKTRPHCNQCTKTGVAHLCHYMEQTWA--GEAEKELSKDAELK 70

>YLR256W (HAP1) [3650] chr12 (646417..650925) Transcription factor
          with heme-dependent DNA-binding activity, responsible
          for heme-dependent activation of many genes [4509 bp,
          1502 aa]
          Length = 1502

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 1/28 (3%)

Query: 19 FCRRSHMVCDEQRP-CSRCVKRSIGHLC 45
           CR+  + CD+ RP C +C K  + HLC
Sbjct: 66 ICRKRKVKCDKLRPHCQQCTKTGVAHLC 93

>Scas_573.4
          Length = 1478

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 1/28 (3%)

Query: 19 FCRRSHMVCDEQRP-CSRCVKRSIGHLC 45
           CR+  + CD+ RP C +C K  + HLC
Sbjct: 45 ICRKRKVKCDKIRPHCQQCTKTGVAHLC 72

>YOR162C (YRR1) [4961] chr15 complement(639560..641992)
          Transcription factor involved in drug-induced
          transcriptional regulation, including activation of
          multidrug transporter gene SNQ2, has a Zn[2]-Cys[6]
          fungal-type binuclear cluster domain [2433 bp, 810 aa]
          Length = 810

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 18/24 (75%), Gaps = 1/24 (4%)

Query: 19 FCRRSHMVCDEQRP-CSRCVKRSI 41
          FCRR  + CD+Q+P CS C+ R++
Sbjct: 56 FCRRRKLRCDQQKPMCSTCISRNL 79

>ACR028C [1076] [Homologous to NOHBY] (408701..410506) [1806 bp,
          601 aa]
          Length = 601

 Score = 34.3 bits (77), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 18/23 (78%), Gaps = 1/23 (4%)

Query: 20 CRRSHMVCDEQRP-CSRCVKRSI 41
          C++SH  CDE +P C +CVKR++
Sbjct: 24 CKKSHTKCDETKPACLKCVKRNV 46

>AFR108W [3300] [Homologous to ScYGL045W - SH; ScYGL046W - SH]
           complement(631113..632759) [1647 bp, 548 aa]
          Length = 548

 Score = 34.3 bits (77), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 17/31 (54%)

Query: 480 YGSIAFDKGQKAVLTSCNLRTRDGRQRRPCC 510
           Y SIAF+KG  +    C L TR G QR   C
Sbjct: 137 YTSIAFEKGSISYAVGCVLETRSGAQRLSSC 167

>CAGL0L04576g 526960..529557 similar to tr|Q12340 Saccharomyces
          cerevisiae YOR172w, hypothetical start
          Length = 865

 Score = 33.5 bits (75), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 17/32 (53%), Gaps = 2/32 (6%)

Query: 19 FCRRSHMVCDEQRP-CSRCVKRSIGHLCRDED 49
          FCRR  + CD  RP CS CV R     C  ED
Sbjct: 42 FCRRRKLKCDNARPMCSTCVSRKFS-TCIYED 72

>CAGL0L04400g complement(511762..514725) similar to tr|Q12340
          Saccharomyces cerevisiae YOR172w, hypothetical start
          Length = 987

 Score = 33.5 bits (75), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 29/51 (56%), Gaps = 3/51 (5%)

Query: 19 FCRRSHMVCDEQRP-CSRCVKRSIGHLCRDEDPEGALPGTVEHSSSSGLEL 68
          FCR+  + CD+Q+P CS C +R++      E+   A    V++ + S L+L
Sbjct: 39 FCRKRKLKCDKQKPRCSSCARRNLPVCVYIENAFTA--EMVQNGTVSSLQL 87

>Sklu_2384.6 YKL015W, Contig c2384 10929-13424
          Length = 831

 Score = 33.1 bits (74), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 33/69 (47%), Gaps = 5/69 (7%)

Query: 20  CRRSHMVCDEQRPCSRCVKRSIGHLCRDEDPEGALPGTVEH---SSSSGLELRVPKVDVD 76
           CRR H+ C    PCS+C+  +I   C   +P   L  ++++     S   E++   + + 
Sbjct: 51  CRRRHVKCPGGNPCSKCIAANIA--CEYIEPNKKLIVSMKYLQKLQSDLAEMKKENIKLQ 108

Query: 77  NTAGLVDSS 85
           N    ++SS
Sbjct: 109 NLVSTINSS 117

>Kwal_23.3514
          Length = 579

 Score = 32.7 bits (73), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 14/26 (53%)

Query: 20 CRRSHMVCDEQRPCSRCVKRSIGHLC 45
          C +  + CD   PCS CVKR    LC
Sbjct: 15 CTKRKVKCDRNIPCSNCVKRGQQELC 40

>Scas_657.3
          Length = 856

 Score = 32.7 bits (73), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 1/32 (3%)

Query: 19 FCRRSHMVCDEQRP-CSRCVKRSIGHLCRDED 49
          FCR+  + CD++RP CS C+ R +      +D
Sbjct: 47 FCRQRKLKCDQKRPICSTCIGRKLTTCVYADD 78

>Scas_663.12
          Length = 944

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 16/20 (80%), Gaps = 1/20 (5%)

Query: 20 CRRSHMVCDEQRP-CSRCVK 38
          CRRS + CD+++P CSRC K
Sbjct: 43 CRRSKVKCDQEKPVCSRCSK 62

>KLLA0E18194g 1613115..1615712 similar to sp|P25502 Saccharomyces
          cerevisiae YKL015w PUT3 positive activator of the
          proline utilisation pathway, start by similarity
          Length = 865

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 18/35 (51%), Gaps = 2/35 (5%)

Query: 20 CRRSHMVCDEQRPCSRCVKRSIGHLCRDEDPEGAL 54
          CRR H+ C    PCS+C+K  +   C   +P   L
Sbjct: 49 CRRRHIKCPGGNPCSKCLKAGVA--CEYVEPNKKL 81

>KLLA0F19602g complement(1814949..1816760) similar to sp|P43634
          Saccharomyces cerevisiae YLR098c CHA4 transcription
          factor, start by similarity
          Length = 603

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 16/30 (53%)

Query: 20 CRRSHMVCDEQRPCSRCVKRSIGHLCRDED 49
          CR     CD +RPCS C+K  I  +  + D
Sbjct: 20 CRIKRRKCDMERPCSNCLKYGIECITVNND 49

>Scas_542.8
          Length = 902

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 9/23 (39%), Positives = 14/23 (60%)

Query: 19 FCRRSHMVCDEQRPCSRCVKRSI 41
           CR+ H+ C    PC+RC+K  +
Sbjct: 31 LCRKRHIKCSGGNPCARCIKHDL 53

>Sklu_2434.10 YAL051W, Contig c2434 22765-25716
          Length = 983

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 11/23 (47%), Positives = 16/23 (69%), Gaps = 1/23 (4%)

Query: 20 CRRSHMVCDEQRP-CSRCVKRSI 41
          CR+S   CD ++P C+RC+K  I
Sbjct: 31 CRKSKTKCDREKPSCTRCIKNGI 53

>ADR405C [2145] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C
          (PIP2) - SH] (1435705..1438128) [2424 bp, 807 aa]
          Length = 807

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%), Gaps = 3/27 (11%)

Query: 20 CRRSHMVCDEQRP-CSRCVKRSIGHLC 45
          CRRS   CD+ +P C+RCVK   G +C
Sbjct: 42 CRRSKTKCDKVKPSCTRCVKN--GSVC 66

>AGL361C [3951] [Homologous to NOHBY] (24101..26191) [2091 bp, 696
           aa]
          Length = 696

 Score = 31.2 bits (69), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 9/55 (16%)

Query: 20  CRRSHMVCDEQRP-CSRCVKRSIGHLCRDEDPEGALPGTVEHSSSSGLEL-RVPK 72
           C++SH+ CD+ +P C+ C K++I  LC  E     L    E  SS    L R+PK
Sbjct: 64  CKKSHIKCDKVQPLCTTCAKKNI--LCTYE-----LSFVFEDGSSKRKILKRLPK 111

>Scas_709.51
          Length = 759

 Score = 30.8 bits (68), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 9/22 (40%), Positives = 14/22 (63%)

Query: 20 CRRSHMVCDEQRPCSRCVKRSI 41
          C+R  + CD  +PC  C+K+ I
Sbjct: 37 CKRRKVKCDGNKPCLNCIKKEI 58

>YNR063W (YNR063W) [4646] chr14 (746940..748763) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region [1824 bp, 607 aa]
          Length = 607

 Score = 30.8 bits (68), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 8/19 (42%), Positives = 13/19 (68%)

Query: 20 CRRSHMVCDEQRPCSRCVK 38
          CR+  + CD  +PC RC++
Sbjct: 19 CRKRKLKCDGNKPCGRCIR 37

>ADR403C [2143] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C
          (PIP2) - SH] (1429118..1432030) [2913 bp, 970 aa]
          Length = 970

 Score = 30.4 bits (67), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 11/23 (47%), Positives = 16/23 (69%), Gaps = 1/23 (4%)

Query: 20 CRRSHMVCDEQRP-CSRCVKRSI 41
          CR+S   CD ++P CSRC K ++
Sbjct: 35 CRKSKTKCDREKPRCSRCAKNNV 57

>YBR297W (MAL33) [474] chr2 (800479..801885) Maltose fermentation
          regulatory protein, has a Zn[2]-Cys[6] fungal-type
          binuclear cluster domain [1407 bp, 468 aa]
          Length = 468

 Score = 30.4 bits (67), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 9/20 (45%), Positives = 15/20 (75%)

Query: 19 FCRRSHMVCDEQRPCSRCVK 38
          +CR   + CD ++PCSRC++
Sbjct: 10 YCRVRRVKCDGKKPCSRCIE 29

>KLLA0C19228g 1713787..1715562 similar to sp|P53749 Saccharomyces
          cerevisiae YNR063w singleton, hypothetical start
          Length = 591

 Score = 30.4 bits (67), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 9/22 (40%), Positives = 14/22 (63%)

Query: 20 CRRSHMVCDEQRPCSRCVKRSI 41
          C++    CD Q+PC RC K ++
Sbjct: 6  CKKRKQKCDGQKPCRRCTKLNV 27

>KLLA0D09977g complement(841852..843756) weakly similar to
          sp|P40969 Saccharomyces cerevisiae YMR168c CEP3
          kinetochore protein complex, 71 KD subunit singleton,
          start by similarity
          Length = 634

 Score = 30.0 bits (66), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 18/32 (56%), Gaps = 1/32 (3%)

Query: 19 FCRRSHMVCDEQRP-CSRCVKRSIGHLCRDED 49
          FC+   + CD   P C  C++R++  LC  +D
Sbjct: 17 FCQARKVKCDRSLPACQNCIERNVTELCEYDD 48

>CAGL0M05907g 622029..624704 similar to sp|P36023 Saccharomyces
          cerevisiae YKR064w, hypothetical start
          Length = 891

 Score = 30.0 bits (66), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 14/26 (53%)

Query: 20 CRRSHMVCDEQRPCSRCVKRSIGHLC 45
          CR+    CD Q PCS+C++      C
Sbjct: 21 CRKRKSKCDRQLPCSKCIQHGDTDTC 46

>YPR196W (YPR196W) [5609] chr16 (931370..932782) Positive
          regulator of the maltose pathway MAL genes, contains a
          Zn[2]-Cys[6] fungal-type binuclear cluster domain in
          the N-terminal region [1413 bp, 470 aa]
          Length = 470

 Score = 29.3 bits (64), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 14/22 (63%)

Query: 20 CRRSHMVCDEQRPCSRCVKRSI 41
          CR   + CD  RPC RC +R++
Sbjct: 11 CRVRRVKCDRNRPCDRCRQRNL 32

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.131    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 15,897,317
Number of extensions: 662521
Number of successful extensions: 2579
Number of sequences better than 10.0: 83
Number of HSP's gapped: 2615
Number of HSP's successfully gapped: 104
Length of query: 526
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 420
Effective length of database: 12,926,601
Effective search space: 5429172420
Effective search space used: 5429172420
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)