Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0D04290g1881858751e-121
Sklu_2363.23231836962e-92
CAGL0J01661g3271836744e-89
YPR011C3261846467e-85
Kwal_14.22103151785813e-75
AGL047C3161835545e-71
YHR002W (LEU5)3571492255e-22
Scas_717.203561532212e-21
CAGL0K02915g3421272133e-20
Kwal_26.79723581232072e-19
KLLA0E18788g3811252038e-19
AGL065C3351231956e-18
Kwal_23.30425421931906e-17
Scas_667.43081941842e-16
YBR085W (AAC3)3071931824e-16
ADL049W9121581845e-16
CAGL0F04213g3061811807e-16
Scas_718.243371821801e-15
Sklu_2374.75131831782e-15
KLLA0C11363g5171811774e-15
CAGL0J05522g5191831774e-15
YNL083W5451831748e-15
YBL030C (PET9)3181801729e-15
Kwal_27.124813041901729e-15
Scas_602.88851671741e-14
AER419W4931831741e-14
AER184W3051831711e-14
CAGL0F07711g3681261703e-14
YPR021C (AGC1)9021151703e-14
AAR036W3171171675e-14
YMR056C (AAC1)3091861667e-14
Scas_578.3*5241911677e-14
CAGL0K02365g9191161652e-13
Sklu_2359.69021151607e-13
YMR166C3681261552e-12
KLLA0D15015g3171151526e-12
Kwal_47.173218811171536e-12
AFL196W3611251518e-12
KLLA0E13453g9061171511e-11
ADL264C3291571482e-11
YOR100C (CRC1)3271601464e-11
YJR095W (SFC1)3221691455e-11
Scas_669.63731291447e-11
YEL006W3351911439e-11
CAGL0M09020g3481691431e-10
Sklu_2334.23191621412e-10
Scas_721.273741821412e-10
KLLA0C13431g3281581402e-10
Scas_558.22891561393e-10
Sklu_2431.53701781376e-10
YNL003C (PET8)2841131367e-10
Scas_697.473281591368e-10
Kwal_0.2322741101359e-10
KLLA0E12353g3051921351e-09
CAGL0B04543g3171571341e-09
CAGL0J02002g3611651342e-09
AGL311C3621631332e-09
Scas_691.43341781323e-09
Kwal_23.39653071161313e-09
KLLA0D09889g3641671252e-08
KLLA0E23705g3681291252e-08
ACR260W3111531252e-08
ADL009W3791231253e-08
Sklu_2430.103241941234e-08
CAGL0H03839g2821101225e-08
Sklu_2037.23101341226e-08
YKL120W (OAC1)3241671226e-08
Scas_645.93911671226e-08
CAGL0H10538g2971191217e-08
YGR257C (MTM1)3661301218e-08
AEL253W3651711201e-07
Kwal_27.120813691751201e-07
CAGL0G03135g3071211182e-07
CAGL0F08305g3741261173e-07
AFR131C3441721163e-07
KLLA0E15532g3261591163e-07
Scas_379.23011571164e-07
YBR291C (CTP1)2991561164e-07
Scas_716.293161171154e-07
KLLA0F03212g3051341154e-07
CAGL0K11616g3201701155e-07
Kwal_55.208683801231138e-07
CAGL0J04114g3031651121e-06
Kwal_23.35293951251131e-06
YGR096W (TPC1)3141411121e-06
YOR222W (ODC2)3071831111e-06
Scas_640.253061631112e-06
AER366W2931571102e-06
YJL133W (MRS3)3141181102e-06
Kwal_23.29133201181102e-06
AFR253W3441201093e-06
Kwal_47.182163331911093e-06
YIL006W3731691084e-06
KLLA0E02750g3041151084e-06
KLLA0B12826g3191681084e-06
ADR036C340891075e-06
YKR052C (MRS4)3041611076e-06
Scas_489.42971561066e-06
Kwal_26.79672971561059e-06
Kwal_23.47313141581041e-05
KLLA0F04697g3071781041e-05
Scas_709.93651221042e-05
KLLA0A09383g3661311032e-05
Sklu_1149.22961201022e-05
AGR383W2931281022e-05
Scas_696.93121391022e-05
Sklu_1926.23051171013e-05
Kwal_55.213383231591013e-05
Sklu_1275.13111141004e-05
KLLA0D04950g2741551004e-05
Sklu_2127.52781141004e-05
Sklu_2442.82751101004e-05
YMR241W (YHM2)3141311004e-05
Scas_667.223061201004e-05
Scas_718.5324123995e-05
CAGL0G01166g295115995e-05
Sklu_2398.4309113995e-05
Kwal_56.23011303112996e-05
CAGL0M05225g381132996e-05
Scas_715.45305137988e-05
Kwal_33.14050314119979e-05
Kwal_33.15597305121971e-04
Kwal_27.11419298117971e-04
AAL014C271123961e-04
Scas_589.10316182961e-04
Kwal_23.4354343169961e-04
CAGL0D01606g305161961e-04
Scas_662.1230870962e-04
CAGL0L02079g297126952e-04
Kwal_26.7653325183952e-04
KLLA0E18810g377120952e-04
Scas_632.929265952e-04
Scas_721.129323197942e-04
Sklu_1119.1307121942e-04
Kwal_26.8669296159943e-04
CAGL0K10362g30167943e-04
KLLA0E02772g28467933e-04
YBR192W (RIM2)377183943e-04
KLLA0E08877g294117933e-04
AFR146W28173934e-04
CAGL0K12210g31168934e-04
Kwal_55.21106328179934e-04
KLLA0B08503g303119924e-04
KLLA0D14036g43172925e-04
Kwal_55.21335317117915e-04
CAGL0K07436g307130915e-04
CAGL0K08250g297157916e-04
AFR542W310130917e-04
KLLA0B11319g35592917e-04
YOR130C (ORT1)292158908e-04
Scas_582.7329118909e-04
Scas_562.12300158890.001
CAGL0D04774g322129890.001
AFR147C315115890.001
YBR104W (YMC2)329159890.001
Scas_673.17314115880.001
AGL064W296100880.001
YPL134C (ODC1)31072880.002
CAGL0G08910g289147880.002
AER450C30879870.002
Scas_714.18305133870.002
Kwal_33.12988303150870.002
YPR058W (YMC1)307120870.002
Sklu_2432.5288114860.002
ACR109W299114860.002
YLR348C (DIC1)298157860.003
Kwal_27.12599304117850.003
CAGL0F00231g307112850.004
YJR077C (MIR1)311112850.004
Sklu_2435.2344136840.004
YPR128C (ANT1)328132840.004
KLLA0B14454g305121840.005
KLLA0D07073g297162830.006
Sklu_2115.4299115830.007
Kwal_47.1922828188820.009
Sklu_2194.3312157810.012
CAGL0J09790g300127810.014
CAGL0L05742g305161800.014
Scas_705.932375800.016
YIL134W (FLX1)31173770.038
KLLA0D04312g10377730.039
ABL023W309126770.044
YFR045W285108760.045
Scas_702.1030290740.088
KLLA0F17864g307113740.090
Sklu_2075.3345165740.090
Sklu_2260.5302117740.098
Kwal_34.15907312148740.099
Kwal_23.5757307113740.11
Scas_687.15*328107730.12
YDL198C (YHM1)300157730.13
YDL119C307116730.13
KLLA0F13464g300127720.15
Scas_328.122754720.16
Sklu_2433.8420116720.18
Kwal_33.15446305176720.18
KLLA0F08547g308135720.19
Kwal_27.11626299158710.20
AGR191W29888700.26
Scas_613.2417737680.39
KLLA0E09680g307162690.39
KLLA0A00979g34389680.64
CAGL0C02013g32990660.94
CAGL0K06545g512108661.2
CAGL0B03883g306183623.0
YKR051W41893623.8
Sklu_2127.432345614.1
Scas_379.343263605.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D04290g
         (185 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyce...   341   e-121
Sklu_2363.2 YPR011C, Contig c2363 11969-12940                         272   2e-92
CAGL0J01661g 154646..155629 highly similar to tr|Q12251 Saccharo...   264   4e-89
YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protei...   253   7e-85
Kwal_14.2210                                                          228   3e-75
AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803) ...   218   5e-71
YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similar...    91   5e-22
Scas_717.20                                                            90   2e-21
CAGL0K02915g 259026..260054 highly similar to sp|P38702 Saccharo...    87   3e-20
Kwal_26.7972                                                           84   2e-19
KLLA0E18788g complement(1661093..1662238) similar to sp|P38702 S...    83   8e-19
AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH] (585963..58...    80   6e-18
Kwal_23.3042                                                           78   6e-17
Scas_667.4                                                             75   2e-16
YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter p...    75   4e-16
ADL049W [1692] [Homologous to ScYPR021C - SH] complement(598135....    75   5e-16
CAGL0F04213g 419473..420393 highly similar to sp|P18239 Saccharo...    74   7e-16
Scas_718.24                                                            74   1e-15
Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement       73   2e-15
KLLA0C11363g complement(975442..976995) similar to sp|P48233 Sac...    73   4e-15
CAGL0J05522g complement(524930..526489) highly similar to sp|P48...    73   4e-15
YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the mi...    72   8e-15
YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP car...    71   9e-15
Kwal_27.12481                                                          71   9e-15
Scas_602.8                                                             72   1e-14
AER419W [2919] [Homologous to ScYNL083W - SH] complement(1442595...    72   1e-14
AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W (...    70   1e-14
CAGL0F07711g complement(751794..752900) similar to sp|Q03829 Sac...    70   3e-14
YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of...    70   3e-14
AAR036W [222] [Homologous to ScYGR096W - SH] complement(406887.....    69   5e-14
YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP c...    69   7e-14
Scas_578.3*                                                            69   7e-14
CAGL0K02365g 212702..215461 highly similar to tr|Q12482 Saccharo...    68   2e-13
Sklu_2359.6 YPR021C, Contig c2359 14617-17325                          66   7e-13
YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member...    64   2e-12
KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces...    63   6e-12
Kwal_47.17321                                                          64   6e-12
AFL196W [2999] [Homologous to ScYMR166C - SH] complement(66955.....    63   8e-12
KLLA0E13453g complement(1184806..1187526) similar to sgd|S000622...    63   1e-11
ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH] (241532..24...    62   2e-11
YOR100C (CRC1) [4905] chr15 complement(513295..514278) Mitochond...    61   4e-11
YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membr...    60   5e-11
Scas_669.6                                                             60   7e-11
YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the mit...    60   9e-11
CAGL0M09020g complement(896312..897358) highly similar to sp|P33...    60   1e-10
Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement         59   2e-10
Scas_721.27                                                            59   2e-10
KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomy...    59   2e-10
Scas_558.2                                                             58   3e-10
Sklu_2431.5 YBR192W, Contig c2431 8526-9638                            57   6e-10
YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein o...    57   7e-10
Scas_697.47                                                            57   8e-10
Kwal_0.232                                                             57   9e-10
KLLA0E12353g complement(1092303..1093220) gi|1351895|sp|P49382|A...    57   1e-09
CAGL0B04543g 441599..442552 highly similar to tr|Q12289 Saccharo...    56   1e-09
CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces c...    56   2e-09
AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH] (119645..12...    56   2e-09
Scas_691.4                                                             55   3e-09
Kwal_23.3965                                                           55   3e-09
KLLA0D09889g complement(834904..835998) similar to sp|Q03829 Sac...    53   2e-08
KLLA0E23705g complement(2099965..2101071) highly similar to sp|P...    53   2e-08
ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C (...    53   2e-08
ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH] co...    53   3e-08
Sklu_2430.10 YKL120W, Contig c2430 18856-19830                         52   4e-08
CAGL0H03839g 359987..360835 highly similar to sp|P38921 Saccharo...    52   5e-08
Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement         52   6e-08
YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial oxalo...    52   6e-08
Scas_645.9                                                             52   6e-08
CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534 Saccha...    51   7e-08
YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member o...    51   8e-08
AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH] complement(...    51   1e-07
Kwal_27.12081                                                          51   1e-07
CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces c...    50   2e-07
CAGL0F08305g complement(827705..828829) similar to sp|P53320 Sac...    50   3e-07
AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033) [...    49   3e-07
KLLA0E15532g complement(1383230..1384210) similar to sp|P23500 S...    49   3e-07
Scas_379.2                                                             49   4e-07
YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondri...    49   4e-07
Scas_716.29                                                            49   4e-07
KLLA0F03212g 302915..303832 highly similar to sp|P33303 Saccharo...    49   4e-07
CAGL0K11616g complement(1121834..1122796) highly similar to sp|P...    49   5e-07
Kwal_55.20868                                                          48   8e-07
CAGL0J04114g complement(384321..385232) similar to sp|Q99297 Sac...    48   1e-06
Kwal_23.3529                                                           48   1e-06
YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiami...    48   1e-06
YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate ...    47   1e-06
Scas_640.25                                                            47   2e-06
AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH] complement(...    47   2e-06
YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the mitoc...    47   2e-06
Kwal_23.2913                                                           47   2e-06
AFR253W [3445] [Homologous to ScYFR045W - SH] complement(892939....    47   3e-06
Kwal_47.18216                                                          47   3e-06
YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the mit...    46   4e-06
KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida ...    46   4e-06
KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces...    46   4e-06
ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH] (771097..77...    46   5e-06
YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of...    46   6e-06
Scas_489.4                                                             45   6e-06
Kwal_26.7967                                                           45   9e-06
Kwal_23.4731                                                           45   1e-05
KLLA0F04697g complement(461126..462049) similar to sp|P40464 Sac...    45   1e-05
Scas_709.9                                                             45   2e-05
KLLA0A09383g complement(818752..819852) similar to sp|P53320 Sac...    44   2e-05
Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement         44   2e-05
AGR383W [4694] [Homologous to ScYDL119C - SH] complement(1436769...    44   2e-05
Scas_696.9                                                             44   2e-05
Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement          44   3e-05
Kwal_55.21338                                                          44   3e-05
Sklu_1275.1 , Contig c1275 314-1249                                    43   4e-05
KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces c...    43   4e-05
Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement         43   4e-05
Sklu_2442.8 YNL003C, Contig c2442 12309-13136                          43   4e-05
YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1 ...    43   4e-05
Scas_667.22                                                            43   4e-05
Scas_718.5                                                             43   5e-05
CAGL0G01166g complement(111298..112185) highly similar to tr|Q06...    43   5e-05
Sklu_2398.4 , Contig c2398 9476-10405                                  43   5e-05
Kwal_56.23011                                                          43   6e-05
CAGL0M05225g 563163..564308 highly similar to sp|P38127 Saccharo...    43   6e-05
Scas_715.45                                                            42   8e-05
Kwal_33.14050                                                          42   9e-05
Kwal_33.15597                                                          42   1e-04
Kwal_27.11419                                                          42   1e-04
AAL014C [173] [Homologous to ScYNL003C (PET8) - SH] (317388..318...    42   1e-04
Scas_589.10                                                            42   1e-04
Kwal_23.4354                                                           42   1e-04
CAGL0D01606g complement(169066..169983) highly similar to sp|P32...    42   1e-04
Scas_662.12                                                            42   2e-04
CAGL0L02079g 243467..244360 highly similar to sp|P38152 Saccharo...    41   2e-04
Kwal_26.7653                                                           41   2e-04
KLLA0E18810g 1663220..1664353 some similarities with sp|P38152 S...    41   2e-04
Scas_632.9                                                             41   2e-04
Scas_721.129                                                           41   2e-04
Sklu_1119.1 YJR077C, Contig c1119 366-1289                             41   2e-04
Kwal_26.8669                                                           41   3e-04
CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375 S...    41   3e-04
KLLA0E02772g complement(261895..262749) similar to sp|Q12375 Sac...    40   3e-04
YBR192W (RIM2) [375] chr2 (607609..608742) Member of the mitocho...    41   3e-04
KLLA0E08877g complement(791157..792041) similar to sgd|S0002277 ...    40   3e-04
AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH] complement(...    40   4e-04
CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces...    40   4e-04
Kwal_55.21106                                                          40   4e-04
KLLA0B08503g complement(753498..754409) similar to sp|P32331 Sac...    40   4e-04
KLLA0D14036g complement(1203522..1204817) some similarities with...    40   5e-04
Kwal_55.21335                                                          40   5e-04
CAGL0K07436g complement(734496..735419) highly similar to sp|Q04...    40   5e-04
CAGL0K08250g complement(820185..821078) highly similar to sp|P23...    40   6e-04
AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH] complement(...    40   7e-04
KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyce...    40   7e-04
YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine...    39   8e-04
Scas_582.7                                                             39   9e-04
Scas_562.12                                                            39   0.001
CAGL0D04774g complement(467712..468680) similar to tr|Q06497 Sac...    39   0.001
AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 3...    39   0.001
YBR104W (YMC2) [293] chr2 (449624..450613) Member of the mitocho...    39   0.001
Scas_673.17                                                            39   0.001
AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH] complement(...    39   0.001
YPL134C (ODC1) [5311] chr16 complement(298570..299502) 2-Oxodica...    39   0.002
CAGL0G08910g complement(853693..854562) similar to sp|P40464 Sac...    39   0.002
AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH] (1500683..1...    38   0.002
Scas_714.18                                                            38   0.002
Kwal_33.12988                                                          38   0.002
YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the mitoc...    38   0.002
Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement       38   0.002
ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C (...    38   0.002
YLR348C (DIC1) [3731] chr12 complement(826976..827872) Mitochond...    38   0.003
Kwal_27.12599                                                          37   0.003
CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomy...    37   0.004
YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate...    37   0.004
Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement         37   0.004
YPR128C (ANT1) [5547] chr16 complement(791212..792198) Peroxisom...    37   0.004
KLLA0B14454g complement(1268709..1269626) highly similar to sp|P...    37   0.005
KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces c...    37   0.006
Sklu_2115.4 YDL119C, Contig c2115 2906-3805                            37   0.007
Kwal_47.19228                                                          36   0.009
Sklu_2194.3 YMR241W, Contig c2194 5245-6183                            36   0.012
CAGL0J09790g complement(957759..958661) highly similar to sp|P38...    36   0.014
CAGL0L05742g complement(630844..631761) similar to sp|P10566 Sac...    35   0.014
Scas_705.9                                                             35   0.016
YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in tr...    34   0.038
KLLA0D04312g 367160..367471 highly similar to sgd|S0006215 Sacch...    33   0.039
ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH] complement(3...    34   0.044
YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the mit...    34   0.045
Scas_702.10                                                            33   0.088
KLLA0F17864g complement(1634241..1635164) similar to sp|P32331 S...    33   0.090
Sklu_2075.3 , Contig c2075 6414-7451 reverse complement                33   0.090
Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement         33   0.098
Kwal_34.15907                                                          33   0.099
Kwal_23.5757                                                           33   0.11 
Scas_687.15*                                                           33   0.12 
YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of t...    33   0.13 
YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member o...    33   0.13 
KLLA0F13464g 1246646..1247548 highly similar to sp|P38988 Saccha...    32   0.15 
Scas_328.1                                                             32   0.16 
Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement       32   0.18 
Kwal_33.15446                                                          32   0.18 
KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces c...    32   0.19 
Kwal_27.11626                                                          32   0.20 
AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH] complement(...    32   0.26 
Scas_613.24                                                            31   0.39 
KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaY...    31   0.39 
KLLA0A00979g complement(92561..93592) weakly similar to sp|P3815...    31   0.64 
CAGL0C02013g complement(209930..210919) weakly similar to sp|P38...    30   0.94 
CAGL0K06545g complement(641129..642667) similar to tr|Q03327 Sac...    30   1.2  
CAGL0B03883g 383602..384522 weakly similar to sp|P32331 Saccharo...    28   3.0  
YKR051W (YKR051W) [3302] chr11 (530588..531844) Member of the do...    28   3.8  
Sklu_2127.4 , Contig c2127 6322-7293                                   28   4.1  
Scas_379.3                                                             28   5.9  

>KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyces
           cerevisiae YPR011c, hypothetical start
          Length = 188

 Score =  341 bits (875), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 167/185 (90%), Positives = 167/185 (90%)

Query: 1   MDLKQLAKQESSIAFIXXXXXXXXSRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVY 60
           MDLKQLAKQESSIAFI        SRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVY
Sbjct: 1   MDLKQLAKQESSIAFIAGGVAGAVSRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVY 60

Query: 61  KEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGAL 120
           KEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGAL
Sbjct: 61  KEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGAL 120

Query: 121 CGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGL 180
           CGGMSVLATYPLDLVRTRLSIQTAN          DIAKPPGVWELLVKTFKEEGGIRGL
Sbjct: 121 CGGMSVLATYPLDLVRTRLSIQTANLAKLSKSKAKDIAKPPGVWELLVKTFKEEGGIRGL 180

Query: 181 YRGIY 185
           YRGIY
Sbjct: 181 YRGIY 185

>Sklu_2363.2 YPR011C, Contig c2363 11969-12940
          Length = 323

 Score =  272 bits (696), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 128/183 (69%), Positives = 150/183 (81%)

Query: 3   LKQLAKQESSIAFIXXXXXXXXSRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKE 62
           +K + K +S++AF+        SRTVVSPFERVKILLQVQ+ST+AYN GI+ AV QVY+E
Sbjct: 14  VKSILKNDSNVAFLAGGLAGAVSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYRE 73

Query: 63  EGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCG 122
           EG  GLFRGNGLNC+RIFPYSAVQFVVYE CKKH FHVDG+ G+EQL NWQRL +GALCG
Sbjct: 74  EGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCG 133

Query: 123 GMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYR 182
           G SVLATYPLDLVRTRLSIQTAN          +I+KPPGVW+LL +T+KEEGGI+GLYR
Sbjct: 134 GCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYR 193

Query: 183 GIY 185
           G++
Sbjct: 194 GVW 196

 Score = 65.5 bits (158), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 53/166 (31%), Positives = 80/166 (48%), Gaps = 24/166 (14%)

Query: 31  PFERVKILLQVQ-------SSTSAYN----HGIINAVGQVYKEEG-VAGLFRGNGLNCVR 78
           P + V+  L +Q       S + A+N     G+ + + + YKEEG + GL+RG     + 
Sbjct: 142 PLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLG 201

Query: 79  IFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTR 138
           + PY A+ F VYE  K+  F  +GT     L N+ +LS GAL GG++   TYP DL+R R
Sbjct: 202 VVPYVALNFAVYEQFKE--FMPEGT--DNTLANFYKLSIGALSGGVAQTVTYPFDLLRRR 257

Query: 139 LSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
             +                 +   V + L+   K E G RG Y+G+
Sbjct: 258 FQVLAMGGNELGF-------RYKSVMDALITIGKTE-GFRGYYKGL 295

 Score = 33.5 bits (75), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 37/71 (52%), Gaps = 4/71 (5%)

Query: 25  SRTVVSPFE----RVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIF 80
           ++TV  PF+    R ++L    +        +++A+  + K EG  G ++G   N  ++ 
Sbjct: 244 AQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVI 303

Query: 81  PYSAVQFVVYE 91
           P +AV ++VYE
Sbjct: 304 PSTAVSWLVYE 314

>CAGL0J01661g 154646..155629 highly similar to tr|Q12251
           Saccharomyces cerevisiae YPR011c, start by similarity
          Length = 327

 Score =  264 bits (674), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 125/183 (68%), Positives = 145/183 (79%)

Query: 3   LKQLAKQESSIAFIXXXXXXXXSRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKE 62
           LK   KQ++++AF+        SRTVVSPFERVKILLQVQSST+AYN G+ +A+GQVYKE
Sbjct: 15  LKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKE 74

Query: 63  EGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCG 122
           E + GLFRGNGLNC+R+FPYSAVQFVV+E CKKHIFHVD     EQL NWQRL +GALCG
Sbjct: 75  ENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCG 134

Query: 123 GMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYR 182
           G SV+ATYPLDLVRTRLS+QTAN          DIAKPPGVW+LL K + EEGGI GLYR
Sbjct: 135 GCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYR 194

Query: 183 GIY 185
           G++
Sbjct: 195 GVW 197

 Score = 58.9 bits (141), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 49/166 (29%), Positives = 72/166 (43%), Gaps = 21/166 (12%)

Query: 31  PFERVKILLQVQS-----------STSAYNHGIINAVGQVYKEEG-VAGLFRGNGLNCVR 78
           P + V+  L VQ+           S  A   G+   + + Y EEG + GL+RG     + 
Sbjct: 143 PLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLG 202

Query: 79  IFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTR 138
           I PY A+ F VYE  K+ +   D         +  +LS GA+ GG++   TYP DL+R R
Sbjct: 203 IVPYVALNFAVYEQLKEFM-PSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRR 261

Query: 139 LSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
             +                     VW+ LV   K E G +G Y+G+
Sbjct: 262 FQVLAMGGNELGFHYN-------SVWDALVTIGKTE-GFKGYYKGL 299

 Score = 34.3 bits (77), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 38/71 (53%), Gaps = 4/71 (5%)

Query: 25  SRTVVSPFE----RVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIF 80
           ++T+  PF+    R ++L    +    + + + +A+  + K EG  G ++G   N  ++ 
Sbjct: 248 AQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVV 307

Query: 81  PYSAVQFVVYE 91
           P +AV ++VYE
Sbjct: 308 PSTAVSWLVYE 318

>YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protein
           with similarity to human Grave's disease carrier protein
           and to bovine homolog of Grave's disease protein, member
           of the mitochondrial carrier family (MCF) of membrane
           transporters [981 bp, 326 aa]
          Length = 326

 Score =  253 bits (646), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 119/184 (64%), Positives = 145/184 (78%)

Query: 2   DLKQLAKQESSIAFIXXXXXXXXSRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYK 61
            +K   KQ+S+IAF+        SRTVVSPFERVKILLQVQSST++YN GI +++ QVY 
Sbjct: 13  SIKDFLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYH 72

Query: 62  EEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALC 121
           EEG  GLFRGNGLNC+RIFPYSAVQFVVYE CKK +FHV+G  G+EQL N QRL +GALC
Sbjct: 73  EEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALC 132

Query: 122 GGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLY 181
           GG SV+ATYPLDL++TRLSIQTAN           I+KPPG+W+LL +T++ EGG+RGLY
Sbjct: 133 GGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYRLEGGLRGLY 192

Query: 182 RGIY 185
           RG++
Sbjct: 193 RGVW 196

 Score = 55.8 bits (133), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 46/167 (27%), Positives = 78/167 (46%), Gaps = 23/167 (13%)

Query: 31  PFERVKILLQVQSST-SAYNH----------GIINAVGQVYK-EEGVAGLFRGNGLNCVR 78
           P + +K  L +Q++  S+ N           GI   + + Y+ E G+ GL+RG     + 
Sbjct: 142 PLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYRLEGGLRGLYRGVWPTSLG 201

Query: 79  IFPYSAVQFVVYEWCKKHIFHVDGTVGKEQL-LNWQRLSAGALCGGMSVLATYPLDLVRT 137
           + PY A+ F VYE  ++  F V+ +  +     N  +L+ GA+ GG++   TYP DL+R 
Sbjct: 202 VVPYVALNFAVYEQLRE--FGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRR 259

Query: 138 RLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
           R  +                 +   VW+ LV   + E G+ G Y+G+
Sbjct: 260 RFQVLAMGGNELGF-------RYTSVWDALVTIGRAE-GVSGYYKGL 298

 Score = 33.1 bits (74), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 38/71 (53%), Gaps = 4/71 (5%)

Query: 25  SRTVVSPFE----RVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIF 80
           ++T+  PF+    R ++L    +        + +A+  + + EGV+G ++G   N  ++ 
Sbjct: 247 AQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVV 306

Query: 81  PYSAVQFVVYE 91
           P +AV ++VYE
Sbjct: 307 PSTAVSWLVYE 317

>Kwal_14.2210
          Length = 315

 Score =  228 bits (581), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 118/178 (66%), Positives = 131/178 (73%), Gaps = 3/178 (1%)

Query: 8   KQESSIAFIXXXXXXXXSRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAG 67
           K ++ IAF         SRTVVSPFERVKILLQVQSST AYNHG+  AV QVY EEGV G
Sbjct: 14  KSDAGIAFCAGGIAGAVSRTVVSPFERVKILLQVQSSTHAYNHGLFRAVKQVYLEEGVPG 73

Query: 68  LFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVL 127
           L RGNGLNC+RIFPYSAVQF+VYE+CKK  F  +       +LNW RL +GALCGG SVL
Sbjct: 74  LLRGNGLNCIRIFPYSAVQFLVYEFCKKQWFQQN---PDTVVLNWHRLVSGALCGGCSVL 130

Query: 128 ATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGIY 185
           ATYPLDLVRTRLSIQTAN            AKPPGVWELL KT+ +EGGI GLYRG++
Sbjct: 131 ATYPLDLVRTRLSIQTANLARLHKAKAASAAKPPGVWELLRKTYTQEGGIFGLYRGVW 188

 Score = 52.0 bits (123), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 59/123 (47%), Gaps = 16/123 (13%)

Query: 31  PFERVKILLQVQSSTSAYNH-----------GIINAVGQVYKEEG-VAGLFRGNGLNCVR 78
           P + V+  L +Q++  A  H           G+   + + Y +EG + GL+RG     + 
Sbjct: 134 PLDLVRTRLSIQTANLARLHKAKAASAAKPPGVWELLRKTYTQEGGIFGLYRGVWPTSIG 193

Query: 79  IFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTR 138
           + PY A+ F VYE  +++I             +  +LS GA+ GG++   TYP DL+R R
Sbjct: 194 VVPYVALNFAVYEQLREYI----PASFDPASASLYKLSIGAISGGVAQTITYPFDLLRRR 249

Query: 139 LSI 141
             +
Sbjct: 250 FQV 252

 Score = 38.1 bits (87), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 41/77 (53%), Gaps = 4/77 (5%)

Query: 25  SRTVVSPFE----RVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIF 80
           ++T+  PF+    R ++L   QS    +   + +A+  + + EG  G ++G   N  ++ 
Sbjct: 236 AQTITYPFDLLRRRFQVLAMGQSELGFHYKSVPDALITIGRTEGFKGYYKGLTANLFKVV 295

Query: 81  PYSAVQFVVYEWCKKHI 97
           P +AV +VVYE  + ++
Sbjct: 296 PSTAVSWVVYETVRDYM 312

>AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803)
           [951 bp, 316 aa]
          Length = 316

 Score =  218 bits (554), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 138/183 (75%), Gaps = 1/183 (0%)

Query: 3   LKQLAKQESSIAFIXXXXXXXXSRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKE 62
           ++ + K +  IAF+        SRTVVSP ERVKILLQVQSST+AYN G+++AV QVYKE
Sbjct: 8   IQTVYKNDGFIAFVAGGVGGAVSRTVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKE 67

Query: 63  EGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCG 122
           EGV GLFRGNG+NC+RIFPYSAVQ+ VYE+CK  +FHV G  G EQL +W+RL  GAL G
Sbjct: 68  EGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVFHV-GQSGHEQLRSWERLVGGALGG 126

Query: 123 GMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYR 182
           G SVL TYPLDLVRTRLSIQTAN          DI +PPG+ ELL + F+EEGG+RG YR
Sbjct: 127 GASVLVTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYR 186

Query: 183 GIY 185
           G+Y
Sbjct: 187 GVY 189

 Score = 54.3 bits (129), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 76/169 (44%), Gaps = 24/169 (14%)

Query: 28  VVSPFERVKILLQVQSSTSAYNH-----------GIINAVGQVYKEEG-VAGLFRGNGLN 75
           V  P + V+  L +Q++  A  H           GI+  + ++++EEG + G +RG    
Sbjct: 132 VTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPT 191

Query: 76  CVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLV 135
            + + P+ A+ F +YE  K  I H D   G    +   +L+ GA+ GG++    YP DL+
Sbjct: 192 SLGVVPFVALNFALYERLKALIPH-DYDAGS---VAAAKLAIGAVSGGIAQTVVYPFDLL 247

Query: 136 RTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
           R R  + T              +    +W     T   + G+RG Y+G+
Sbjct: 248 RRRFQVLTMGQSELGFRYA---SVADALW-----TIGRQEGLRGYYKGL 288

 Score = 40.8 bits (94), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 43/77 (55%), Gaps = 4/77 (5%)

Query: 25  SRTVVSPFE----RVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIF 80
           ++TVV PF+    R ++L   QS        + +A+  + ++EG+ G ++G   N V++ 
Sbjct: 237 AQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVV 296

Query: 81  PYSAVQFVVYEWCKKHI 97
           P  AVQ+ VYE   +++
Sbjct: 297 PAMAVQWFVYELISENM 313

>YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similarity
           to Grave's disease protein, member of the mitochondrial
           carrier (MCF) family of membrane transporters [1074 bp,
           357 aa]
          Length = 357

 Score = 91.3 bits (225), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 52/149 (34%), Positives = 80/149 (53%), Gaps = 13/149 (8%)

Query: 25  SRTVVSPFERVKILLQVQSSTSAYNH------GIINAVGQVYKEEGVAGLFRGNGLNCVR 78
           ++T+++P +R+KIL Q  +S   Y        G++ A   ++  +GV G F+G+    +R
Sbjct: 47  AKTLIAPLDRIKILFQ--TSNPHYTKYTGSLIGLVEAAKHIWINDGVRGFFQGHSATLLR 104

Query: 79  IFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTR 138
           IFPY+AV+FV YE  +  +        KE   +W+RL +G+L G  SV  TYPLDLVR R
Sbjct: 105 IFPYAAVKFVAYEQIRNTLI-----PSKEFESHWRRLVSGSLAGLCSVFITYPLDLVRVR 159

Query: 139 LSIQTANXXXXXXXXXXDIAKPPGVWELL 167
           L+ +T +           I K P    L+
Sbjct: 160 LAYETEHKRVKLGRIIKKIYKEPASATLI 188

 Score = 41.6 bits (96), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 39/75 (52%), Gaps = 5/75 (6%)

Query: 25  SRTVVSPFERVKILLQVQ--SSTSAYNHGI--INAVGQV-YKEEGVAGLFRGNGLNCVRI 79
           S+T   PFE ++  LQV   S  + Y+H    I+ +  + +KE GV G F G  +  +++
Sbjct: 278 SQTAAYPFEIIRRRLQVSALSPKTMYDHKFQSISEIAHIIFKERGVRGFFVGLSIGYIKV 337

Query: 80  FPYSAVQFVVYEWCK 94
            P  A  F VYE  K
Sbjct: 338 TPMVACSFFVYERMK 352

>Scas_717.20
          Length = 356

 Score = 89.7 bits (221), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 80/153 (52%), Gaps = 13/153 (8%)

Query: 25  SRTVVSPFERVKILLQVQSSTSAYNH------GIINAVGQVYKEEGVAGLFRGNGLNCVR 78
           ++T+++P +R+KIL Q  +S   Y        G+  A   ++  +G+ G F+G+ +  +R
Sbjct: 46  AKTLIAPLDRIKILFQ--TSNPHYTKYAGSLVGLKEAAKHIWLNDGIRGFFQGHSVTLMR 103

Query: 79  IFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTR 138
           IFPY+AV+FV YE  +  +        KE   +W+RL +G+L G  SV  TYPLDL+R R
Sbjct: 104 IFPYAAVKFVAYEQIRNTLI-----PSKEYESHWRRLMSGSLAGLCSVFTTYPLDLIRVR 158

Query: 139 LSIQTANXXXXXXXXXXDIAKPPGVWELLVKTF 171
           L+  T +           I K P    L  K +
Sbjct: 159 LAYVTEHKRISLLGLVKTIYKEPASTTLEAKGY 191

 Score = 42.4 bits (98), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 38/78 (48%), Gaps = 5/78 (6%)

Query: 25  SRTVVSPFERVKILLQVQ--SSTSAYNH---GIINAVGQVYKEEGVAGLFRGNGLNCVRI 79
           S+T   PFE ++  LQV   S +  Y+H    I      +YKE G  G F G  +  +++
Sbjct: 277 SQTAAYPFEIIRRRLQVSTLSVSQMYDHRFQSISEIAKIIYKERGWRGFFVGLSIGYIKV 336

Query: 80  FPYSAVQFVVYEWCKKHI 97
            P  A  F VYE  K H+
Sbjct: 337 TPMVACSFFVYERMKWHL 354

>CAGL0K02915g 259026..260054 highly similar to sp|P38702
           Saccharomyces cerevisiae YHR002w LEU5, hypothetical
           start
          Length = 342

 Score = 86.7 bits (213), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 75/127 (59%), Gaps = 13/127 (10%)

Query: 25  SRTVVSPFERVKILLQVQSSTSAYNH------GIINAVGQVYKEEGVAGLFRGNGLNCVR 78
           ++T+++P +R+KIL Q  +S   Y+       G+  A   ++  +G+ G F+G+ +  +R
Sbjct: 32  AKTLIAPLDRIKILFQ--TSNPHYSKYAGSLVGLYEAAKHIWINDGIRGFFQGHSVTLLR 89

Query: 79  IFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTR 138
           IFPY+AV+FV YE  +  +        +E   +W+RL++G+L G  SV  TYPLDL R R
Sbjct: 90  IFPYAAVKFVAYEQIRSILI-----PSREYESHWRRLASGSLAGLCSVFITYPLDLTRVR 144

Query: 139 LSIQTAN 145
           L+  T +
Sbjct: 145 LAYVTEH 151

 Score = 39.7 bits (91), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 41/78 (52%), Gaps = 5/78 (6%)

Query: 25  SRTVVSPFERVKILLQVQ--SSTSAYNHGI--INAVGQV-YKEEGVAGLFRGNGLNCVRI 79
           S+T   P E ++  LQV   S    Y+H    I+++ ++ Y+E+G  G F G  +  +++
Sbjct: 263 SQTAAYPLEIIRRRLQVSTLSPRKMYDHKFQSISSIARIIYQEKGWRGFFVGLSIGYIKV 322

Query: 80  FPYSAVQFVVYEWCKKHI 97
            P  A  F VYE  K H+
Sbjct: 323 TPMVACSFFVYERMKWHL 340

 Score = 39.7 bits (91), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 35/79 (44%), Gaps = 7/79 (8%)

Query: 106 KEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWE 165
           K  L  W  L AG L G +S  A YPL+++R RL + T +           I+       
Sbjct: 244 KTPLRTWAELVAGGLSGILSQTAAYPLEIIRRRLQVSTLSPRKMYDHKFQSISS------ 297

Query: 166 LLVKTFKEEGGIRGLYRGI 184
            + +   +E G RG + G+
Sbjct: 298 -IARIIYQEKGWRGFFVGL 315

>Kwal_26.7972
          Length = 358

 Score = 84.3 bits (207), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 71/123 (57%), Gaps = 9/123 (7%)

Query: 25  SRTVVSPFERVKILLQVQSST----SAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIF 80
           ++T+++P +R+KIL Q  +      S    G+I A   +   +G+ G ++G+    +RIF
Sbjct: 41  AKTLIAPLDRIKILFQTSNPHYLKYSGSTMGLIRAGAHINAHDGIRGFYQGHSATLIRIF 100

Query: 81  PYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLS 140
           PY+A++F+ YE  +  +        KE   + +RL++G++ G  SV  TYPLDL+R RL+
Sbjct: 101 PYAAIKFIAYEQIRHFMI-----PSKEYETHARRLASGSMAGLCSVFMTYPLDLIRVRLA 155

Query: 141 IQT 143
             T
Sbjct: 156 YVT 158

 Score = 35.0 bits (79), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 34/66 (51%), Gaps = 3/66 (4%)

Query: 25  SRTVVSPFERVKILLQVQ--SSTSAYN-HGIINAVGQVYKEEGVAGLFRGNGLNCVRIFP 81
           S+T   PFE ++  LQV   S TS +N   I + +  +YKE G  G F G  +  +++ P
Sbjct: 272 SQTASYPFEIIRRRLQVSVVSPTSIHNFQTIPDMIRIIYKERGWRGFFVGLSIGYIKVTP 331

Query: 82  YSAVQF 87
             A  F
Sbjct: 332 MVACSF 337

>KLLA0E18788g complement(1661093..1662238) similar to sp|P38702
           Saccharomyces cerevisiae YHR002w, start by similarity
          Length = 381

 Score = 82.8 bits (203), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 74/125 (59%), Gaps = 9/125 (7%)

Query: 25  SRTVVSPFERVKILLQVQSST----SAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIF 80
           ++T+++P +R+KIL Q  +      +    G++NA   ++  + + G+F+G+    +RIF
Sbjct: 67  AKTLIAPLDRIKILFQTSNPHYVKYAGSFQGLLNAGVHIWSRDRLRGVFQGHSATLLRIF 126

Query: 81  PYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLS 140
           PY+AV+F+ YE  +  I        KE   +++RL +G+L G  SV  TYPLDL+R RL+
Sbjct: 127 PYAAVKFIAYEQIRNVII-----PSKEYETHFRRLCSGSLAGLCSVFCTYPLDLIRVRLA 181

Query: 141 IQTAN 145
             T +
Sbjct: 182 YVTEH 186

 Score = 36.6 bits (83), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 34/73 (46%), Gaps = 3/73 (4%)

Query: 25  SRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQ---VYKEEGVAGLFRGNGLNCVRIFP 81
           S+T   PFE ++  LQV + T+   H   +       ++ E G  G F G  +  +++ P
Sbjct: 304 SQTAAYPFEIIRRRLQVGAVTNPLEHKFTSMSEMAKIIFHERGWRGFFVGLSIGYIKVTP 363

Query: 82  YSAVQFVVYEWCK 94
             A  F VYE  K
Sbjct: 364 MVACSFFVYERMK 376

>AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH]
           (585963..586970) [1008 bp, 335 aa]
          Length = 335

 Score = 79.7 bits (195), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 45/123 (36%), Positives = 70/123 (56%), Gaps = 9/123 (7%)

Query: 25  SRTVVSPFERVKILLQVQSSTSAY----NHGIINAVGQVYKEEGVAGLFRGNGLNCVRIF 80
           ++T+V+P +R+KIL Q  +   A       G++ A   +   +G  G F+G+    +RIF
Sbjct: 33  AKTLVAPLDRIKILFQTSNPQFAQFAGSMGGLVRASKYIMAHDGPRGFFQGHSATLLRIF 92

Query: 81  PYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLS 140
           PY+A++F+ YE  +  +     T   E   +W+RL +G+L G  SV  TYPLDLVR RL+
Sbjct: 93  PYAAIKFIAYEQIRSVVI---PTWRHES--HWRRLLSGSLAGLCSVFVTYPLDLVRVRLA 147

Query: 141 IQT 143
             T
Sbjct: 148 YVT 150

 Score = 42.0 bits (97), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 51/135 (37%), Gaps = 28/135 (20%)

Query: 66  AGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFH----------------VDGTVGKEQL 109
           +  +RG     + + PY+ V F  ++ C+    H                 D TV    L
Sbjct: 186 SNFYRGYTPTVIGMIPYAGVSFFAHDLCQDIFRHPMLEPYSVLSPGGSSAYDRTV---PL 242

Query: 110 LNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVK 169
             W +L AG L G  S  A YP +++R RL +                    G+ E + K
Sbjct: 243 KTWAQLVAGGLAGMASQTAAYPFEIIRRRLQVSAITDPTRRHFV--------GINE-IAK 293

Query: 170 TFKEEGGIRGLYRGI 184
               EGG RG + G+
Sbjct: 294 IIYTEGGWRGFFVGL 308

 Score = 36.6 bits (83), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 37/76 (48%), Gaps = 3/76 (3%)

Query: 25  SRTVVSPFERVKILLQVQSSTSAYNHGI--INAVGQV-YKEEGVAGLFRGNGLNCVRIFP 81
           S+T   PFE ++  LQV + T         IN + ++ Y E G  G F G  +  +++ P
Sbjct: 258 SQTAAYPFEIIRRRLQVSAITDPTRRHFVGINEIAKIIYTEGGWRGFFVGLSIGYIKVTP 317

Query: 82  YSAVQFVVYEWCKKHI 97
             A  F +YE  K ++
Sbjct: 318 MVACSFFIYERTKWYL 333

>Kwal_23.3042
          Length = 542

 Score = 77.8 bits (190), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 86/193 (44%), Gaps = 36/193 (18%)

Query: 15  FIXXXXXXXXSRTVVSPFERVKILLQVQSSTSAY--------------------NHGIIN 54
           FI        SRT  +PF+R+K+ L  ++  S+                        ++ 
Sbjct: 228 FIAGGVSGVVSRTCTAPFDRIKVFLIARTDLSSTFLKSKDIILEKNPNADLSKIKSPLVK 287

Query: 55  AVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQR 114
           A   +Y++ G+   + GNGLN +++FP SA++F  +E  K+ +  ++G      L  +  
Sbjct: 288 AATTLYRQGGIRAFYVGNGLNAMKVFPESAIKFGSFELAKRLMAQLEGVQDTAGLSRFST 347

Query: 115 LSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKE- 173
             AG L G M+ L+ YP+D ++ R+     N                   +LL+ T K+ 
Sbjct: 348 YLAGGLGGVMAQLSVYPIDTLKYRVQCAPLNTESKGR-------------QLLISTAKDM 394

Query: 174 --EGGIRGLYRGI 184
             EGG+R  YRGI
Sbjct: 395 YKEGGLRIFYRGI 407

 Score = 49.7 bits (117), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 76/166 (45%), Gaps = 23/166 (13%)

Query: 29  VSPFERVKILLQVQ--SSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQ 86
           V P + +K  +Q    ++ S     +I+    +YKE G+   +RG  +  + IFPY+A+ 
Sbjct: 362 VYPIDTLKYRVQCAPLNTESKGRQLLISTAKDMYKEGGLRIFYRGITVGIMGIFPYAAMD 421

Query: 87  FVVYEWCKK-HIFHVDGTVGKEQ----LLNWQRLSAGALCGGMSVLATYPLDLVRTRLSI 141
              +   KK +I       G  +    + N   L  GA  G +   A YP++L+RTRL  
Sbjct: 422 LGTFSALKKWYIARQARLTGLPEDQVTMSNMFVLLMGAFSGTVGATAVYPVNLLRTRLQA 481

Query: 142 QTANXXXXXXXXXXDIAKP---PGVWELLVKTFKEEGGIRGLYRGI 184
           Q               A P    G  ++L+KT + E G +GL++G+
Sbjct: 482 QGT------------FAHPHRYNGFRDVLLKTVQRE-GYQGLFKGL 514

 Score = 33.5 bits (75), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 36/72 (50%), Gaps = 4/72 (5%)

Query: 27  TVVSPFERVKILLQVQSSTSAYNH---GIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYS 83
           T V P   ++  LQ Q  T A+ H   G  + + +  + EG  GLF+G   N  ++ P  
Sbjct: 467 TAVYPVNLLRTRLQAQG-TFAHPHRYNGFRDVLLKTVQREGYQGLFKGLVPNLAKVCPAV 525

Query: 84  AVQFVVYEWCKK 95
           ++ ++ YE  K+
Sbjct: 526 SISYLCYENLKR 537

>Scas_667.4
          Length = 308

 Score = 75.5 bits (184), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 59/194 (30%), Positives = 88/194 (45%), Gaps = 21/194 (10%)

Query: 1   MDLKQLAKQESSIA--FIXXXXXXXXSRTVVSPFERVKILLQ------VQSSTSAYNHGI 52
           M  K+  K+ES+ A  F+        ++T  SP ERVK+L+Q       Q S  +   GI
Sbjct: 1   MSSKEEVKKESNFAIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDSKYKGI 60

Query: 53  INAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNW 112
           I    +  K EG+   +RGN  N +R FP  A+ F      K  I  + G   +E    W
Sbjct: 61  IECFQRTAKTEGIIAFWRGNTANVIRYFPTQALNFAF----KDKIKAMFGFKKEEGYGKW 116

Query: 113 --QRLSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKT 170
               L++G   GG+S+L  Y LD  RTRL+    +             +  G+ ++  +T
Sbjct: 117 FAGNLASGGAAGGLSLLFVYSLDYARTRLAADAKSSKKGGSR------QYKGLIDVYKQT 170

Query: 171 FKEEGGIRGLYRGI 184
              + G+ GLYRG 
Sbjct: 171 LATD-GMAGLYRGF 183

 Score = 42.4 bits (98), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 68/157 (43%), Gaps = 24/157 (15%)

Query: 32  FERVKILLQVQSST---SAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFV 88
           + R ++    +SS    S    G+I+   Q    +G+AGL+RG   + V I  Y  + F 
Sbjct: 140 YARTRLAADAKSSKKGGSRQYKGLIDVYKQTLATDGMAGLYRGFLPSVVGIIVYRGLYFG 199

Query: 89  VYEWCKKHIF--HVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTANX 146
           +Y+  K  +    ++G+     LL W  ++ GA        A+YPLD VR R+ + +   
Sbjct: 200 LYDSLKPAVLTGSLEGSFLASFLLGWI-VTTGAST------ASYPLDTVRRRMMMTSGQA 252

Query: 147 XXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRG 183
                       K  G ++   K    E G+  L++G
Sbjct: 253 -----------VKYDGAFDCFRKVVAAE-GVSSLFKG 277

 Score = 29.6 bits (65), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 26/54 (48%)

Query: 25  SRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVR 78
           + T   P + V+  + + S  +    G  +   +V   EGV+ LF+G G N +R
Sbjct: 231 ASTASYPLDTVRRRMMMTSGQAVKYDGAFDCFRKVVAAEGVSSLFKGCGANILR 284

>YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 74.7 bits (182), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 60/193 (31%), Positives = 88/193 (45%), Gaps = 24/193 (12%)

Query: 2   DLKQLAKQESSIA--FIXXXXXXXXSRTVVSPFERVKILLQVQS------STSAYNHGII 53
           D KQ   QE++ A  F+        ++T  SP ERVKIL+Q Q       +      GI+
Sbjct: 4   DAKQ---QETNFAINFLMGGVSAAIAKTAASPIERVKILIQNQDEMIKQGTLDKKYSGIV 60

Query: 54  NAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNW- 112
           +   +  K+EG+   +RGN  N +R FP  A+ F      K  I  + G   +E    W 
Sbjct: 61  DCFKRTAKQEGLISFWRGNTANVIRYFPTQALNFAF----KDKIKLMFGFKKEEGYGKWF 116

Query: 113 -QRLSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTF 171
              L++G   G +S+L  Y LD  RTRL+    +             +  G+ ++  KT 
Sbjct: 117 AGNLASGGAAGALSLLFVYSLDFARTRLAADAKSSKKGGAR------QFNGLTDVYKKTL 170

Query: 172 KEEGGIRGLYRGI 184
           K + GI GLYRG 
Sbjct: 171 KSD-GIAGLYRGF 182

 Score = 44.7 bits (104), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 54/117 (46%), Gaps = 12/117 (10%)

Query: 32  FERVKILLQVQSSTSAYN---HGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFV 88
           F R ++    +SS        +G+ +   +  K +G+AGL+RG   + V I  Y  + F 
Sbjct: 139 FARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGIAGLYRGFMPSVVGIVVYRGLYFG 198

Query: 89  VYEWCKKHIF--HVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQT 143
           +++  K  +    +DG+     LL W   +  + C       +YPLD VR R+ + +
Sbjct: 199 MFDSLKPLVLTGSLDGSFLASFLLGWVVTTGASTC-------SYPLDTVRRRMMMTS 248

 Score = 32.0 bits (71), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 35/73 (47%), Gaps = 7/73 (9%)

Query: 25  SRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVR------ 78
           + T   P + V+  + + S  +   +G I+ + ++   EGV  LF+G G N +R      
Sbjct: 230 ASTCSYPLDTVRRRMMMTSGQAVKYNGAIDCLKKIVASEGVGSLFKGCGANILRSVAGAG 289

Query: 79  -IFPYSAVQFVVY 90
            I  Y  +Q +++
Sbjct: 290 VISMYDQLQMILF 302

>ADL049W [1692] [Homologous to ScYPR021C - SH]
           complement(598135..600873) [2739 bp, 912 aa]
          Length = 912

 Score = 75.5 bits (184), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 76/158 (48%), Gaps = 15/158 (9%)

Query: 29  VSPFERVKILLQVQSSTSA-YNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQF 87
            +P E VKI LQV+S   A      +NA+  V K  G+ GL+RG G   +R  P+SA+ F
Sbjct: 636 TNPLEIVKIRLQVKSDYVADAARNSVNAIS-VIKNLGLIGLYRGAGACLLRDIPFSAIYF 694

Query: 88  VVYEWCKKHIFHVD--GTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTAN 145
             Y   K ++F+ D   +  + +L  WQ L +G L G  +   T P D+++TRL I    
Sbjct: 695 PTYAHIKSNVFNFDPKDSDKRNKLNTWQLLVSGGLAGMPAAFLTTPFDVIKTRLQIDPKK 754

Query: 146 XXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRG 183
                           G+W+      KEE GI+  ++G
Sbjct: 755 GESVYN----------GIWDAARTILKEE-GIKSFFKG 781

 Score = 48.9 bits (115), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 58/116 (50%), Gaps = 6/116 (5%)

Query: 28  VVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQF 87
           VV P + VK  +Q Q   S Y + I + + ++  +EGV GL+ G G   + + P  A++ 
Sbjct: 541 VVYPIDMVKTRMQAQRDFSKYKNSI-DCLLKILSKEGVRGLYSGLGPQLIGVAPEKAIKL 599

Query: 88  VVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQT 143
            V +  +  +   DG +          + +GA  G   V+ T PL++V+ RL +++
Sbjct: 600 TVNDHMRATLAGRDGKLSLP-----CEIISGATAGACQVVFTNPLEIVKIRLQVKS 650

 Score = 37.7 bits (86), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 35/70 (50%), Gaps = 13/70 (18%)

Query: 115 LSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEE 174
            + G++ G +  +  YP+D+V+TR+  Q             D +K     + L+K   +E
Sbjct: 528 FTLGSVAGCIGAMVVYPIDMVKTRMQAQ------------RDFSKYKNSIDCLLKILSKE 575

Query: 175 GGIRGLYRGI 184
            G+RGLY G+
Sbjct: 576 -GVRGLYSGL 584

 Score = 37.4 bits (85), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 35/74 (47%), Gaps = 8/74 (10%)

Query: 28  VVSPFERVKILLQV--QSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAV 85
           + +PF+ +K  LQ+  +   S YN GI +A   + KEEG+   F+G     +R  P    
Sbjct: 737 LTTPFDVIKTRLQIDPKKGESVYN-GIWDAARTILKEEGIKSFFKGGPARVLRSSPQFGF 795

Query: 86  QFVVYEWCKKHIFH 99
               YE     IFH
Sbjct: 796 TLAAYE-----IFH 804

>CAGL0F04213g 419473..420393 highly similar to sp|P18239
           Saccharomyces cerevisiae YBL030c AAC2 ADP/ATP carrier
           protein, hypothetical start
          Length = 306

 Score = 73.9 bits (180), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 52/181 (28%), Positives = 85/181 (46%), Gaps = 19/181 (10%)

Query: 12  SIAFIXXXXXXXXSRTVVSPFERVKILLQVQSST---SAYNH---GIINAVGQVYKEEGV 65
           +I F+        ++T  SP ERVK+L+Q Q       + +H   GI++   +  ++EG+
Sbjct: 12  AIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDHRYKGIVDCFQRTARQEGI 71

Query: 66  AGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNW--QRLSAGALCGG 123
              +RGN  N +R FP  A+ F      K  I  + G   +E    W    L++G + GG
Sbjct: 72  ISFWRGNTANVIRYFPTQALNFAF----KDQIKAMFGFKKEEGYAKWFAGNLASGGIAGG 127

Query: 124 MSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRG 183
           +S++  Y LD  RTRL+    +             +  G+ ++  KT   + G+ GLYRG
Sbjct: 128 LSLMFVYSLDYARTRLAADAKSSKKGGER------QFNGLVDVYKKTIASD-GVAGLYRG 180

Query: 184 I 184
            
Sbjct: 181 F 181

 Score = 43.9 bits (102), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 68/157 (43%), Gaps = 24/157 (15%)

Query: 32  FERVKILLQVQSSTSAYN---HGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFV 88
           + R ++    +SS        +G+++   +    +GVAGL+RG   + + I  Y  + F 
Sbjct: 138 YARTRLAADAKSSKKGGERQFNGLVDVYKKTIASDGVAGLYRGFLPSVIGIVVYRGLYFG 197

Query: 89  VYEWCKKHIF--HVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTANX 146
           +Y+ CK  +    ++G+     LL W       +  G S  A+YPLD VR R+ + +   
Sbjct: 198 LYDSCKPLLLTGSLEGSFIASFLLGW------VVTTGAST-ASYPLDTVRRRMMMTSGQA 250

Query: 147 XXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRG 183
                       K  G  + L K    E G+  L++G
Sbjct: 251 -----------VKYKGAMDCLQKIVAAE-GVSSLFKG 275

 Score = 30.4 bits (67), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 14/54 (25%), Positives = 28/54 (51%)

Query: 25  SRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVR 78
           + T   P + V+  + + S  +    G ++ + ++   EGV+ LF+G G N +R
Sbjct: 229 ASTASYPLDTVRRRMMMTSGQAVKYKGAMDCLQKIVAAEGVSSLFKGCGANILR 282

>Scas_718.24
          Length = 337

 Score = 73.9 bits (180), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 85/182 (46%), Gaps = 21/182 (11%)

Query: 12  SIAFIXXXXXXXXSRTVVSPFERVKILLQVQS------STSAYNHGIINAVGQVYKEEGV 65
           +I F+        ++T  SP ERVK+L+Q Q+      +      GI++   +  ++EG+
Sbjct: 43  AIDFLMGGVSAAVAKTAASPIERVKLLIQNQNEMLKQGTLDTKYKGIVDCFRRTAQQEGI 102

Query: 66  AGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHI-FHVDGTVGKEQLLNW--QRLSAGALCG 122
              +RGN  N +R FP  A+ F   +  K    F  +   GK     W    L++G   G
Sbjct: 103 ISFWRGNTANVIRYFPTQALNFAFKDKIKLMFGFKKEDGYGK-----WFAGNLASGGAAG 157

Query: 123 GMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYR 182
           G+S+L  Y LD  RTRL+  + +             +  G+ ++  KT K + G+ GLYR
Sbjct: 158 GLSLLFVYSLDFARTRLAADSKSSKKGGSR------QFNGLIDVYKKTLKSD-GVAGLYR 210

Query: 183 GI 184
           G 
Sbjct: 211 GF 212

 Score = 44.7 bits (104), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 68/157 (43%), Gaps = 24/157 (15%)

Query: 32  FERVKILLQVQSST---SAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFV 88
           F R ++    +SS    S   +G+I+   +  K +GVAGL+RG   + V I  Y  + F 
Sbjct: 169 FARTRLAADSKSSKKGGSRQFNGLIDVYKKTLKSDGVAGLYRGFLPSVVGIIVYRGLYFG 228

Query: 89  VYEWCKKHIF--HVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTANX 146
           +Y+  K  +    ++G+     LL W   +  + C       +YPLD VR ++ + +   
Sbjct: 229 LYDSIKPVLLTGSLEGSFLASFLLGWVVTTGASTC-------SYPLDTVRRKMMMTSGQA 281

Query: 147 XXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRG 183
                       K  G ++   K    E G+  L++G
Sbjct: 282 -----------VKYKGAFDCFKKIVAAE-GVASLFKG 306

 Score = 30.0 bits (66), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 33/73 (45%), Gaps = 7/73 (9%)

Query: 25  SRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVR------ 78
           + T   P + V+  + + S  +    G  +   ++   EGVA LF+G G N +R      
Sbjct: 260 ASTCSYPLDTVRRKMMMTSGQAVKYKGAFDCFKKIVAAEGVASLFKGCGANILRGVAGAG 319

Query: 79  -IFPYSAVQFVVY 90
            I  Y  +Q +++
Sbjct: 320 VISMYDQLQMILF 332

>Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement
          Length = 513

 Score = 73.2 bits (178), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 85/183 (46%), Gaps = 36/183 (19%)

Query: 25  SRTVVSPFERVKILLQVQSSTSA--------------------YNHGIINAVGQVYKEEG 64
           SRT  +PF+R+K+ L  ++  S+                        +I A   +Y++ G
Sbjct: 209 SRTCTAPFDRIKVFLIARTDLSSTLLNSKDKVLMKNPNADISKIKSPLIKAATTLYRQGG 268

Query: 65  VAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGM 124
           +   + GNGLN +++FP SA++F  +E  K+ + H++G     +L  +    AG + G +
Sbjct: 269 IRAFYVGNGLNVIKVFPESAMKFGSFELAKQLMAHLEGVHHTSELSKFSTYIAGGMGGVV 328

Query: 125 SVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKE---EGGIRGLY 181
           +  + YP+D ++ R+     +                   ELL+ T ++   +GG++  Y
Sbjct: 329 AQFSVYPIDTLKYRVQCAPLDTALKGN-------------ELLISTARQMYRDGGLKLFY 375

Query: 182 RGI 184
           RG+
Sbjct: 376 RGV 378

 Score = 50.4 bits (119), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 44/166 (26%), Positives = 74/166 (44%), Gaps = 23/166 (13%)

Query: 29  VSPFERVKILLQVQSSTSAY--NHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQ 86
           V P + +K  +Q     +A   N  +I+   Q+Y++ G+   +RG  +  + IFPY+A+ 
Sbjct: 333 VYPIDTLKYRVQCAPLDTALKGNELLISTARQMYRDGGLKLFYRGVTVGVMGIFPYAALD 392

Query: 87  FVVYEWCKKHIFHVDG-----TVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSI 141
              +   KK             V +  + N+  L  GA  G +     YP++L+RTRL  
Sbjct: 393 LGTFSALKKWYIARQAKMTGVPVDQVTISNFIVLPMGAFSGTVGATVVYPINLLRTRLQA 452

Query: 142 QTANXXXXXXXXXXDIAKP---PGVWELLVKTFKEEGGIRGLYRGI 184
           Q               A P    G  ++L KT + E G +GL++G+
Sbjct: 453 QGT------------YAHPHTYTGFRDVLWKTVQRE-GYQGLFKGL 485

 Score = 34.7 bits (78), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 37/72 (51%), Gaps = 4/72 (5%)

Query: 27  TVVSPFERVKILLQVQSSTSAYNH---GIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYS 83
           TVV P   ++  LQ Q  T A+ H   G  + + +  + EG  GLF+G   N  ++ P  
Sbjct: 438 TVVYPINLLRTRLQAQG-TYAHPHTYTGFRDVLWKTVQREGYQGLFKGLVPNLAKVCPAV 496

Query: 84  AVQFVVYEWCKK 95
           ++ ++ YE  K+
Sbjct: 497 SISYLCYENFKR 508

>KLLA0C11363g complement(975442..976995) similar to sp|P48233
           Saccharomyces cerevisiae YNL083w singleton, start by
           similarity
          Length = 517

 Score = 72.8 bits (177), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 79/181 (43%), Gaps = 30/181 (16%)

Query: 25  SRTVVSPFERVKILLQVQSSTSAY--------------------NHGIINAVGQVYKEEG 64
           SRT  +PF+R+K+ L  ++  S+                        +I A   +Y++ G
Sbjct: 213 SRTCTAPFDRIKVFLIARTDLSSTLLNSKDTLLAKNPNADLSKIKSPLIKAATTLYRQGG 272

Query: 65  VAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGM 124
           +   + GNGLN V++FP SA++F  +E  K+ +  ++      +L       AG L G  
Sbjct: 273 LRAFYVGNGLNVVKVFPESAIKFGSFEMAKRIMARLENVKDTSELSRLSTYIAGGLGGVA 332

Query: 125 SVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
           +  + YP+D ++ R+     N             K   +     K   ++GGIR  YRG+
Sbjct: 333 AQFSVYPIDTLKYRIQCAPLNTNL----------KKSSILLQTAKEMYQQGGIRLFYRGV 382

Query: 185 Y 185
           +
Sbjct: 383 H 383

 Score = 44.7 bits (104), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 64/141 (45%), Gaps = 21/141 (14%)

Query: 52  IINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVY----EWCKKHIFHVDGTVGKE 107
           ++    ++Y++ G+   +RG  +  + IFPY+A+    +    +W  K      G    E
Sbjct: 362 LLQTAKEMYQQGGIRLFYRGVHIGVMGIFPYAALDLGTFSALKKWYIKKEAKKTGLPEDE 421

Query: 108 QLL-NWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKP---PGV 163
            ++ N   L  GA  G +     YP++L+RTRL  Q               A P    G 
Sbjct: 422 VIISNLIVLPMGAFSGTVGATLVYPINLLRTRLQAQGT------------YAHPHTYNGF 469

Query: 164 WELLVKTFKEEGGIRGLYRGI 184
            ++L KT + E G +GL++G+
Sbjct: 470 SDVLKKTIQRE-GYQGLFKGL 489

 Score = 35.0 bits (79), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 37/72 (51%), Gaps = 4/72 (5%)

Query: 27  TVVSPFERVKILLQVQSSTSAYNH---GIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYS 83
           T+V P   ++  LQ Q  T A+ H   G  + + +  + EG  GLF+G   N  ++ P  
Sbjct: 442 TLVYPINLLRTRLQAQG-TYAHPHTYNGFSDVLKKTIQREGYQGLFKGLVPNLAKVCPAV 500

Query: 84  AVQFVVYEWCKK 95
           ++ ++ YE  K+
Sbjct: 501 SISYLCYENLKR 512

>CAGL0J05522g complement(524930..526489) highly similar to sp|P48233
           Saccharomyces cerevisiae YNL083w, hypothetical start
          Length = 519

 Score = 72.8 bits (177), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 83/183 (45%), Gaps = 36/183 (19%)

Query: 25  SRTVVSPFERVKILLQVQSSTSA--------------------YNHGIINAVGQVYKEEG 64
           SRT  +PF+R+K+ L  ++  S+                        ++ A+  +Y++ G
Sbjct: 214 SRTCTAPFDRLKVFLIARTDLSSTLLNSTEDVLAKNPHAKPNKLRSPLVKAIISLYRQGG 273

Query: 65  VAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGM 124
           +   + GNGLN +++FP S+++F  +E  KK +  V+     + L       AG L G  
Sbjct: 274 IKSFYVGNGLNALKVFPESSIKFGSFEITKKLMTKVENCKDTKDLSKLSTFIAGGLAGVC 333

Query: 125 SVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKE---EGGIRGLY 181
           +  + YP+D ++ R+     N                   +L+++T KE   EGG++  Y
Sbjct: 334 AQFSVYPIDTLKFRMQCAPLNAELKGR-------------KLMIQTAKEMYTEGGLKLFY 380

Query: 182 RGI 184
           RG+
Sbjct: 381 RGV 383

 Score = 50.4 bits (119), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 52/194 (26%), Positives = 85/194 (43%), Gaps = 28/194 (14%)

Query: 2   DLKQLAKQESSIAFIXXXXXXXXSRTVVSPFERVKILLQVQSSTSAYNHG---IINAVGQ 58
           D K L+K  +   FI        ++  V P + +K  +Q  +  +A   G   +I    +
Sbjct: 314 DTKDLSKLST---FIAGGLAGVCAQFSVYPIDTLKFRMQC-APLNAELKGRKLMIQTAKE 369

Query: 59  VYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKK-HIFHVDGTVGKE----QLLNWQ 113
           +Y E G+   +RG  +  + IFPY+A+    +   KK +I      + K+    +L N  
Sbjct: 370 MYTEGGLKLFYRGVTVGVLGIFPYAALDLGTFSMLKKWYISSKAKKLNKKEEDVELSNLV 429

Query: 114 RLSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKP---PGVWELLVKT 170
            L  GA  G       YP++L+RTRL  Q               A P    G  ++L+KT
Sbjct: 430 VLPMGAFSGTFGATVVYPINLLRTRLQAQGT------------FAHPYRYDGFRDVLLKT 477

Query: 171 FKEEGGIRGLYRGI 184
            + E G  GL++G+
Sbjct: 478 IQRE-GYPGLFKGL 490

 Score = 32.0 bits (71), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 35/71 (49%), Gaps = 2/71 (2%)

Query: 27  TVVSPFERVKILLQVQSS-TSAYNH-GIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSA 84
           TVV P   ++  LQ Q +    Y + G  + + +  + EG  GLF+G      ++ P  +
Sbjct: 443 TVVYPINLLRTRLQAQGTFAHPYRYDGFRDVLLKTIQREGYPGLFKGLVPTLAKVCPAVS 502

Query: 85  VQFVVYEWCKK 95
           + ++ YE  KK
Sbjct: 503 ISYLCYENLKK 513

>YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1638 bp, 545 aa]
          Length = 545

 Score = 71.6 bits (174), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 46/183 (25%), Positives = 83/183 (45%), Gaps = 36/183 (19%)

Query: 25  SRTVVSPFERVKILLQVQSSTSAY--------------------NHGIINAVGQVYKEEG 64
           SRT  +PF+R+K+ L  ++  S+                     +  +  AV  +Y++ G
Sbjct: 241 SRTCTAPFDRLKVFLIARTDLSSILLNSKTDLLAKNPNADINKISSPLAKAVKSLYRQGG 300

Query: 65  VAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGM 124
           +   + GNGLN +++FP S+++F  +E  KK +  ++G    + L  +    AG L G  
Sbjct: 301 IKAFYVGNGLNVIKVFPESSIKFGSFEVTKKIMTKLEGCRDTKDLSKFSTYIAGGLAGMA 360

Query: 125 SVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKE---EGGIRGLY 181
           +  + YP+D ++ R+     +                    LL +T K+   EGG+R  Y
Sbjct: 361 AQFSVYPIDTLKFRVQCAPLDTKLKGN-------------NLLFQTAKDMFREGGLRLFY 407

Query: 182 RGI 184
           RG+
Sbjct: 408 RGV 410

 Score = 49.3 bits (116), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 84/193 (43%), Gaps = 26/193 (13%)

Query: 2   DLKQLAKQESSIAFIXXXXXXXXSRTVVSPFERVKILLQVQSSTSAY--NHGIINAVGQV 59
           D K L+K  + IA          ++  V P + +K  +Q     +    N+ +      +
Sbjct: 341 DTKDLSKFSTYIA---GGLAGMAAQFSVYPIDTLKFRVQCAPLDTKLKGNNLLFQTAKDM 397

Query: 60  YKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKK-HIFHVDGTVGKEQ----LLNWQR 114
           ++E G+   +RG  +  V IFPY+A+    +   KK +I     T+   Q    L N   
Sbjct: 398 FREGGLRLFYRGVTVGIVGIFPYAALDLGTFSALKKWYIAKQAKTLNLPQDQVTLSNLVV 457

Query: 115 LSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKP---PGVWELLVKTF 171
           L  GA  G +     YP++L+RTRL  Q               A P    G  ++L+KT 
Sbjct: 458 LPMGAFSGTVGASVVYPINLLRTRLQAQGT------------YAHPYVYNGFKDVLLKTL 505

Query: 172 KEEGGIRGLYRGI 184
           + E G +GL++G+
Sbjct: 506 ERE-GYQGLFKGL 517

 Score = 31.6 bits (70), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 37/74 (50%), Gaps = 4/74 (5%)

Query: 27  TVVSPFERVKILLQVQSSTS---AYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYS 83
           +VV P   ++  LQ Q + +    YN G  + + +  + EG  GLF+G      ++ P  
Sbjct: 470 SVVYPINLLRTRLQAQGTYAHPYVYN-GFKDVLLKTLEREGYQGLFKGLVPTLAKVCPAV 528

Query: 84  AVQFVVYEWCKKHI 97
           ++ ++ YE  KK +
Sbjct: 529 SISYLCYENLKKFM 542

>YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [957 bp, 318 aa]
          Length = 318

 Score = 70.9 bits (172), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 53/180 (29%), Positives = 81/180 (45%), Gaps = 19/180 (10%)

Query: 13  IAFIXXXXXXXXSRTVVSPFERVKILLQVQS------STSAYNHGIINAVGQVYKEEGVA 66
           I F+        ++T  SP ERVK+L+Q Q       +      GI++   +   +EGV 
Sbjct: 25  IDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMLKQGTLDRKYAGILDCFKRTATQEGVI 84

Query: 67  GLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNW--QRLSAGALCGGM 124
             +RGN  N +R FP  A+ F      K  I  + G   +E    W    L++G   G +
Sbjct: 85  SFWRGNTANVIRYFPTQALNFAF----KDKIKAMFGFKKEEGYAKWFAGNLASGGAAGAL 140

Query: 125 SVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
           S+L  Y LD  RTRL+  + +             +  G+ ++  KT K + G+ GLYRG 
Sbjct: 141 SLLFVYSLDYARTRLAADSKSSKKGGAR------QFNGLIDVYKKTLKSD-GVAGLYRGF 193

 Score = 45.4 bits (106), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 61/136 (44%), Gaps = 21/136 (15%)

Query: 50  HGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIF--HVDGTVGKE 107
           +G+I+   +  K +GVAGL+RG   + V I  Y  + F +Y+  K  +    ++G+    
Sbjct: 171 NGLIDVYKKTLKSDGVAGLYRGFLPSVVGIVVYRGLYFGMYDSLKPLLLTGSLEGSFLAS 230

Query: 108 QLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELL 167
            LL W   +  + C       +YPLD VR R+ + +               K  G ++ L
Sbjct: 231 FLLGWVVTTGASTC-------SYPLDTVRRRMMMTSGQA-----------VKYDGAFDCL 272

Query: 168 VKTFKEEGGIRGLYRG 183
            K    E G+  L++G
Sbjct: 273 RKIVAAE-GVGSLFKG 287

 Score = 29.3 bits (64), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/73 (23%), Positives = 33/73 (45%), Gaps = 7/73 (9%)

Query: 25  SRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVR------ 78
           + T   P + V+  + + S  +    G  + + ++   EGV  LF+G G N +R      
Sbjct: 241 ASTCSYPLDTVRRRMMMTSGQAVKYDGAFDCLRKIVAAEGVGSLFKGCGANILRGVAGAG 300

Query: 79  -IFPYSAVQFVVY 90
            I  Y  +Q +++
Sbjct: 301 VISMYDQLQMILF 313

>Kwal_27.12481
          Length = 304

 Score = 70.9 bits (172), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 56/190 (29%), Positives = 88/190 (46%), Gaps = 25/190 (13%)

Query: 7   AKQESSIA--FIXXXXXXXXSRTVVSPFERVKILLQVQSSTSAYNHGIIN----AVGQVY 60
           +K++S+ A  F+        S+T  +P ERVK+L+Q Q        G ++     +G+ +
Sbjct: 4   SKKQSNFAVDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEM--IKQGSLDRRYTGIGECF 61

Query: 61  K----EEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNW--QR 114
           K     EG+A  +RGN  N +R FP  A+ F      K  I  + G   +E    W    
Sbjct: 62  KRTAANEGIASFWRGNTANVIRYFPTQALNFAF----KDKIKAMFGFKKEEGYAKWFAGN 117

Query: 115 LSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEE 174
           L++G   GG+S++  Y LD  RTRL+  +               +  G+ ++  KT   +
Sbjct: 118 LASGGAAGGLSLMFVYSLDYARTRLAADSKGAKKGGER------QFNGLVDVYKKTLASD 171

Query: 175 GGIRGLYRGI 184
            GI GLYRG 
Sbjct: 172 -GIAGLYRGF 180

 Score = 40.8 bits (94), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 61/136 (44%), Gaps = 21/136 (15%)

Query: 50  HGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIF--HVDGTVGKE 107
           +G+++   +    +G+AGL+RG   + V I  Y  + F  Y+  K  +    ++G+    
Sbjct: 158 NGLVDVYKKTLASDGIAGLYRGFLPSVVGIVVYRGLYFGGYDSLKPLLLTGSLEGSFLAS 217

Query: 108 QLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELL 167
            LL W      A+  G S  A+YPLD VR R+ + +               K  G ++  
Sbjct: 218 FLLGW------AVTTGAST-ASYPLDTVRRRMMMTSGQA-----------VKYNGAFDAF 259

Query: 168 VKTFKEEGGIRGLYRG 183
            K    E GI+ L++G
Sbjct: 260 RKIVAAE-GIKSLFKG 274

 Score = 30.0 bits (66), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 14/54 (25%), Positives = 27/54 (50%)

Query: 25  SRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVR 78
           + T   P + V+  + + S  +   +G  +A  ++   EG+  LF+G G N +R
Sbjct: 228 ASTASYPLDTVRRRMMMTSGQAVKYNGAFDAFRKIVAAEGIKSLFKGCGANILR 281

>Scas_602.8
          Length = 885

 Score = 71.6 bits (174), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 52/167 (31%), Positives = 79/167 (47%), Gaps = 34/167 (20%)

Query: 30  SPFERVKILLQVQSSTSAYNHGIIN----AVGQVYKEEGVAGLFRGNGLNCVRIFPYSAV 85
           +P E VKI LQV+S    Y + +I        Q+ KE  + GL++G G   +R  P+SA+
Sbjct: 611 NPLEIVKIRLQVKSE---YTNAMIPKSQLTAFQIIKELKLIGLYKGVGACLLRDVPFSAI 667

Query: 86  QFVVYEWCKKHIFHVD--GTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQT 143
            F  Y   KK++F  D      +++L  W+ L+AGAL G  +   T P D+++TRL I+ 
Sbjct: 668 YFPTYAHLKKNVFQFDPNDKDKRDRLKTWELLTAGALAGVPAAFLTTPFDVIKTRLQIE- 726

Query: 144 ANXXXXXXXXXXDIAKPPGVWEL-------LVKTFKEEGGIRGLYRG 183
                            PGV E         V+T  +E   R  ++G
Sbjct: 727 -----------------PGVGETRYTGILHAVRTILKEESFRSFFKG 756

 Score = 56.6 bits (135), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 33/119 (27%), Positives = 64/119 (53%), Gaps = 10/119 (8%)

Query: 27  TVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQ 86
           T+V P + +K  +Q Q S + Y + I + + +++ +EG+ GL+ G G   + + P  A++
Sbjct: 514 TLVYPIDFIKTRMQAQRSLTKYKNSI-DCLVKIFGKEGIRGLYSGLGPQLIGVAPEKAIK 572

Query: 87  FVVYEWCKKHIFHVDGT--VGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQT 143
             V ++ +K +    G   +G E L       +GA  G   V+ T PL++V+ RL +++
Sbjct: 573 LTVNDFMRKSLVDKKGNLQLGAEVL-------SGATAGACQVVFTNPLEIVKIRLQVKS 624

 Score = 37.4 bits (85), Expect = 0.005,   Method: Composition-based stats.
 Identities = 22/70 (31%), Positives = 34/70 (48%), Gaps = 13/70 (18%)

Query: 115 LSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEE 174
            S G++ G +     YP+D ++TR+  Q +            + K     + LVK F +E
Sbjct: 502 FSLGSVAGCIGATLVYPIDFIKTRMQAQRS------------LTKYKNSIDCLVKIFGKE 549

Query: 175 GGIRGLYRGI 184
            GIRGLY G+
Sbjct: 550 -GIRGLYSGL 558

 Score = 36.2 bits (82), Expect = 0.013,   Method: Composition-based stats.
 Identities = 19/68 (27%), Positives = 31/68 (45%), Gaps = 1/68 (1%)

Query: 28  VVSPFERVKILLQVQSSTSAYNH-GIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQ 86
           + +PF+ +K  LQ++       + GI++AV  + KEE     F+G     +R  P     
Sbjct: 712 LTTPFDVIKTRLQIEPGVGETRYTGILHAVRTILKEESFRSFFKGGAARVMRSSPQFGFT 771

Query: 87  FVVYEWCK 94
              YE  K
Sbjct: 772 LAAYELFK 779

>AER419W [2919] [Homologous to ScYNL083W - SH]
           complement(1442595..1444076) [1482 bp, 493 aa]
          Length = 493

 Score = 71.6 bits (174), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 85/183 (46%), Gaps = 36/183 (19%)

Query: 25  SRTVVSPFERVKILLQVQSSTSA---------YNHG-----------IINAVGQVYKEEG 64
           SRT  +PF+R+K+ L  ++  S+          +H            ++ A   +Y++ G
Sbjct: 189 SRTCTAPFDRIKVFLIARTDLSSPLLHTPEQLLHHNPRADPAKIRSPLVKAATSLYRQGG 248

Query: 65  VAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGM 124
           +   + GNGLN +++FP SA++F  +E  K+ +  ++G     +L       AG L G M
Sbjct: 249 LRAFYLGNGLNVIKVFPESAMKFGSFELAKRVLAGLEGCGETGELSRLSTYVAGGLGGIM 308

Query: 125 SVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKE---EGGIRGLY 181
           +  + YP+D ++ R+     +                    LL+KT K+   EGG+R  Y
Sbjct: 309 AQFSVYPIDTLKFRIQCAPLDTRCRG-------------LPLLIKTAKDMYREGGLRLFY 355

Query: 182 RGI 184
           RG+
Sbjct: 356 RGL 358

 Score = 48.5 bits (114), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 64/141 (45%), Gaps = 21/141 (14%)

Query: 52  IINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKK-HIFHVDGTVGKEQ-- 108
           +I     +Y+E G+   +RG G+  + +FPY+A+    +   K+ +I      +G  +  
Sbjct: 338 LIKTAKDMYREGGLRLFYRGLGVGILGVFPYAALDLGTFSALKRWYITRRANALGISENE 397

Query: 109 --LLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKP---PGV 163
             + N   L  GA  G +     YP++L+RTRL  Q               A P    G 
Sbjct: 398 VVMSNLVVLPMGAFSGTVGATVVYPINLLRTRLQAQGT------------YAHPHRYDGF 445

Query: 164 WELLVKTFKEEGGIRGLYRGI 184
            ++  KT + E G+ GLY+G+
Sbjct: 446 QDVFRKTVQRE-GLPGLYKGL 465

 Score = 34.3 bits (77), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 37/74 (50%), Gaps = 4/74 (5%)

Query: 27  TVVSPFERVKILLQVQSSTSAYNH---GIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYS 83
           TVV P   ++  LQ Q  T A+ H   G  +   +  + EG+ GL++G      ++ P  
Sbjct: 418 TVVYPINLLRTRLQAQG-TYAHPHRYDGFQDVFRKTVQREGLPGLYKGLVPTLAKVCPAV 476

Query: 84  AVQFVVYEWCKKHI 97
           A+ ++ YE  K+ +
Sbjct: 477 AISYLCYENLKRAM 490

>AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W
           (AAC3) - SH] complement(978781..979698) [918 bp, 305 aa]
          Length = 305

 Score = 70.5 bits (171), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 55/183 (30%), Positives = 80/183 (43%), Gaps = 24/183 (13%)

Query: 13  IAFIXXXXXXXXSRTVVSPFERVKILLQVQS------STSAYNHGIINAVGQVYKEEGVA 66
           I F+        S+T  +P ERVK+L+Q Q       S     +GI++   +    EGV 
Sbjct: 11  INFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKQGSLDRRYNGIVDCFKRTAASEGVI 70

Query: 67  GLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIF---HVDGTVGKEQLLNW--QRLSAGALC 121
             +RGN  N +R FP  A+ F   +  K        VDG         W    L++G   
Sbjct: 71  SFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFRKEVDGYA------KWFAGNLASGGAA 124

Query: 122 GGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLY 181
           GG+S+L  Y LD  RTRL+  + +             +  G+ ++  KT   + GI GLY
Sbjct: 125 GGLSLLFVYSLDYARTRLAADSKSAKKGGER------QFNGLVDVYKKTLASD-GIAGLY 177

Query: 182 RGI 184
           RG 
Sbjct: 178 RGF 180

 Score = 40.8 bits (94), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 62/136 (45%), Gaps = 21/136 (15%)

Query: 50  HGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIF--HVDGTVGKE 107
           +G+++   +    +G+AGL+RG   + V I  Y  + F +Y+  K  +   +++ +    
Sbjct: 158 NGLVDVYKKTLASDGIAGLYRGFLPSVVGIVVYRGLYFGMYDSLKPLLLTGNLESSFIAS 217

Query: 108 QLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELL 167
            LL W      A+  G S  A+YPLD VR R+ + +               K  G ++  
Sbjct: 218 FLLGW------AVTTGAST-ASYPLDTVRRRMMMTSGQA-----------VKYDGAFDAF 259

Query: 168 VKTFKEEGGIRGLYRG 183
            K    E G++ L++G
Sbjct: 260 RKIVAAE-GVKSLFKG 274

 Score = 30.4 bits (67), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 39/90 (43%), Gaps = 9/90 (10%)

Query: 10  ESSI--AFIXXXXXXXXSRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAG 67
           ESS   +F+        + T   P + V+  + + S  +    G  +A  ++   EGV  
Sbjct: 211 ESSFIASFLLGWAVTTGASTASYPLDTVRRRMMMTSGQAVKYDGAFDAFRKIVAAEGVKS 270

Query: 68  LFRGNGLNCVR-------IFPYSAVQFVVY 90
           LF+G G N +R       I  Y  +Q V++
Sbjct: 271 LFKGCGANILRGVAGAGVISLYDQLQLVLF 300

>CAGL0F07711g complement(751794..752900) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, hypothetical start
          Length = 368

 Score = 70.1 bits (170), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 45/126 (35%), Positives = 66/126 (52%), Gaps = 8/126 (6%)

Query: 25  SRTVVSPFERVKILLQVQSS------TSAYNH-GIINAVGQVYKEEGVAGLFRGNGLNCV 77
           S  V  P E +K  LQ+Q         S YN+  + NA+  +Y+ EGVA LF G      
Sbjct: 162 SSFVYVPSEVLKTRLQLQGCYNNPHFNSGYNYKSLRNAIATIYRTEGVAALFFGYKATLA 221

Query: 78  RIFPYSAVQFVVYEWCKKHIFHVDG-TVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVR 136
           R  P+SA+QF  YE  ++  F ++G  + K  L     +  GA  GG++ + T PLD+V+
Sbjct: 222 RDLPFSALQFAFYEKFRQWAFLLEGKDIYKHDLSISNEIVTGACAGGLAGILTTPLDVVK 281

Query: 137 TRLSIQ 142
           TR+  Q
Sbjct: 282 TRVQTQ 287

 Score = 38.5 bits (88), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 56/120 (46%), Gaps = 13/120 (10%)

Query: 27  TVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVA-GLFRGNGLNCVRIFPYSAV 85
           + +   + VK   Q   +   Y H ++ A   ++ EEG   GL+ G     +  FP +A+
Sbjct: 69  SAMHSLDTVKTRQQGAPNVHKYKH-MLQAYRTMFIEEGFRRGLYGGYCAAMLGSFPSAAI 127

Query: 86  QFVVYEWCKKHI---FHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQ 142
            F  YE+ K+ +   +H++ T        +  L+AG L    S     P ++++TRL +Q
Sbjct: 128 FFSTYEFTKRTMINDYHLNDT--------FSHLTAGFLGDFFSSFVYVPSEVLKTRLQLQ 179

>YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [2709 bp, 902 aa]
          Length = 902

 Score = 70.1 bits (170), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 42/115 (36%), Positives = 60/115 (52%), Gaps = 3/115 (2%)

Query: 30  SPFERVKILLQVQSSTSAYNHGIINAVG-QVYKEEGVAGLFRGNGLNCVRIFPYSAVQFV 88
           +P E VKI LQVQS     N    N    Q+ K+ G+ GL+ G     +R  P+SA+ F 
Sbjct: 643 NPLEIVKIRLQVQSDYVGENIQQANETATQIVKKLGLRGLYNGVAACLMRDVPFSAIYFP 702

Query: 89  VYEWCKKHIFHVD--GTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSI 141
            Y   KK +F  D      + +L  W+ L+AGA+ G  +   T P D+++TRL I
Sbjct: 703 TYAHLKKDLFDFDPNDKTKRNRLKTWELLTAGAIAGMPAAFLTTPFDVIKTRLQI 757

 Score = 58.2 bits (139), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 41/158 (25%), Positives = 76/158 (48%), Gaps = 17/158 (10%)

Query: 27  TVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQ 86
           TVV P + +K  +Q Q S + Y + I + + ++   EG+ GL+ G G   + + P  A++
Sbjct: 546 TVVYPIDFIKTRMQAQRSLAQYKNSI-DCLLKIISREGIKGLYSGLGPQLIGVAPEKAIK 604

Query: 87  FVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTANX 146
             V ++ +  +   +G     +L  +  + +GA  G   V+ T PL++V+ RL +Q+   
Sbjct: 605 LTVNDFMRNRLTDKNG-----KLSLFPEIISGASAGACQVIFTNPLEIVKIRLQVQS--- 656

Query: 147 XXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
                    +I +       +VK      G+RGLY G+
Sbjct: 657 ----DYVGENIQQANETATQIVKKL----GLRGLYNGV 686

 Score = 38.1 bits (87), Expect = 0.002,   Method: Composition-based stats.
 Identities = 22/72 (30%), Positives = 34/72 (47%), Gaps = 3/72 (4%)

Query: 28  VVSPFERVKILLQV--QSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAV 85
           + +PF+ +K  LQ+  +   + YN GI +A+  + KEE     F+G G   +R  P    
Sbjct: 744 LTTPFDVIKTRLQIDPRKGETKYN-GIFHAIRTILKEESFRSFFKGGGARVLRSSPQFGF 802

Query: 86  QFVVYEWCKKHI 97
               YE  K  I
Sbjct: 803 TLAAYELFKGFI 814

 Score = 33.1 bits (74), Expect = 0.11,   Method: Composition-based stats.
 Identities = 19/70 (27%), Positives = 33/70 (47%), Gaps = 13/70 (18%)

Query: 115 LSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEE 174
            S G++ G +     YP+D ++TR+  Q +            +A+     + L+K    E
Sbjct: 534 FSLGSIAGCIGATVVYPIDFIKTRMQAQRS------------LAQYKNSIDCLLKIISRE 581

Query: 175 GGIRGLYRGI 184
            GI+GLY G+
Sbjct: 582 -GIKGLYSGL 590

>AAR036W [222] [Homologous to ScYGR096W - SH]
           complement(406887..407840) [954 bp, 317 aa]
          Length = 317

 Score = 68.9 bits (167), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 44/117 (37%), Positives = 61/117 (52%), Gaps = 10/117 (8%)

Query: 25  SRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSA 84
           +R+V +P + VKI  Q+Q ++    HGI++    V +EEGV  L++GN         Y +
Sbjct: 38  ARSVTAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGS 97

Query: 85  VQFVVYEWCKKHIFHVDGTVGKEQLLNWQ--RLSAGALCGGMSVLATYPLDLVRTRL 139
           +QF  Y W          T      L  Q   L+ GAL G +S L TYPLDL+RTRL
Sbjct: 98  LQFGTYAWLN--------TAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRL 146

 Score = 39.3 bits (90), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 52/136 (38%), Gaps = 27/136 (19%)

Query: 59  VYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQL-LNWQRLSA 117
           ++  EG AG FRG           + + F +YE C         T+  +   L W   +A
Sbjct: 164 IWDTEGPAGFFRGGAWAIAATTLTTGLIFGIYETC---------TIAADTYGLPWLAAAA 214

Query: 118 GALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWE---------LLV 168
               G +S  A +PLD VR RL I  A              + PG +          L V
Sbjct: 215 SPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPF-------FTRDPGAYSALRGTRFLGLAV 267

Query: 169 KTFKEEGGIRGLYRGI 184
              + E GI  LY+G+
Sbjct: 268 HMVRAE-GIASLYKGL 282

>YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [930 bp, 309 aa]
          Length = 309

 Score = 68.6 bits (166), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 79/186 (42%), Gaps = 14/186 (7%)

Query: 5   QLAKQESSIAFIXXXXXXXXSRTVVSPFERVKILLQ------VQSSTSAYNHGIINAVGQ 58
           Q  +    + F+        ++T  +P ERVK+L+Q       Q S      GI++   +
Sbjct: 7   QTQQSHFGVDFLMGGVSAAIAKTGAAPIERVKLLMQNQEEMLKQGSLDTRYKGILDCFKR 66

Query: 59  VYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAG 118
               EG+   +RGN  N +R FP  A+ F   +  K  + +     G  +       S G
Sbjct: 67  TATHEGIVSFWRGNTANVLRYFPTQALNFAFKDKIKSLLSYDRERDGYAKWFAGNLFSGG 126

Query: 119 ALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIR 178
           A  GG+S+L  Y LD  RTRL+                  +  G+ ++  KT K + G+ 
Sbjct: 127 A-AGGLSLLFVYSLDYARTRLAADARGSKSTSQR------QFNGLLDVYKKTLKTD-GLL 178

Query: 179 GLYRGI 184
           GLYRG 
Sbjct: 179 GLYRGF 184

 Score = 37.0 bits (84), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 65/144 (45%), Gaps = 21/144 (14%)

Query: 42  QSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIF--H 99
           +S++    +G+++   +  K +G+ GL+RG   + + I  Y  + F +Y+  K  +    
Sbjct: 154 KSTSQRQFNGLLDVYKKTLKTDGLLGLYRGFVPSVLGIIVYRGLYFGLYDSFKPVLLTGA 213

Query: 100 VDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAK 159
           ++G+     LL W       +  G S  A+YPLD VR R+ + +               K
Sbjct: 214 LEGSFVASFLLGW------VITMGAST-ASYPLDTVRRRMMMTSGQTI-----------K 255

Query: 160 PPGVWELLVKTFKEEGGIRGLYRG 183
             G  + L K  ++EG    L++G
Sbjct: 256 YDGALDCLRKIVQKEGAY-SLFKG 278

 Score = 28.1 bits (61), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 16/73 (21%), Positives = 34/73 (46%), Gaps = 7/73 (9%)

Query: 25  SRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVR------ 78
           + T   P + V+  + + S  +    G ++ + ++ ++EG   LF+G G N  R      
Sbjct: 232 ASTASYPLDTVRRRMMMTSGQTIKYDGALDCLRKIVQKEGAYSLFKGCGANIFRGVAAAG 291

Query: 79  -IFPYSAVQFVVY 90
            I  Y  +Q +++
Sbjct: 292 VISLYDQLQLIMF 304

>Scas_578.3*
          Length = 524

 Score = 68.9 bits (167), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 84/191 (43%), Gaps = 34/191 (17%)

Query: 15  FIXXXXXXXXSRTVVSPFERVKILLQVQSSTSA------------------YNHGIINAV 56
           FI        SRT  +P +R+K+ L  ++  S+                      II A+
Sbjct: 212 FIAGGLSGVISRTCTAPLDRIKVFLIARTDLSSTLLNPKMHLRIQGLNLAKIRSPIIKAI 271

Query: 57  GQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLS 116
             +Y++ G+   + GNGL+  +I P S+++F  +E  K+ + ++ G      L   Q   
Sbjct: 272 RSLYRQGGLRAFYVGNGLSVFKICPESSIKFGTFELAKRLMANLSGDKLVNDLSKLQTYV 331

Query: 117 AGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKE--- 173
           AG + G M+ ++ YP+D ++ R  IQ A                     LL+ T KE   
Sbjct: 332 AGGIAGVMAQISIYPIDTLKFR--IQCAPLEGNLKGNA-----------LLISTAKEMYK 378

Query: 174 EGGIRGLYRGI 184
           EGGIR  YRG+
Sbjct: 379 EGGIRVFYRGV 389

 Score = 52.4 bits (124), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 69/144 (47%), Gaps = 21/144 (14%)

Query: 49  NHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKK-HIFHVDGTVG-- 105
           N  +I+   ++YKE G+   +RG  L  + IFPY+A+    +   KK +I      +   
Sbjct: 366 NALLISTAKEMYKEGGIRVFYRGVLLGALGIFPYAALDLGTFSALKKWYIKRQSKKLNIP 425

Query: 106 -KEQLLNWQR-LSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKP--- 160
            K+ +L++   L  GA  G +   A YP++L+RTRL  Q               A P   
Sbjct: 426 EKDVMLSYLLVLPMGAFSGTVGATAVYPINLLRTRLQAQGT------------YAHPYTY 473

Query: 161 PGVWELLVKTFKEEGGIRGLYRGI 184
            G  ++ ++T K E G+ G Y+G+
Sbjct: 474 TGFRDVFMQTLKRE-GVPGFYKGL 496

 Score = 31.6 bits (70), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 33/73 (45%), Gaps = 8/73 (10%)

Query: 27  TVVSPFERVKILLQVQSSTSAYNH-----GIINAVGQVYKEEGVAGLFRGNGLNCVRIFP 81
           T V P   ++  LQ Q +   Y H     G  +   Q  K EGV G ++G     V++ P
Sbjct: 449 TAVYPINLLRTRLQAQGT---YAHPYTYTGFRDVFMQTLKREGVPGFYKGLVPTLVKVCP 505

Query: 82  YSAVQFVVYEWCK 94
             ++ ++ YE  K
Sbjct: 506 AVSIGYLCYEKFK 518

>CAGL0K02365g 212702..215461 highly similar to tr|Q12482
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 919

 Score = 68.2 bits (165), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 44/116 (37%), Positives = 64/116 (55%), Gaps = 5/116 (4%)

Query: 30  SPFERVKILLQVQSSTSAYN--HGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQF 87
           +P E VKI LQV+    A N  +  + A+ Q+ K  G+ GL++G     +R  P+SA+ F
Sbjct: 656 NPLEIVKIRLQVKGEYVAENAENAKLTAL-QIIKRLGLPGLYKGAAACLLRDVPFSAIYF 714

Query: 88  VVYEWCKKHIFHVD-GTVGKEQLLN-WQRLSAGALCGGMSVLATYPLDLVRTRLSI 141
             Y   K+ +F+ D     K   LN W+ LSAGAL G  +   T P D+++TRL I
Sbjct: 715 PTYAHLKRDLFNFDPNDKNKRSRLNTWELLSAGALAGMPAAYLTTPFDVIKTRLQI 770

 Score = 54.7 bits (130), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 33/116 (28%), Positives = 62/116 (53%), Gaps = 6/116 (5%)

Query: 27  TVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQ 86
           T+V P + VK  +Q Q S S Y + I +   ++   EG+ G++ G G   + + P  A++
Sbjct: 559 TIVYPIDFVKTRMQAQRSLSQYKNSI-DCFLKILSREGIRGVYSGLGPQLIGVAPEKAIK 617

Query: 87  FVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQ 142
             V ++ +  +   +G +G   LL+   + +GA  G   V+ T PL++V+ RL ++
Sbjct: 618 LTVNDYMRNKLKDKNGKLG---LLS--EIISGASAGACQVIFTNPLEIVKIRLQVK 668

 Score = 32.7 bits (73), Expect = 0.16,   Method: Composition-based stats.
 Identities = 20/74 (27%), Positives = 33/74 (44%), Gaps = 8/74 (10%)

Query: 28  VVSPFERVKILLQV--QSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAV 85
           + +PF+ +K  LQ+  +   + Y  GII+A   + +EE     F+G     +R  P    
Sbjct: 757 LTTPFDVIKTRLQIDPKKGETIYK-GIIHAARTILREESFKSFFKGGAARVLRSSPQFGF 815

Query: 86  QFVVYEWCKKHIFH 99
               YE     +FH
Sbjct: 816 TLAAYE-----LFH 824

 Score = 30.8 bits (68), Expect = 0.70,   Method: Composition-based stats.
 Identities = 18/70 (25%), Positives = 32/70 (45%), Gaps = 13/70 (18%)

Query: 115 LSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEE 174
            S G++ G +     YP+D V+TR+  Q +            +++     +  +K    E
Sbjct: 547 FSLGSVAGCIGATIVYPIDFVKTRMQAQRS------------LSQYKNSIDCFLKILSRE 594

Query: 175 GGIRGLYRGI 184
            GIRG+Y G+
Sbjct: 595 -GIRGVYSGL 603

>Sklu_2359.6 YPR021C, Contig c2359 14617-17325
          Length = 902

 Score = 66.2 bits (160), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 42/115 (36%), Positives = 62/115 (53%), Gaps = 4/115 (3%)

Query: 30  SPFERVKILLQVQSSTSA-YNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFV 88
           +P E VKI LQV+S  +       + A+G V K+ G+ GL++G     +R  P+SA+ F 
Sbjct: 631 NPLEVVKIRLQVRSEYAGDVLKSQVTALG-VIKQLGIKGLYKGIAACLMRDVPFSAIYFP 689

Query: 89  VYEWCKKHIFHVDGTVGKE--QLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSI 141
            Y   KK +F  D    K+  +L  W+ L AG L G  +   T P D+++TRL I
Sbjct: 690 TYAHLKKDVFKYDPKDKKQRNKLKTWELLVAGGLAGMPAAYLTTPFDVIKTRLQI 744

 Score = 60.8 bits (146), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 43/159 (27%), Positives = 76/159 (47%), Gaps = 20/159 (12%)

Query: 27  TVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQ 86
           TVV P + VK  +Q Q S S Y + I +   +++  EG+ G++ G G   + + P  A++
Sbjct: 534 TVVYPIDLVKTRMQAQRSFSQYKNSI-DCFAKIFSREGIRGIYSGLGPQLIGVAPEKAIK 592

Query: 87  FVVYEWCKKHIFHVDGTVGKEQLLNWQ-RLSAGALCGGMSVLATYPLDLVRTRLSIQTAN 145
             V ++ +  +      + K   L W   + +GA  G   V+ T PL++V+ RL +++  
Sbjct: 593 LTVNDYMRGRL------MDKHANLKWYFEILSGACAGACQVVFTNPLEVVKIRLQVRSE- 645

Query: 146 XXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
                     D+ K       ++K      GI+GLY+GI
Sbjct: 646 -------YAGDVLKSQVTALGVIKQL----GIKGLYKGI 673

 Score = 33.5 bits (75), Expect = 0.091,   Method: Composition-based stats.
 Identities = 19/70 (27%), Positives = 32/70 (45%), Gaps = 13/70 (18%)

Query: 115 LSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEE 174
            + G++ G +     YP+DLV+TR+  Q +             ++     +   K F  E
Sbjct: 522 FTLGSIAGCIGATVVYPIDLVKTRMQAQRS------------FSQYKNSIDCFAKIFSRE 569

Query: 175 GGIRGLYRGI 184
            GIRG+Y G+
Sbjct: 570 -GIRGIYSGL 578

 Score = 32.3 bits (72), Expect = 0.24,   Method: Composition-based stats.
 Identities = 17/65 (26%), Positives = 27/65 (41%), Gaps = 1/65 (1%)

Query: 28  VVSPFERVKILLQVQSSTSAYNH-GIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQ 86
           + +PF+ +K  LQ+        + GI +A   + KEE     F+G     +R  P     
Sbjct: 731 LTTPFDVIKTRLQIDPRKGETRYEGIFHAARTILKEESFKSFFKGGSARVLRSSPQFGFT 790

Query: 87  FVVYE 91
              YE
Sbjct: 791 LAAYE 795

>YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member of
           the mitochondrial carrier (MCF) protein family of
           membrane transporters [1107 bp, 368 aa]
          Length = 368

 Score = 64.3 bits (155), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 65/126 (51%), Gaps = 8/126 (6%)

Query: 25  SRTVVSPFERVKILLQVQSS------TSAYNHGII-NAVGQVYKEEGVAGLFRGNGLNCV 77
           S  V  P E +K  LQ+Q         S YN+  + NA+  V KEEG   LF G      
Sbjct: 162 SSFVYVPSEVLKTRLQLQGRFNNPFFQSGYNYSNLRNAIKTVIKEEGFRSLFFGYKATLA 221

Query: 78  RIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNW-QRLSAGALCGGMSVLATYPLDLVR 136
           R  P+SA+QF  YE  ++  F ++   G++  L+    +  GA  GG++ + T P+D+V+
Sbjct: 222 RDLPFSALQFAFYEKFRQLAFKIEQKDGRDGELSIPNEILTGACAGGLAGIITTPMDVVK 281

Query: 137 TRLSIQ 142
           TR+  Q
Sbjct: 282 TRVQTQ 287

 Score = 37.4 bits (85), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 47/98 (47%), Gaps = 18/98 (18%)

Query: 52  IINAVGQVYKEEGVA-GLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLL 110
           +I+A   ++ EEGV  GL+ G     +  FP +A+ F  YE+ K+ +             
Sbjct: 93  MISAYRTIWLEEGVRRGLYGGYMAAMLGSFPSAAIFFGTYEYTKRTMIE----------- 141

Query: 111 NWQ------RLSAGALCGGMSVLATYPLDLVRTRLSIQ 142
           +WQ       LSAG L   +S     P ++++TRL +Q
Sbjct: 142 DWQINDTITHLSAGFLGDFISSFVYVPSEVLKTRLQLQ 179

>KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, start by similarity
          Length = 317

 Score = 63.2 bits (152), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 41/115 (35%), Positives = 58/115 (50%), Gaps = 4/115 (3%)

Query: 25  SRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSA 84
           +R   +P + VKI  Q+Q        GI + V  + KEEG+  L++GN         Y A
Sbjct: 32  ARMATAPMDTVKIRYQLQPVQEDKYKGIASTVRTIMKEEGLRALWKGNIPATAMYVVYGA 91

Query: 85  VQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRL 139
           VQF  Y W   +++        +Q    Q L+ GAL G  S + +YPLDL+RTRL
Sbjct: 92  VQFGSYSWF-NNVWSAKFPRFSQQ---GQTLTVGALAGMTSSVVSYPLDLLRTRL 142

 Score = 37.4 bits (85), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 58/143 (40%), Gaps = 35/143 (24%)

Query: 58  QVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEW----CKKHIFHVDGTVGKEQLLNWQ 113
           Q++  EGV G F G       +   +A+ F+ YE     C+ H         KE    W 
Sbjct: 159 QMWLNEGVRGFFTGISTAMTTVTLSTAIMFLTYETVNIVCENH--------EKE---FWS 207

Query: 114 R---LSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWE----- 165
           R    S+G + G +S    +P+D +R R+ +  +              K P V+      
Sbjct: 208 RPVSASSGIIAGFVSKTMVFPIDTLRRRMQVMNSK-------RTVHFTKFPAVYHEYRYK 260

Query: 166 ----LLVKTFKEEGGIRGLYRGI 184
               ++ K  ++E G+  LYRG+
Sbjct: 261 SSTAIIYKILRQE-GVSALYRGL 282

 Score = 33.5 bits (75), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 37/80 (46%), Gaps = 13/80 (16%)

Query: 25  SRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYK-------------EEGVAGLFRG 71
           S+T+V P + ++  +QV +S    +     AV   Y+             +EGV+ L+RG
Sbjct: 222 SKTMVFPIDTLRRRMQVMNSKRTVHFTKFPAVYHEYRYKSSTAIIYKILRQEGVSALYRG 281

Query: 72  NGLNCVRIFPYSAVQFVVYE 91
             +   +  P +A+   VYE
Sbjct: 282 LTMGLCKSVPTTAISLFVYE 301

 Score = 28.9 bits (63), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 38/79 (48%), Gaps = 13/79 (16%)

Query: 106 KEQLLNW-QRLSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVW 164
           K + ++W   + AG++ G  + +AT P+D V+ R  +Q                K  G+ 
Sbjct: 12  KGETVSWYNSVIAGSVSGVFARMATAPMDTVKIRYQLQPVQED-----------KYKGI- 59

Query: 165 ELLVKTFKEEGGIRGLYRG 183
              V+T  +E G+R L++G
Sbjct: 60  ASTVRTIMKEEGLRALWKG 78

>Kwal_47.17321
          Length = 881

 Score = 63.5 bits (153), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 62/117 (52%), Gaps = 4/117 (3%)

Query: 29  VSPFERVKILLQVQSS-TSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQF 87
            +P E VKI LQV+S    +     + A+G V K  G+ GL++G     +R  P+SA+ F
Sbjct: 612 TNPLEIVKIRLQVRSEYADSLPKSQLTALG-VVKSLGLRGLYKGLVACLMRDVPFSAIYF 670

Query: 88  VVYEWCKKHIFHVD--GTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQ 142
             Y   K+ IF+ D      + +L  W+ L+AG L G  +   T P D+++TRL I 
Sbjct: 671 PTYAHLKRDIFNYDPQDKNKRARLHTWELLTAGGLAGMPAAYLTTPFDVIKTRLQID 727

 Score = 52.4 bits (124), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 75/158 (47%), Gaps = 18/158 (11%)

Query: 27  TVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQ 86
           T V P + VK  +Q Q + S Y + I +   +++  EG+ G++ G G   V + P  A++
Sbjct: 516 TAVYPIDLVKTRMQAQRNFSQYKNSI-DCFVKIFSREGIRGIYSGLGPQLVGVAPEKAIK 574

Query: 87  FVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTANX 146
             V ++ +K +   +      +L     + +GA  G   V+ T PL++V+ RL +++   
Sbjct: 575 LTVNDYVRKLLMDENN-----RLTLPLEIISGAAAGACQVIFTNPLEIVKIRLQVRSE-- 627

Query: 147 XXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
                     + K       +VK+     G+RGLY+G+
Sbjct: 628 ------YADSLPKSQLTALGVVKSL----GLRGLYKGL 655

 Score = 36.6 bits (83), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 13/67 (19%)

Query: 118 GALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGI 177
           G++ G +   A YP+DLV+TR+  Q             + ++     +  VK F  E GI
Sbjct: 507 GSVAGCIGATAVYPIDLVKTRMQAQ------------RNFSQYKNSIDCFVKIFSRE-GI 553

Query: 178 RGLYRGI 184
           RG+Y G+
Sbjct: 554 RGIYSGL 560

 Score = 33.5 bits (75), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 29/65 (44%), Gaps = 1/65 (1%)

Query: 28  VVSPFERVKILLQVQSSTSAYNH-GIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQ 86
           + +PF+ +K  LQ+        + GI++A   + KEE     F+G G   +R  P     
Sbjct: 713 LTTPFDVIKTRLQIDPRKGETRYTGILHAARTILKEERFKSFFKGGGARVLRSSPQFGFT 772

Query: 87  FVVYE 91
              YE
Sbjct: 773 LAAYE 777

>AFL196W [2999] [Homologous to ScYMR166C - SH]
           complement(66955..68040) [1086 bp, 361 aa]
          Length = 361

 Score = 62.8 bits (151), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 63/125 (50%), Gaps = 7/125 (5%)

Query: 25  SRTVVSPFERVKILLQVQSS------TSAYNH-GIINAVGQVYKEEGVAGLFRGNGLNCV 77
           S  V  P E +K  LQ+Q         S YN+ G+ +AV  + + EGV+ LF G      
Sbjct: 162 SSVVYVPSEVLKTRLQLQGCYNNRHFQSGYNYRGLSDAVRTIVRTEGVSALFFGYKATLS 221

Query: 78  RIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRT 137
           R  P+SA+QF  YE  +K  F ++       L     +  GA  GG++ + T PLD+V+T
Sbjct: 222 RDLPFSALQFAFYERFRKWAFLLERKPVDGHLSFTAEVVTGASAGGLAGIITTPLDVVKT 281

Query: 138 RLSIQ 142
           R+  Q
Sbjct: 282 RIQTQ 286

 Score = 44.3 bits (103), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 58/124 (46%), Gaps = 21/124 (16%)

Query: 27  TVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVA-GLFRGNGLNCVRIFPYSAV 85
           +V+   + VK   Q       Y H +I+A   +  EEGV  GL+ G G   +  FP +AV
Sbjct: 69  SVMHSLDTVKTRQQGAPGEVKYRH-MISAYRTLALEEGVRRGLYGGYGAAMLGSFPSAAV 127

Query: 86  QFVVYEWCKKHIFHVDGTVGKEQLLN-WQ------RLSAGALCGGMSVLATYPLDLVRTR 138
            F  YEW K+            Q++N WQ       L+AG L    S +   P ++++TR
Sbjct: 128 FFGTYEWVKR------------QMINEWQIHETYSHLAAGFLGDLFSSVVYVPSEVLKTR 175

Query: 139 LSIQ 142
           L +Q
Sbjct: 176 LQLQ 179

>KLLA0E13453g complement(1184806..1187526) similar to sgd|S0006225
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 906

 Score = 62.8 bits (151), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 62/117 (52%), Gaps = 4/117 (3%)

Query: 29  VSPFERVKILLQVQSSTSAYN-HGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQF 87
            +P E VKI LQ++S     N    + AVG + ++ G+ GL++G     +R  P+SA+ F
Sbjct: 616 TNPLEIVKIRLQMRSDYVGENARPQLGAVG-IIRQLGLRGLYKGAAACLLRDVPFSAIYF 674

Query: 88  VVYEWCKKHIFHVD--GTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQ 142
             Y   KK +F+ D      + +L  W+ L AG + G  +   T P D+++TRL I 
Sbjct: 675 PTYAHLKKDVFNFDPNDKNKRNKLKTWELLLAGGIAGMPAAYLTTPFDVIKTRLQID 731

 Score = 58.2 bits (139), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 81/158 (51%), Gaps = 20/158 (12%)

Query: 27  TVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQ 86
           TVV P + VK  +Q Q ++  Y + I + V ++++ +G+ GL+ G G   + + P  A++
Sbjct: 520 TVVYPIDLVKTRMQAQRNSVQYKNSI-DCVVKIFQTKGIRGLYSGLGPQLIGVAPEKAIK 578

Query: 87  FVVYEWCKKHIFHVDGTVGKEQLLNW-QRLSAGALCGGMSVLATYPLDLVRTRLSIQTAN 145
             V ++ +++       + K + + W Q + +GA  G   V+ T PL++V+ RL +++  
Sbjct: 579 LTVNDFMRQYF------MNKSRTIKWYQEILSGATAGACQVVFTNPLEIVKIRLQMRSD- 631

Query: 146 XXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRG 183
                     + A+P    +L       + G+RGLY+G
Sbjct: 632 -------YVGENARP----QLGAVGIIRQLGLRGLYKG 658

 Score = 33.9 bits (76), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 34/72 (47%), Gaps = 13/72 (18%)

Query: 113 QRLSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFK 172
              + G++ G +     YP+DLV+TR+  Q             +  +     + +VK F+
Sbjct: 506 HNFTLGSIAGCIGATVVYPIDLVKTRMQAQ------------RNSVQYKNSIDCVVKIFQ 553

Query: 173 EEGGIRGLYRGI 184
            + GIRGLY G+
Sbjct: 554 TK-GIRGLYSGL 564

 Score = 31.6 bits (70), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 16/65 (24%), Positives = 29/65 (44%), Gaps = 1/65 (1%)

Query: 28  VVSPFERVKILLQVQSSTSAYNH-GIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQ 86
           + +PF+ +K  LQ+        + G+I+A   + KEE +   F+G     +R  P     
Sbjct: 717 LTTPFDVIKTRLQIDPRKGETTYTGVIHAARTILKEESIKSFFKGGPARVLRSSPQFGFT 776

Query: 87  FVVYE 91
              +E
Sbjct: 777 LAAFE 781

>ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH]
           (241532..242521) [990 bp, 329 aa]
          Length = 329

 Score = 61.6 bits (148), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 47/157 (29%), Positives = 71/157 (45%), Gaps = 23/157 (14%)

Query: 28  VVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQF 87
           V++P ERVK++LQ QS     NH + +A   +    GV  LFRG+     R  P SA+ F
Sbjct: 166 VMAPTERVKVVLQTQS-----NHSLGSAAKHILATGGVRSLFRGSLATLARDGPGSALYF 220

Query: 88  VVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTANXX 147
             YE  K ++    GT    +L       AG + G    +  +P+D ++T L  Q++N  
Sbjct: 221 ASYEATKAYLNARSGT---NELSIKNVCLAGGMAGVSMWVGVFPIDTIKTEL--QSSNTR 275

Query: 148 XXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
                          + E   K +   GGI+G + GI
Sbjct: 276 QT-------------MMEATRKIYNTRGGIKGFFPGI 299

>YOR100C (CRC1) [4905] chr15 complement(513295..514278)
           Mitochondrial carnitine carrier, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [984 bp, 327 aa]
          Length = 327

 Score = 60.8 bits (146), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 46/160 (28%), Positives = 74/160 (46%), Gaps = 23/160 (14%)

Query: 28  VVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQF 87
           V +P ERVK++LQ  S  S      I A   + KE G+A LF+G+     R  P SA+ F
Sbjct: 158 VTAPTERVKVVLQTSSKGS-----FIQAAKTIVKEGGIASLFKGSLATLARDGPGSALYF 212

Query: 88  VVYEWCKKHIF--HVDGTVGKEQLLNWQRLSAGALCGGMSV-LATYPLDLVRTRLSIQTA 144
             YE  K ++         GK++ +N   +       GMS+ LA +P+D ++T+L  Q +
Sbjct: 213 ASYEISKNYLNSRQPRQDAGKDEPVNILNVCLAGGIAGMSMWLAVFPIDTIKTKL--QAS 270

Query: 145 NXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
           +          +I             + + GGI+G + G+
Sbjct: 271 STRQNMLSATKEI-------------YLQRGGIKGFFPGL 297

 Score = 31.2 bits (69), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 5/64 (7%)

Query: 29  VSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEG-VAGLFRGNGLNCVRIFPYSAVQF 87
           V P + +K  LQ  S+       +++A  ++Y + G + G F G G   +R FP +A  F
Sbjct: 257 VFPIDTIKTKLQASST----RQNMLSATKEIYLQRGGIKGFFPGLGPALLRSFPANAATF 312

Query: 88  VVYE 91
           +  E
Sbjct: 313 LGVE 316

>YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membrane
           succinate-fumarate transporter, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [969 bp, 322 aa]
          Length = 322

 Score = 60.5 bits (145), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 77/169 (45%), Gaps = 29/169 (17%)

Query: 28  VVSPFERVKILLQVQSSTSA-------YNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIF 80
           VV+P E VKI LQ Q  T +       YN+ I +A   + KEEGV+ L+RG  L   R  
Sbjct: 128 VVNPMEVVKIRLQAQHLTPSEPNAGPKYNNAI-HAAYTIVKEEGVSALYRGVSLTAARQA 186

Query: 81  PYSAVQFVVYEWCKKHI--FHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTR 138
                 F VY   K+ +  +H       + L +W+    G + G +   +  PLD ++TR
Sbjct: 187 TNQGANFTVYSKLKEFLQNYH-----QMDVLPSWETSCIGLISGAIGPFSNAPLDTIKTR 241

Query: 139 LSIQTANXXXXXXXXXXDIAKPPGVWELLV---KTFKEEGGIRGLYRGI 184
           L    +            + K  G+ +++    +  KEE G R LY+GI
Sbjct: 242 LQKDKS----------ISLEKQSGMKKIITIGAQLLKEE-GFRALYKGI 279

 Score = 43.9 bits (102), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 36/72 (50%), Gaps = 4/72 (5%)

Query: 30  SPFERVKILLQVQSSTSAYNHG----IINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAV 85
           +P + +K  LQ   S S         II    Q+ KEEG   L++G     +R+ P  AV
Sbjct: 233 APLDTIKTRLQKDKSISLEKQSGMKKIITIGAQLLKEEGFRALYKGITPRVMRVAPGQAV 292

Query: 86  QFVVYEWCKKHI 97
            F VYE+ ++H+
Sbjct: 293 TFTVYEYVREHL 304

 Score = 41.6 bits (96), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/159 (22%), Positives = 66/159 (41%), Gaps = 15/159 (9%)

Query: 31  PFERVKILLQVQSSTSAYNH----GIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQ 86
           P + +K+ +Q+    +   H    G I     +Y++EG   L++G G   + I P  A++
Sbjct: 30  PLDTIKVRMQIYRRVAGIEHVKPPGFIKTGRTIYQKEGFLALYKGLGAVVIGIIPKMAIR 89

Query: 87  FVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCG-GMSVLATYPLDLVRTRLSIQTAN 145
           F  YE+ +  + + +  +    +       AG   G   +VL   P+++V+ RL  Q   
Sbjct: 90  FSSYEFYRTLLVNKESGI----VSTGNTFVAGVGAGITEAVLVVNPMEVVKIRLQAQHLT 145

Query: 146 XXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
                     + A           T  +E G+  LYRG+
Sbjct: 146 PSEPNAGPKYNNAIHAAY------TIVKEEGVSALYRGV 178

>Scas_669.6
          Length = 373

 Score = 60.1 bits (144), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 64/129 (49%), Gaps = 8/129 (6%)

Query: 25  SRTVVSPFERVKILLQVQSST------SAYNH-GIINAVGQVYKEEGVAGLFRGNGLNCV 77
           S  V  P E +K  LQ+Q         S YN+  +  A+  +   EGV  LF G      
Sbjct: 160 SSFVYVPSEVLKTRLQLQGRVNNPFFQSGYNYRSLRTAIRIIVNTEGVKALFFGYKATLA 219

Query: 78  RIFPYSAVQFVVYEWCKKHIFHVDG-TVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVR 136
           R  P+SA+QF  YE  ++  F ++   + K  L     +  GA+ GG++ + T P+D+++
Sbjct: 220 RDLPFSALQFGFYEKFRQTAFKLEKKDITKHNLSIPNEIFTGAIAGGLAGIITTPMDVIK 279

Query: 137 TRLSIQTAN 145
           TRL  Q A+
Sbjct: 280 TRLQTQQAD 288

 Score = 46.6 bits (109), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 56/111 (50%), Gaps = 7/111 (6%)

Query: 33  ERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVA-GLFRGNGLNCVRIFPYSAVQFVVYE 91
           + VK   Q    T  Y + +  A   ++ EEG+A GL+ G     +  FP +A+ F  YE
Sbjct: 73  DTVKTRQQGAPMTPKYKN-MTTAYRTIFLEEGIARGLYGGYFAAMLGSFPSAAIFFGTYE 131

Query: 92  WCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQ 142
           WCK+ +    G +G    ++   LSAG L   +S     P ++++TRL +Q
Sbjct: 132 WCKRKMI---GDLGFNDTVS--HLSAGLLGDFVSSFVYVPSEVLKTRLQLQ 177

>YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1008 bp, 335 aa]
          Length = 335

 Score = 59.7 bits (143), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 85/191 (44%), Gaps = 26/191 (13%)

Query: 3   LKQLAKQ-ESSIAFIXXXXXXXXSRTVVSPFERVKILLQVQ-----SSTSAYNHGIINAV 56
           L +L K  +  +A I        S  +V PF+  K  LQ Q     +  S +  G     
Sbjct: 29  LNRLKKNADPRVAAISGALSGALSAMLVCPFDVAKTRLQAQGLQNMTHQSQHYKGFFGTF 88

Query: 57  GQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLS 116
             ++K+EG AGL++G     +   P   + F VY++C+K  + VD       L N    S
Sbjct: 89  ATIFKDEGAAGLYKGLQPTVLGYIPTLMIYFSVYDFCRK--YSVDIFPHSPFLSNA---S 143

Query: 117 AGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFK---E 173
           +    G +S +AT P+ +V+TRL +QT             I K    ++  + TF+   +
Sbjct: 144 SAITAGAISTVATNPIWVVKTRLMLQTG------------IGKYSTHYKGTIDTFRKIIQ 191

Query: 174 EGGIRGLYRGI 184
           + G + LY G+
Sbjct: 192 QEGAKALYAGL 202

 Score = 42.7 bits (99), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 39/74 (52%), Gaps = 1/74 (1%)

Query: 25  SRTVVSPFERVKILLQVQSS-TSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYS 83
           + TV  P E ++  +Q++S   +     ++  +   Y++EG AG + G   N VR  P +
Sbjct: 257 ASTVTYPHEILRTRMQLKSDLPNTVQRHLLPLIKITYRQEGFAGFYSGFATNLVRTVPAA 316

Query: 84  AVQFVVYEWCKKHI 97
            V  V +E+ KK++
Sbjct: 317 VVTLVSFEYSKKYL 330

 Score = 35.4 bits (80), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 59/131 (45%), Gaps = 19/131 (14%)

Query: 25  SRTVVSPFERVKILLQVQSSTSAYN---HGIINAVGQVYKEEGVAGLFRG------NGLN 75
           S    +P   VK  L +Q+    Y+    G I+   ++ ++EG   L+ G        LN
Sbjct: 152 STVATNPIWVVKTRLMLQTGIGKYSTHYKGTIDTFRKIIQQEGAKALYAGLVPALLGMLN 211

Query: 76  CVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLL--NWQRLSAGALCGGM-SVLATYPL 132
                   A+QF +YE  K    + + T     +   N+Q+L   ++   M +   TYP 
Sbjct: 212 V-------AIQFPLYENLKIRFGYSESTDVSTDVTSSNFQKLILASMLSKMVASTVTYPH 264

Query: 133 DLVRTRLSIQT 143
           +++RTR+ +++
Sbjct: 265 EILRTRMQLKS 275

>CAGL0M09020g complement(896312..897358) highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w succinate-fumarate
           transporter, start by similarity
          Length = 348

 Score = 59.7 bits (143), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 52/169 (30%), Positives = 72/169 (42%), Gaps = 29/169 (17%)

Query: 28  VVSPFERVKILLQVQSSTSAYNHGI-----INAVGQVY---KEEGVAGLFRGNGLNCVRI 79
           VV+P E VKI LQ Q      NH +      NAV   Y   KEEG++ L+RG  L   R 
Sbjct: 155 VVNPMEVVKIRLQAQHLNP--NHDLAKPKYTNAVQAGYTIIKEEGISALYRGVSLTAARQ 212

Query: 80  FPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRL 139
                  F VY   ++ +    GT   E L +W+    G + G +   +  PLD ++TRL
Sbjct: 213 ATNQGANFTVYSKLREFLQEYHGT---ETLPSWETSCIGLISGAIGPFSNAPLDTIKTRL 269

Query: 140 SIQTANXXXXXXXXXXDIAKPPGVWELL----VKTFKEEGGIRGLYRGI 184
               +              K    W+ +     +  KEE G R LY+GI
Sbjct: 270 QKDKSTSF-----------KGESGWKRIAHIGTQLLKEE-GFRALYKGI 306

 Score = 43.1 bits (100), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 4/72 (5%)

Query: 30  SPFERVKILLQVQSSTSAYNHG----IINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAV 85
           +P + +K  LQ   STS         I +   Q+ KEEG   L++G     +R+ P  AV
Sbjct: 260 APLDTIKTRLQKDKSTSFKGESGWKRIAHIGTQLLKEEGFRALYKGITPRVMRVAPGQAV 319

Query: 86  QFVVYEWCKKHI 97
            F VYE+ ++H+
Sbjct: 320 TFTVYEFVRRHL 331

 Score = 42.7 bits (99), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 59/136 (43%), Gaps = 13/136 (9%)

Query: 51  GIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLL 110
           G I     +Y +EG   L++G G   + I P  A++F  YE+ +  +   D   G     
Sbjct: 81  GFIRTGRNIYAQEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRTLL--ADKQTGVVSTS 138

Query: 111 NWQRLSAGALCG-GMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVK 169
           N     AG   G   +VL   P+++V+ RL  Q  N          D+AKP     +   
Sbjct: 139 N--TFIAGVGAGVTEAVLVVNPMEVVKIRLQAQHLN-------PNHDLAKPKYTNAVQAG 189

Query: 170 -TFKEEGGIRGLYRGI 184
            T  +E GI  LYRG+
Sbjct: 190 YTIIKEEGISALYRGV 205

>Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement
          Length = 319

 Score = 58.9 bits (141), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 67/162 (41%), Gaps = 18/162 (11%)

Query: 28  VVSPFERVKILLQVQ-----SSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPY 82
           VV+P E VKI LQ Q     ++ S      + A   + KEEG+  L+RG  L   R    
Sbjct: 127 VVNPMEVVKIRLQAQHLHPETAASPRYRNALQACYLIVKEEGIGALYRGVSLTAARQATN 186

Query: 83  SAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQ 142
               F VY   K+ +     T   + L +W+    G + G +   +  PLD ++TRL   
Sbjct: 187 QGANFTVYSKLKEFLQEHHKT---DALPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKD 243

Query: 143 TANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
            +            I K         +  KEE G R LY+GI
Sbjct: 244 KSTANMSGWSRIVTIGK---------QLIKEE-GFRALYKGI 275

 Score = 43.5 bits (101), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 38/70 (54%), Gaps = 2/70 (2%)

Query: 30  SPFERVKILLQVQSSTSAYN--HGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQF 87
           +P + +K  LQ   ST+  +    I+    Q+ KEEG   L++G     +R+ P  AV F
Sbjct: 231 APLDTIKTRLQKDKSTANMSGWSRIVTIGKQLIKEEGFRALYKGITPRVMRVAPGQAVTF 290

Query: 88  VVYEWCKKHI 97
            VYE+ ++H+
Sbjct: 291 TVYEFVREHL 300

 Score = 42.4 bits (98), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 69/161 (42%), Gaps = 21/161 (13%)

Query: 31  PFERVKILLQVQSSTSAYN---HGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQF 87
           P + +K+ +Q+   ++       G I     +Y EEG+  L++G G   + I P  A++F
Sbjct: 30  PLDTIKVRMQIYRRSALEGIKPPGFIKTGRNIYTEEGLLALYKGLGAVVIGIIPKMAIRF 89

Query: 88  VVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGM-SVLATYPLDLVRTRLSIQTANX 146
             YE+ +  +   D   G     N     AG   G   +VL   P+++V+ RL  Q  + 
Sbjct: 90  SSYEFYRSAL--ADKQTGSVSTGN--TFLAGVGAGTTEAVLVVNPMEVVKIRLQAQHLH- 144

Query: 147 XXXXXXXXXDIAKPPGVWELLVKTF---KEEGGIRGLYRGI 184
                    + A  P     L   +   KEE GI  LYRG+
Sbjct: 145 --------PETAASPRYRNALQACYLIVKEE-GIGALYRGV 176

>Scas_721.27
          Length = 374

 Score = 58.9 bits (141), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 75/182 (41%), Gaps = 39/182 (21%)

Query: 28  VVSPFERVKILLQ-----------VQSSTSAYNHGIINAV--------------GQVYKE 62
           V  PF+ VK  LQ             + T+A+N  I N++              G VYK 
Sbjct: 69  VTCPFDLVKTRLQSDIYQSVYKSKAATVTAAHNSKIANSLVQAGTHFKETFGILGNVYKR 128

Query: 63  EGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCG 122
           EG   LF+G G N V + P  ++ F  Y    K I+      G+E  L    L + A  G
Sbjct: 129 EGFRSLFKGLGPNLVGVIPARSINFFTYG-TTKEIYSKAFNNGQETPL--IHLMSAATAG 185

Query: 123 GMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYR 182
             +  AT P+ +++TR+ +  A              K    W+ L    K E GI GLYR
Sbjct: 186 WATSTATNPIWMIKTRVQLDKAGTTR----------KYKNSWDCLKTVLKSE-GIYGLYR 234

Query: 183 GI 184
           G+
Sbjct: 235 GL 236

 Score = 36.2 bits (82), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 63/128 (49%), Gaps = 15/128 (11%)

Query: 25  SRTVVSPFERVKILLQV-QSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYS 83
           + T  +P   +K  +Q+ ++ T+       + +  V K EG+ GL+RG  L+   +    
Sbjct: 188 TSTATNPIWMIKTRVQLDKAGTTRKYKNSWDCLKTVLKSEGIYGLYRG--LSASYLGSIE 245

Query: 84  AV-QFVVYEWCKKHI-------FHVDGTVGK---EQLLNW-QRLSAGALCGGMSVLATYP 131
            + Q+++YE  K  I       F  +G + K   E++  W QR  +  +   ++ + TYP
Sbjct: 246 GILQWLLYEQMKHLIKQRSIEKFGHEGQLTKSRTEKIKEWCQRSGSAGVAKFIASIVTYP 305

Query: 132 LDLVRTRL 139
            ++VRTRL
Sbjct: 306 HEVVRTRL 313

 Score = 29.3 bits (64), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 34/67 (50%), Gaps = 4/67 (5%)

Query: 28  VVSPFERVKILLQ---VQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSA 84
           V  P E V+  L+   +++    Y  G++ +   + KEEG+A ++ G   + +R  P S 
Sbjct: 302 VTYPHEVVRTRLRQMPMENGKPKYT-GLVQSFRVIIKEEGLASMYSGLTPHLMRTVPNSI 360

Query: 85  VQFVVYE 91
           + F  +E
Sbjct: 361 IMFGTWE 367

>KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomyces
           cerevisiae YOR100c CRC1 mitochondrial carnitine carrier,
           member of the mitochondrial carrier (MCF) family, start
           by similarity
          Length = 328

 Score = 58.5 bits (140), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 74/158 (46%), Gaps = 22/158 (13%)

Query: 28  VVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQF 87
           V +P ERVK++LQ     +++    ++A  Q+ + +G   LF+G+     R  P SA+ F
Sbjct: 156 VTAPTERVKVVLQTTQGKASF----LDAAKQIVRTQGFQSLFKGSLATLSRDGPGSALYF 211

Query: 88  VVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSV-LATYPLDLVRTRLSIQTANX 146
             YE CK+++    G    E  +    +S G    G+S+ +  +P+D V+T+L       
Sbjct: 212 ASYEICKEYLNKASGHTSGELSITNVCISGG--MAGVSMWVVVFPIDTVKTQLQ------ 263

Query: 147 XXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
                      +K   + E+    +   GGI+G + G+
Sbjct: 264 ---------SSSKRQSMLEVTRMIYNTRGGIKGFFPGV 292

 Score = 30.0 bits (66), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 37/95 (38%), Gaps = 10/95 (10%)

Query: 91  EWCKKHIFHVDGTVGKEQLL-NWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXX 149
           E    H+  V  T  K QL  N + L+AG + G  +VL  +P DLV+ R     A     
Sbjct: 9   ELETSHVNDVSQT--KSQLTENLKSLAAGGVGGVCAVLTGHPFDLVKVRCQSNQARSAMD 66

Query: 150 XXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
                   A+       L         +RG Y+G+
Sbjct: 67  AVSHILQAARQAAGPTSL-------NAVRGFYKGV 94

 Score = 30.0 bits (66), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 30/65 (46%), Gaps = 5/65 (7%)

Query: 28  VVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEG-VAGLFRGNGLNCVRIFPYSAVQ 86
           VV P + VK  LQ    +S+    ++     +Y   G + G F G G   +R FP +A  
Sbjct: 251 VVFPIDTVKTQLQ----SSSKRQSMLEVTRMIYNTRGGIKGFFPGVGPAILRSFPANAAT 306

Query: 87  FVVYE 91
           F+  E
Sbjct: 307 FLGVE 311

>Scas_558.2
          Length = 289

 Score = 58.2 bits (139), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 43/156 (27%), Positives = 72/156 (46%), Gaps = 21/156 (13%)

Query: 31  PFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVA-GLFRGNGLNCVRIFPYSAVQFVV 89
           P E +K   QV S+ S++       + +   +EG+   L+RG     +R  P++ +QF +
Sbjct: 119 PAEVIKQRTQVHSTNSSWQ--TFRTILKNENQEGIIRNLYRGWSTTIMREIPFTCIQFPL 176

Query: 90  YEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXX 149
           YE+ KK     D  VG   L  W+    G++ GG++   T PLD ++TRL +   +    
Sbjct: 177 YEFMKKEWALYDNEVG--HLKPWKGAICGSIAGGIAAATTTPLDFLKTRLMLNKDSIP-- 232

Query: 150 XXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGIY 185
                        +  L+   +KEE G +  + GIY
Sbjct: 233 -------------IKSLIRNIYKEE-GFKIFFSGIY 254

 Score = 35.8 bits (81), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 29/138 (21%), Positives = 56/138 (40%), Gaps = 20/138 (14%)

Query: 53  INAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCK-------KHIFHVDGTVG 105
           + A G  ++  G  G++RG G   V   P +++ FV Y+  K       + + +  GT  
Sbjct: 34  LQAKGGFFQNGGYHGIYRGLGSAVVASAPSASLFFVTYDSMKVRVRPHVERVINSSGTRS 93

Query: 106 KEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWE 165
              +     + A ++    + L   P ++++ R  + + N                  + 
Sbjct: 94  PHSVDTIVHMIASSMGELAACLVRVPAEVIKQRTQVHSTNSSWQ-------------TFR 140

Query: 166 LLVKTFKEEGGIRGLYRG 183
            ++K   +EG IR LYRG
Sbjct: 141 TILKNENQEGIIRNLYRG 158

>Sklu_2431.5 YBR192W, Contig c2431 8526-9638
          Length = 370

 Score = 57.4 bits (137), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 53/178 (29%), Positives = 73/178 (41%), Gaps = 35/178 (19%)

Query: 28  VVSPFERVKILLQVQSSTSAY---------NHGIINAVG------------QVYKEEGVA 66
           V  PF+ VK  LQ     +AY         N   + A G             VY+ EG  
Sbjct: 69  VTCPFDVVKTRLQSDVFQAAYKSHAKSIGPNQANVIAQGVRHFKETFGIISNVYRNEGFR 128

Query: 67  GLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSV 126
            LF+G G N V + P  ++ F  Y    K I+      G+E +  W  L A A  G  + 
Sbjct: 129 SLFKGLGPNLVGVIPARSINFFTYG-TTKEIYSKTLNNGQEAV--WIHLMAAATAGWATS 185

Query: 127 LATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
            AT P+ LV+TRL +  A              K    W+ L    ++E GI GLY+G+
Sbjct: 186 TATNPIWLVKTRLQLDKAGTT----------KKYKNSWDCLKNVVQKE-GILGLYKGL 232

 Score = 34.3 bits (77), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 63/129 (48%), Gaps = 17/129 (13%)

Query: 25  SRTVVSPFERVKILLQV-QSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYS 83
           + T  +P   VK  LQ+ ++ T+       + +  V ++EG+ GL++G  L+   +    
Sbjct: 184 TSTATNPIWLVKTRLQLDKAGTTKKYKNSWDCLKNVVQKEGILGLYKG--LSASYLGSVE 241

Query: 84  AV-QFVVYEWCKK-----------HIFHVDGTVGKEQLLNW-QRLSAGALCGGMSVLATY 130
            + Q+V+YE  K            +I  V+ +   +++  W QR  +  L   ++ + TY
Sbjct: 242 GILQWVLYEQMKHIIKQRSMEKFGNISEVEKSTS-DKIKEWCQRSGSAGLAKFVASIITY 300

Query: 131 PLDLVRTRL 139
           P ++VRTRL
Sbjct: 301 PHEVVRTRL 309

 Score = 28.9 bits (63), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 12/41 (29%), Positives = 24/41 (58%)

Query: 51  GIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYE 91
           G++ ++  + KEEG+A ++ G   + +R  P S + F  +E
Sbjct: 323 GLVQSIRVIIKEEGLASMYGGLTPHLLRTVPNSIIMFGTWE 363

>YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein of
           the mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to Mrs4p and Mrs3p [855 bp,
           284 aa]
          Length = 284

 Score = 57.0 bits (136), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 61/113 (53%), Gaps = 6/113 (5%)

Query: 31  PFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGV-AGLFRGNGLNCVRIFPYSAVQFVV 89
           P E VK   QV S+ S++    + ++ +   +EG+   L+RG     +R  P++ +QF +
Sbjct: 114 PAEVVKQRTQVHSTNSSWQ--TLQSILRNDNKEGLRKNLYRGWSTTIMREIPFTCIQFPL 171

Query: 90  YEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQ 142
           YE+ KK     +G   + Q+  W+    G++ GG++   T PLD ++TRL + 
Sbjct: 172 YEYLKKTWAKANG---QSQVEPWKGAICGSIAGGIAAATTTPLDFLKTRLMLN 221

 Score = 31.2 bits (69), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 33/141 (23%), Positives = 60/141 (42%), Gaps = 29/141 (20%)

Query: 53  INAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCK-KHIFHVDG--TVGKEQL 109
           + A G  +   G  G++RG G   V   P +++ F+ Y++ K K   ++    + G EQL
Sbjct: 32  LQAKGGFFANGGYKGIYRGLGSAVVASAPGASLFFISYDYMKVKSRPYISKLYSQGSEQL 91

Query: 110 LNWQ----RLSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWE 165
           ++        S G +C   + L   P ++V+ R  + + N                  W+
Sbjct: 92  IDTTTHMLSSSIGEIC---ACLVRVPAEVVKQRTQVHSTNSS----------------WQ 132

Query: 166 LL---VKTFKEEGGIRGLYRG 183
            L   ++   +EG  + LYRG
Sbjct: 133 TLQSILRNDNKEGLRKNLYRG 153

 Score = 27.7 bits (60), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 31/64 (48%), Gaps = 4/64 (6%)

Query: 28  VVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQF 87
             +P + +K  L +  +T++    II    ++Y+EEG A  F G G   + I    A+  
Sbjct: 207 TTTPLDFLKTRLMLNKTTASLGSVII----RIYREEGPAVFFSGVGPRTMWISAGGAIFL 262

Query: 88  VVYE 91
            +YE
Sbjct: 263 GMYE 266

>Scas_697.47
          Length = 328

 Score = 57.0 bits (136), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 73/159 (45%), Gaps = 19/159 (11%)

Query: 28  VVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQF 87
           V +P ER+K++LQ   + S  +   I A   + K+ GV  LF+G+     R  P SA+ F
Sbjct: 157 VTAPTERIKVVLQTAGANSKTS--FIGAAKNIVKDGGVKSLFKGSLATLARDGPGSALYF 214

Query: 88  VVYEWCKKHIFHVDGTV-GKEQLLNWQRLSAGALCGGMSV-LATYPLDLVRTRLSIQTAN 145
             YE  KK +   + T   K   +N   +       GMS+ L  +P+D ++T+L  Q+++
Sbjct: 215 ASYEISKKFLNDRNATAESKTGEVNIANVCLAGGIAGMSMWLVVFPIDTIKTKL--QSSS 272

Query: 146 XXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
                     +I             + + GGI+G + G+
Sbjct: 273 GSQSMVAATREI-------------YVKRGGIKGFFPGL 298

 Score = 33.5 bits (75), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 34/65 (52%), Gaps = 5/65 (7%)

Query: 28  VVSPFERVKILLQVQSSTSAYNHGIINAVGQVY-KEEGVAGLFRGNGLNCVRIFPYSAVQ 86
           VV P + +K  LQ    +S+ +  ++ A  ++Y K  G+ G F G G   +R FP +A  
Sbjct: 257 VVFPIDTIKTKLQ----SSSGSQSMVAATREIYVKRGGIKGFFPGLGPALLRSFPANAAT 312

Query: 87  FVVYE 91
           F+  E
Sbjct: 313 FLGVE 317

>Kwal_0.232
          Length = 274

 Score = 56.6 bits (135), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 58/110 (52%), Gaps = 6/110 (5%)

Query: 31  PFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVA-GLFRGNGLNCVRIFPYSAVQFVV 89
           P E +K   Q   S S+     +  + Q    EG+   L+RG     +R  P++ +QF +
Sbjct: 115 PAEVIKQRTQTHKSDSSLQ--TLKKLLQNENGEGIRRNLYRGWSTTVMREIPFTCIQFPL 172

Query: 90  YEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRL 139
           YE+ KK  + + G  G+EQ+  WQ    G + GG++   T PLD+++TRL
Sbjct: 173 YEFLKKQ-WAISG--GREQVAPWQGAFCGCVAGGIAAATTTPLDVLKTRL 219

>KLLA0E12353g complement(1092303..1093220)
           gi|1351895|sp|P49382|ADT_KLULA Kluyveromyces lactis ADP,
           ATP carrier protein (ADP/ATP translocase) (Adenine
           nucleotide translocator) (ANT), start by similarity
          Length = 305

 Score = 56.6 bits (135), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 61/192 (31%), Positives = 88/192 (45%), Gaps = 31/192 (16%)

Query: 8   KQESSIA--FIXXXXXXXXSRTVVSPFERVKILLQVQS------STSAYNHGIINAVGQV 59
           K++S+ A  F+        S+T  +P ERVK+L+Q Q       S      GI+    + 
Sbjct: 5   KKQSNFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGSLDRRYTGIVECFKRT 64

Query: 60  YKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNW--QRLSA 117
             +EGVA  +RGN  N +R FP  A+ F      K  I  + G   +E    W    L++
Sbjct: 65  AADEGVASFWRGNTANVIRYFPTQALNFAF----KDKIKAMFGFKKEEGYAKWFAGNLAS 120

Query: 118 GALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWEL--LVKTFKE-- 173
           G L GG+S+L  Y LD  RTRL+  + +            AK  G  +   LV  +K+  
Sbjct: 121 GGLAGGLSLLFVYSLDYARTRLAADSKS------------AKKGGERQFNGLVDVYKKTL 168

Query: 174 -EGGIRGLYRGI 184
              G+ GLYRG 
Sbjct: 169 ASDGVAGLYRGF 180

 Score = 41.2 bits (95), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 61/136 (44%), Gaps = 21/136 (15%)

Query: 50  HGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIF--HVDGTVGKE 107
           +G+++   +    +GVAGL+RG   + V I  Y  + F +Y+  K  +    ++ +    
Sbjct: 158 NGLVDVYKKTLASDGVAGLYRGFLPSVVGIVVYRGLYFGLYDSLKPLLLTGSLENSFLAS 217

Query: 108 QLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELL 167
            LL W      A+  G S  A+YPLD VR R+ + +               K  G ++  
Sbjct: 218 FLLGW------AVTTGAST-ASYPLDTVRRRMMMTSGQA-----------VKYDGAFDAF 259

Query: 168 VKTFKEEGGIRGLYRG 183
            K    E GI+ L++G
Sbjct: 260 RKIVAAE-GIKSLFKG 274

 Score = 29.6 bits (65), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/54 (25%), Positives = 26/54 (48%)

Query: 25  SRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVR 78
           + T   P + V+  + + S  +    G  +A  ++   EG+  LF+G G N +R
Sbjct: 228 ASTASYPLDTVRRRMMMTSGQAVKYDGAFDAFRKIVAAEGIKSLFKGCGANILR 281

>CAGL0B04543g 441599..442552 highly similar to tr|Q12289
           Saccharomyces cerevisiae YOR100c CRC1, start by
           similarity
          Length = 317

 Score = 56.2 bits (134), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 65/157 (41%), Gaps = 18/157 (11%)

Query: 28  VVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQF 87
           V +P ER+K++LQ  S    +    I A   +    GV  LF G+     R  P SA+ F
Sbjct: 149 VTAPTERIKVVLQTNSE---FKGSFIKAAKHIVSTGGVKSLFNGSLATLARDGPGSALYF 205

Query: 88  VVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTANXX 147
             YE  K  +        K+++       AG + G    L  +P+D ++TRL + T    
Sbjct: 206 ASYELSKAFLNKSVAKKDKDEVNLANVCLAGGIAGMSMWLVVFPIDTIKTRLQVATT--- 262

Query: 148 XXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
                       P  + +     + + GGI+G + G+
Sbjct: 263 ------------PISMVQATKDIYIQRGGIKGFFPGL 287

 Score = 32.0 bits (71), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 38/76 (50%), Gaps = 9/76 (11%)

Query: 28  VVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEG-VAGLFRGNGLNCVRIFPYSAVQ 86
           VV P + +K  LQV ++  +    ++ A   +Y + G + G F G G   +R FP +A  
Sbjct: 246 VVFPIDTIKTRLQVATTPIS----MVQATKDIYIQRGGIKGFFPGLGPALLRSFPANAAT 301

Query: 87  F----VVYEWCKKHIF 98
           F    + + + KK+ F
Sbjct: 302 FLGVELTHAFFKKYNF 317

>CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces
           cerevisiae YIL006w or sp|P39953 Saccharomyces cerevisiae
           YEL006w, hypothetical start
          Length = 361

 Score = 56.2 bits (134), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/165 (26%), Positives = 75/165 (45%), Gaps = 25/165 (15%)

Query: 28  VVSPFERVKILLQVQ-----SSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPY 82
           VV P +  K  LQ Q     ++ + Y  G I  +  + ++EGV GL++G     +  FP 
Sbjct: 85  VVCPLDVAKTRLQAQGLQTRTTENLYYRGSIGTMTTIVRDEGVRGLYKGLVPIIMGYFPT 144

Query: 83  SAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLS---AGALCGGMSVLATYPLDLVRTRL 139
             + F VYE+CK ++        +    NW  +S   +    G +S + T P+ +V+TRL
Sbjct: 145 WMIYFSVYEFCKDNL--------RTNSSNWSFVSHSFSAITAGAVSTVVTNPIWVVKTRL 196

Query: 140 SIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
            +QT            +     G ++   K   +E G++ LY G+
Sbjct: 197 MLQT--------HIGSNTTHYQGTYDAFKKIINQE-GVKALYAGL 232

 Score = 43.5 bits (101), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 43/95 (45%), Gaps = 4/95 (4%)

Query: 7   AKQESSIAFIXXXXXXXXSRTVVS----PFERVKILLQVQSSTSAYNHGIINAVGQVYKE 62
           +  ES I           S+ V S    P E ++  LQ++S   ++   +I  +   Y +
Sbjct: 264 SSNESKINLKRLILASSVSKMVASVLSYPHEILRTRLQLKSDLPSHQRRLIPLIKITYIQ 323

Query: 63  EGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHI 97
           EG+ G + G G N  R  P SA+  V +E+ +  +
Sbjct: 324 EGIFGFYSGFGTNLFRTLPASAITLVSFEYVRNFL 358

 Score = 31.2 bits (69), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 36/77 (46%), Gaps = 9/77 (11%)

Query: 110 LNWQRLSA--GALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELL 167
           LN  R++A  GAL G +S +   PLD+ +TRL  Q                   G    +
Sbjct: 65  LNDNRINAISGALAGLLSGIVVCPLDVAKTRLQAQGLQTRTTENLYYR------GSIGTM 118

Query: 168 VKTFKEEGGIRGLYRGI 184
               ++E G+RGLY+G+
Sbjct: 119 TTIVRDE-GVRGLYKGL 134

>AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH]
           (119645..120733) [1089 bp, 362 aa]
          Length = 362

 Score = 55.8 bits (133), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 66/163 (40%), Gaps = 21/163 (12%)

Query: 28  VVSPFERVKILLQVQS-STSAYNHGIINAVGQVY---KEEGVAGLFRGNGLNCVRIFPYS 83
           VV+P E VKI LQ Q    +A      NA+   Y   KEEG+  L+RG  L   R     
Sbjct: 173 VVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQ 232

Query: 84  AVQFVVYEWCKKHI--FHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSI 141
              F VY    + +  +H     G + L +W+    G + G +   +  PLD ++TRL  
Sbjct: 233 GANFTVYSKLMERLQEYH-----GSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQK 287

Query: 142 QTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
             +            I           +   +E G R LY+GI
Sbjct: 288 DKSTRNLSNWVRITTIG----------RQLVQEEGFRALYKGI 320

 Score = 43.1 bits (100), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 40/70 (57%), Gaps = 2/70 (2%)

Query: 30  SPFERVKILLQVQSSTSAYNHGI-INAVG-QVYKEEGVAGLFRGNGLNCVRIFPYSAVQF 87
           +P + +K  LQ   ST   ++ + I  +G Q+ +EEG   L++G     +R+ P  AV F
Sbjct: 276 APLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTF 335

Query: 88  VVYEWCKKHI 97
            VYE+ ++H+
Sbjct: 336 TVYEFVRRHL 345

 Score = 37.4 bits (85), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 65/156 (41%), Gaps = 13/156 (8%)

Query: 31  PFERVKILLQV--QSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFV 88
           P + +K+ +Q+  +++      G +     +Y  EG+   ++G G   + I P  A++F 
Sbjct: 77  PLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFS 136

Query: 89  VYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTANXXX 148
            YE+ +  +   D   G     N      GA     +VL   P+++V+ RL  Q  +   
Sbjct: 137 SYEFYRTLL--ADRQTGVVSTGNTFLAGVGAGV-TEAVLVVNPMEVVKIRLQAQHLHGAA 193

Query: 149 XXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
                   I        L+VK    E GI  LYRG+
Sbjct: 194 EQQKYRNAIQ----AAYLIVK----EEGIGALYRGV 221

>Scas_691.4
          Length = 334

 Score = 55.5 bits (132), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 70/178 (39%), Gaps = 36/178 (20%)

Query: 28  VVSPFERVKILLQVQ-------------------SSTSAYNHGIINAVGQVYKEEGVAGL 68
           VV+P E VKI LQ Q                   + T       I+A   + KEEG   L
Sbjct: 128 VVNPMEVVKIRLQAQHLNDLIPQPAGVSAAGTAATVTKPKYANAIHAAYTIVKEEGAGAL 187

Query: 69  FRGNGLNCVRIFPYSAVQFVVYEWCKKHI--FHVDGTVGKEQLLNWQRLSAGALCGGMSV 126
           +RG  L   R        F VY + K ++  +H      +E L +W+    G + G +  
Sbjct: 188 YRGVSLTAARQATNQGANFTVYSYLKDYLQKYH-----NRESLPSWETSCIGLISGAIGP 242

Query: 127 LATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
            +  PLD ++TRL    +                  ++ +  +  KEE G R LY+GI
Sbjct: 243 FSNAPLDTIKTRLQKDKSISSNSAWKK---------IYIIGTQLIKEE-GFRALYKGI 290

 Score = 45.8 bits (107), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 52/119 (43%), Gaps = 10/119 (8%)

Query: 31  PFERVKILLQVQSSTSAYN-HGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVV 89
           P + +K+ +Q+   T     HG I     +Y  EG   L++G G   + I P  A++F  
Sbjct: 33  PLDTIKVRMQIAKRTEGMRPHGFITTGRNIYSHEGFLALYKGLGAVVIGIIPKMAIRFSS 92

Query: 90  YEWCKKHIFHVDGTVGKE--QLLNWQRLSAGALCG-GMSVLATYPLDLVRTRLSIQTAN 145
           YE      F+ +    KE   +       AG   G   +VL   P+++V+ RL  Q  N
Sbjct: 93  YE------FYRNALTDKETRTITTGNTFLAGVGAGITEAVLVVNPMEVVKIRLQAQHLN 145

 Score = 42.7 bits (99), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 40/72 (55%), Gaps = 6/72 (8%)

Query: 30  SPFERVKILLQVQ---SSTSAYNHGIINAVG-QVYKEEGVAGLFRGNGLNCVRIFPYSAV 85
           +P + +K  LQ     SS SA+    I  +G Q+ KEEG   L++G     +R+ P  AV
Sbjct: 246 APLDTIKTRLQKDKSISSNSAWKK--IYIIGTQLIKEEGFRALYKGITPRVMRVAPGQAV 303

Query: 86  QFVVYEWCKKHI 97
            F VYE+ +KH+
Sbjct: 304 TFTVYEFVRKHL 315

>Kwal_23.3965
          Length = 307

 Score = 55.1 bits (131), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 37/116 (31%), Positives = 56/116 (48%), Gaps = 8/116 (6%)

Query: 25  SRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSA 84
           +R V +P + +KI LQ+Q +  A   GI+    ++ ++EGV  L++GN         Y +
Sbjct: 28  ARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNVPAMAMYILYGS 87

Query: 85  VQFVVYEWCKKHIFHVDGTVGKEQL-LNWQRLSAGALCGGMSVLATYPLDLVRTRL 139
            QF  Y    K        + K QL         GAL G  S +A+YP D++RTR 
Sbjct: 88  TQFTSYAILNK-------LLSKSQLPAQIHTGMVGALSGTCSAIASYPCDVLRTRF 136

 Score = 33.5 bits (75), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 36/89 (40%), Gaps = 16/89 (17%)

Query: 25  SRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYK----------------EEGVAGL 68
           S+T+V P + V+   QV       + G  N   + YK                +EG+  L
Sbjct: 218 SKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLAL 277

Query: 69  FRGNGLNCVRIFPYSAVQFVVYEWCKKHI 97
           + G  L   +  P + V   VYEWC + +
Sbjct: 278 YHGYTLGIAKSVPSTVVSLGVYEWCLRRM 306

 Score = 31.2 bits (69), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 21/90 (23%), Positives = 39/90 (43%), Gaps = 2/90 (2%)

Query: 52  IINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLN 111
           +++   ++++ EG  G F+G   + V I   ++     YE  K  IF          ++ 
Sbjct: 147 MLSTAQEIWRHEGFRGFFKGVSSSIVSIAVATSSILATYESVK--IFCEQRPDRDSSVIQ 204

Query: 112 WQRLSAGALCGGMSVLATYPLDLVRTRLSI 141
               SA  + G +S    +P+D VR R  +
Sbjct: 205 LLESSASVIAGIVSKTIVFPIDTVRKRYQV 234

>KLLA0D09889g complement(834904..835998) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, start by similarity
          Length = 364

 Score = 52.8 bits (125), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 75/167 (44%), Gaps = 8/167 (4%)

Query: 25  SRTVVSPFERVKILLQVQSS------TSAYNH-GIINAVGQVYKEEGVAGLFRGNGLNCV 77
           S  V  P E +K  LQ+Q         S YN+  + +AV  + + EG   LF G      
Sbjct: 164 SSFVYVPSEVLKTRLQLQGRYNNPFFRSGYNYKNLTDAVTTIVRREGWPTLFFGYKATLS 223

Query: 78  RIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRT 137
           R  P+S +QF  YE  ++  F V+     E L     +  GA  GG++ + T PLD+V+T
Sbjct: 224 RDLPFSGLQFAFYEKFRQLAFAVENKTFDEDLSLSNEIITGAAAGGLAGIITTPLDVVKT 283

Query: 138 RLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
           R+  Q  +                 + + ++  +K E G+ GL+ G+
Sbjct: 284 RIQTQLPDIPENSSQNLKQQTLTNSITKGMMTVYKTE-GLAGLFSGV 329

 Score = 38.5 bits (88), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 54/112 (48%), Gaps = 7/112 (6%)

Query: 32  FERVKILLQVQSSTSAYNHGIINAVGQVYKEEGV-AGLFRGNGLNCVRIFPYSAVQFVVY 90
            + VK   Q   ST  Y + +I A   +  EEG+  GL+ G     +  FP +A+ F  Y
Sbjct: 76  LDTVKTRQQGAPSTVKYKN-MIGAYRTIILEEGLRKGLYGGYSGAMLGSFPSAAIFFATY 134

Query: 91  EWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQ 142
           E+ K+ +    G  G  +   +  L+AG L   +S     P ++++TRL +Q
Sbjct: 135 EYTKRKMI---GEWGINE--TFSHLTAGFLGDFISSFVYVPSEVLKTRLQLQ 181

 Score = 32.3 bits (72), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 44/94 (46%), Gaps = 14/94 (14%)

Query: 28  VVSPFERVKILLQVQ-------SSTSAYNHGIINAVGQ----VYKEEGVAGLFRGNGLNC 76
           + +P + VK  +Q Q       SS +     + N++ +    VYK EG+AGLF G G   
Sbjct: 274 ITTPLDVVKTRIQTQLPDIPENSSQNLKQQTLTNSITKGMMTVYKTEGLAGLFSGVGPRF 333

Query: 77  VRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLL 110
           +     S++  ++Y+   K +   D  +  E+ L
Sbjct: 334 IWTSIQSSIMLLLYQVALKTL---DSKLSDEKKL 364

>KLLA0E23705g complement(2099965..2101071) highly similar to
           sp|P38127 Saccharomyces cerevisiae YBR192w RIM2
           mitochondrial carrier protein (MCF), start by similarity
          Length = 368

 Score = 52.8 bits (125), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 57/129 (44%), Gaps = 15/129 (11%)

Query: 56  VGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRL 115
           +G VY++EG   LF+G G N V + P  ++ F+ Y    K I+    T+   Q   W  L
Sbjct: 117 IGNVYRQEGFRSLFKGLGPNLVGVIPARSINFLTYG-TTKDIY--SRTLNNGQEAPWIHL 173

Query: 116 SAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEG 175
            A A  G  +   T P+ LV+TRL +  A                       +K+  +  
Sbjct: 174 LAAATAGWATSTVTNPIWLVKTRLQLDKAGTKTYKNSLD------------CIKSVVKNE 221

Query: 176 GIRGLYRGI 184
           G+ GLY+G+
Sbjct: 222 GVLGLYKGL 230

 Score = 47.0 bits (110), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 61/127 (48%), Gaps = 14/127 (11%)

Query: 25  SRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSA 84
           + TV +P   VK  LQ+  + +      ++ +  V K EGV GL++  GL+   +     
Sbjct: 183 TSTVTNPIWLVKTRLQLDKAGTKTYKNSLDCIKSVVKNEGVLGLYK--GLSASYLGSVEG 240

Query: 85  V-QFVVYEWCKKHI----------FHVDGTVGKEQLLNW-QRLSAGALCGGMSVLATYPL 132
           + Q+++YE  K+ I           H D     +++  W QR  +  L   ++ + TYP 
Sbjct: 241 ILQWILYEQMKRIIKERSIEKFGHIHEDAKSTSDKVKEWCQRSGSAGLAKFVASIVTYPH 300

Query: 133 DLVRTRL 139
           ++VRTRL
Sbjct: 301 EVVRTRL 307

>ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C
           (MRS4) - SH] complement(823895..824830) [936 bp, 311 aa]
          Length = 311

 Score = 52.8 bits (125), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 63/153 (41%), Gaps = 13/153 (8%)

Query: 28  VVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQF 87
           +++PF+ +K  LQ+  S S     +     ++Y+ EG+A  F           P++A+ F
Sbjct: 136 LMNPFDTIKQRLQLHPSDS-----MTKCAVRMYQREGIAAFFYSYPTTIAMNIPFAALNF 190

Query: 88  VVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTANXX 147
           V+YE   K IF+            W     G + G      T PLD V+T L I+ A+  
Sbjct: 191 VIYESSTK-IFNPSNNYNP-----WIHCLCGGISGATCAAITTPLDCVKTVLQIRGADSV 244

Query: 148 XXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGL 180
                   D  +       + KT+   G  RGL
Sbjct: 245 QSQLFKEADTFR--KAASAIHKTYGWSGFFRGL 275

 Score = 35.8 bits (81), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 55/129 (42%), Gaps = 16/129 (12%)

Query: 26  RTVVSPFERVKILLQVQSST--SAYNHGIINAVGQVYK---EEGVAGLFRGNGLNCVRIF 80
            +++ P + +K  +Q  S+T  SA      N + Q+ K    EG   L++G     +   
Sbjct: 32  HSIMFPIDAIKTRMQAVSTTGSSAATRLPSNMLAQIAKISTTEGSLALWKGVQSVVLGAG 91

Query: 81  PYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLAT----YPLDLVR 136
           P  AV F  YE CK  +      +  E     Q L   AL G ++ +A      P D ++
Sbjct: 92  PAHAVYFATYEMCKSRL------IDPEDRQTHQPLKT-ALSGTLATVAADALMNPFDTIK 144

Query: 137 TRLSIQTAN 145
            RL +  ++
Sbjct: 145 QRLQLHPSD 153

 Score = 34.7 bits (78), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 39/86 (45%), Gaps = 11/86 (12%)

Query: 28  VVSPFERVKILLQVQSSTSAYNH------GIINAVGQVYKEEGVAGLFRGNGLNCVRIFP 81
           + +P + VK +LQ++ + S  +           A   ++K  G +G FRG     +   P
Sbjct: 225 ITTPLDCVKTVLQIRGADSVQSQLFKEADTFRKAASAIHKTYGWSGFFRGLKPRIISNMP 284

Query: 82  YSAVQFVVYEWCKKHIF-----HVDG 102
            +A+ +  YE+ K  +F     H+D 
Sbjct: 285 ATAISWTSYEFAKHLLFTNSNAHLDN 310

>ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH]
           complement(693078..694217) [1140 bp, 379 aa]
          Length = 379

 Score = 52.8 bits (125), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 40/123 (32%), Positives = 63/123 (51%), Gaps = 12/123 (9%)

Query: 25  SRTVVSPFERVKILLQVQSSTSA--YNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPY 82
           S  +V P +  K  LQ Q + S   Y  GI+  +  + ++EGVAGL++G     +  FP 
Sbjct: 98  SGIMVCPLDVAKTRLQAQGAGSGERYYRGIVGTLSAILRDEGVAGLYKGLAPIVLGYFPT 157

Query: 83  SAVQFVVYEWCK-KHIFHVDGTVGKEQLLNWQRLSAGAL-CGGMSVLATYPLDLVRTRLS 140
             + F VYE CK ++  ++ G         +   +A AL  G +S   T P+ +V+TRL 
Sbjct: 158 WMLYFSVYEKCKQRYPSYLPG--------GFVSHAASALTAGAISTALTNPIWVVKTRLM 209

Query: 141 IQT 143
           IQ+
Sbjct: 210 IQS 212

 Score = 43.9 bits (102), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 74/167 (44%), Gaps = 23/167 (13%)

Query: 25  SRTVVSPFERVKILLQVQSSTS--AYNH-GIINAVGQVYKEEGVAGLFRGNGLNCVRIFP 81
           S  + +P   VK  L +QS  S  + N+   ++A  ++Y+ EG+   + G   +   +F 
Sbjct: 194 STALTNPIWVVKTRLMIQSDVSRDSTNYRSTLDAFRKMYRSEGLKVFYSGLVPSLFGLF- 252

Query: 82  YSAVQFVVYE----WCKKHIFHVDGTVGKEQLLNWQRL-SAGALCGGMSVLATYPLDLVR 136
           + A+ F VYE    W  ++    DG       L   RL  A  L   ++ + TYP +++R
Sbjct: 253 HVAIHFPVYEKLKIWLHRNTPAADGQRLDHNKLQLDRLIVASCLSKVVASVITYPHEILR 312

Query: 137 TRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRG 183
           TR+ ++ +               PP +  LL +    EG + G Y G
Sbjct: 313 TRMQVRHSGV-------------PPSLLNLLGRIRASEGYV-GFYSG 345

 Score = 30.4 bits (67), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 39/79 (49%), Gaps = 12/79 (15%)

Query: 108 QLLNWQRLSA--GALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWE 165
           QLL+  +++A  GAL G +S +   PLD+ +TRL  Q A                 G+  
Sbjct: 79  QLLDDTQVTAVSGALAGFVSGIMVCPLDVAKTRLQAQGAGSGERYYR---------GIVG 129

Query: 166 LLVKTFKEEGGIRGLYRGI 184
            L    ++E G+ GLY+G+
Sbjct: 130 TLSAILRDE-GVAGLYKGL 147

>Sklu_2430.10 YKL120W, Contig c2430 18856-19830
          Length = 324

 Score = 52.0 bits (123), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 56/194 (28%), Positives = 86/194 (44%), Gaps = 26/194 (13%)

Query: 4   KQLAKQESSI-AFIXXXXXXXXSRTVVSPFERVKILLQVQSSTSAYNHGI----INAVGQ 58
           K  A++ S + +FI        + TV +PFE VK  +Q+Q   SA N  I      A+G 
Sbjct: 15  KSAAQKVSKVGSFIAGGLAACIAVTVTNPFELVKTRMQLQGEMSATNQRIYRNPFQALGV 74

Query: 59  VYKEEGVAGLFRG--------NGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLL 110
           ++K EGV GL RG         GLN  R+  Y  ++ V+        F  +    K Q +
Sbjct: 75  IFKNEGVKGLQRGLVSAYVYQIGLNGSRLGFYEPIRTVL-----NKTFFPESDPHKLQNV 129

Query: 111 NWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKT 170
               ++AGA  G +  +   PL LV+TR+   +             ++        L   
Sbjct: 130 AVN-VTAGATSGIIGAIVGSPLFLVKTRMQSYSNAIKIGEQTHYTSMSNG------LATI 182

Query: 171 FKEEGGIRGLYRGI 184
           FK+E G+ GL+RG+
Sbjct: 183 FKKE-GVLGLFRGV 195

 Score = 41.2 bits (95), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/161 (28%), Positives = 68/161 (42%), Gaps = 23/161 (14%)

Query: 28  VVSPFERVKILLQVQSST-----SAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPY 82
           V SP   VK  +Q  S+        +   + N +  ++K+EGV GLFRG     +R    
Sbjct: 146 VGSPLFLVKTRMQSYSNAIKIGEQTHYTSMSNGLATIFKKEGVLGLFRGVDAAILRTGAG 205

Query: 83  SAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQ 142
           S+VQ  +Y   K  +   D  + KE       LS+     G+ ++   P D+V TR+  Q
Sbjct: 206 SSVQLPIYNTTKNFLLQND--IMKEGTA-LHLLSSTVTGLGVGIVMN-PWDVVLTRVYNQ 261

Query: 143 TANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRG 183
             N                G  + + KT K E GI  LY+G
Sbjct: 262 KGNTYK-------------GPIDCMFKTIKIE-GIGALYKG 288

 Score = 30.0 bits (66), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 38/77 (49%), Gaps = 2/77 (2%)

Query: 28  VVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQF 87
           V++P++ V  L +V +       G I+ + +  K EG+  L++G G    RI P++ +  
Sbjct: 247 VMNPWDVV--LTRVYNQKGNTYKGPIDCMFKTIKIEGIGALYKGFGAQLFRIAPHTILCL 304

Query: 88  VVYEWCKKHIFHVDGTV 104
              E   K ++ V+  +
Sbjct: 305 TFMEQTMKLVYAVESRI 321

>CAGL0H03839g 359987..360835 highly similar to sp|P38921
           Saccharomyces cerevisiae YNL003c PET8, start by
           similarity
          Length = 282

 Score = 51.6 bits (122), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 56/110 (50%), Gaps = 7/110 (6%)

Query: 34  RVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAG----LFRGNGLNCVRIFPYSAVQFVV 89
           RV   +  Q S +  +H     + ++ K E   G    L+RG     +R  P++ +QF +
Sbjct: 111 RVPAEVVKQRSQTHASHSSWETLREILKNENGEGVRRNLYRGWSTTIMREIPFTCIQFPL 170

Query: 90  YEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRL 139
           YE+ KK    +D +   +++  W+    G++ GG++   T PLD ++TRL
Sbjct: 171 YEYMKKVWAELDES---DRVEPWKGAVCGSIAGGIAAATTTPLDFLKTRL 217

 Score = 28.9 bits (63), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 23/42 (54%)

Query: 53 INAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCK 94
          + A G  ++  G  G++RG G   V   P +++ F+ Y+ CK
Sbjct: 33 LQAKGGFFRNGGYRGVYRGLGSAVVASAPGASLFFITYDTCK 74

>Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement
          Length = 310

 Score = 51.6 bits (122), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 65/134 (48%), Gaps = 13/134 (9%)

Query: 53  INAVGQVYKEEGVAGLFRGNGLNCVRIFPYS--AVQFVVYEWCKKHIFHVDGTVGKEQLL 110
           ++ + ++Y+ EG+AG +RG       +F  S  A+ F VY+  K H F       K++L 
Sbjct: 163 VDGIKKLYRIEGLAGFWRGL---VPSLFGVSQGAIYFTVYDTLKYHYFAAKHVDKKKKLS 219

Query: 111 NWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKT 170
           N + ++  +L   +SV A YPL L++       +N          +      VW+L+   
Sbjct: 220 NLEYITITSLSKMVSVTAVYPLQLLK-------SNLQSFEVSTVINPKTSHRVWKLITTI 272

Query: 171 FKEEGGIRGLYRGI 184
           +  + G+ GLY+G+
Sbjct: 273 YVRD-GVTGLYKGL 285

 Score = 38.9 bits (89), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 35/71 (49%), Gaps = 4/71 (5%)

Query: 25  SRTVVSPFERVKILLQVQSSTSAYN----HGIINAVGQVYKEEGVAGLFRGNGLNCVRIF 80
           S T V P + +K  LQ    ++  N    H +   +  +Y  +GV GL++G   N +R  
Sbjct: 234 SVTAVYPLQLLKSNLQSFEVSTVINPKTSHRVWKLITTIYVRDGVTGLYKGLLANLIRAV 293

Query: 81  PYSAVQFVVYE 91
           P + + F VYE
Sbjct: 294 PSTCITFCVYE 304

 Score = 36.6 bits (83), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 37/75 (49%), Gaps = 15/75 (20%)

Query: 113 QRLSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWEL---LVK 169
           + + +G   G ++ ++T+PLDLV+ RL +   N             KP G +++   +VK
Sbjct: 10  KEMISGLTAGTITTVSTHPLDLVKVRLQLLATN------------KKPQGYYDVVKRIVK 57

Query: 170 TFKEEGGIRGLYRGI 184
             K+    R  YRG+
Sbjct: 58  DSKQHSFFRETYRGL 72

>YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial
           oxaloacetate transporter, member of the mitochondrial
           carrier (MCF) family of membrane transporters [975 bp,
           324 aa]
          Length = 324

 Score = 51.6 bits (122), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 51/167 (30%), Positives = 74/167 (44%), Gaps = 19/167 (11%)

Query: 27  TVVSPFERVKILLQVQSSTSAYNHGI----INAVGQVYKEEGVAGLFRGNGLNCVRIFP- 81
           TV +P E +KI +Q+Q   SA    +    I  +  ++K EG+ GL +  GLN   I+  
Sbjct: 38  TVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQK--GLNAAYIYQI 95

Query: 82  -YSAVQFVVYEWCK---KHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRT 137
             +  +   YE  +     +F  D    K Q +     S GA  G +  +   PL LV+T
Sbjct: 96  GLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFS-GAASGIIGAVIGSPLFLVKT 154

Query: 138 RLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
           RL                +     GVW  LV  FK E G++GL+RGI
Sbjct: 155 RLQ------SYSEFIKIGEQTHYTGVWNGLVTIFKTE-GVKGLFRGI 194

 Score = 43.9 bits (102), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 67/159 (42%), Gaps = 23/159 (14%)

Query: 30  SPFERVKILLQ-----VQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSA 84
           SP   VK  LQ     ++     +  G+ N +  ++K EGV GLFRG     +R    S+
Sbjct: 147 SPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSS 206

Query: 85  VQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTA 144
           VQ  +Y   K  +   D       L     L+A  + G    +   P D++ TR+  Q  
Sbjct: 207 VQLPIYNTAKNILVKNDLMKDGPAL----HLTASTISGLGVAVVMNPWDVILTRIYNQKG 262

Query: 145 NXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRG 183
                      D+ K P   + LVKT + E G+  LY+G
Sbjct: 263 -----------DLYKGP--IDCLVKTVRIE-GVTALYKG 287

 Score = 27.7 bits (60), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 17/77 (22%), Positives = 37/77 (48%), Gaps = 2/77 (2%)

Query: 28  VVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQF 87
           V++P++   IL ++ +       G I+ + +  + EGV  L++G      RI P++ +  
Sbjct: 246 VMNPWDV--ILTRIYNQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCL 303

Query: 88  VVYEWCKKHIFHVDGTV 104
              E   K ++ ++  V
Sbjct: 304 TFMEQTMKLVYSIESRV 320

>Scas_645.9
          Length = 391

 Score = 51.6 bits (122), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 79/167 (47%), Gaps = 12/167 (7%)

Query: 27  TVVSPFERVKILLQ----VQSSTSAYNHGIINAVGQVYKEEGVAG----LFRGNGLNCVR 78
           + V+P E +K  LQ    V  ST+++   +   + +  +E  ++G    LF+G  +   R
Sbjct: 201 STVAPLELLKTKLQSIPRVSKSTTSW-MMVKELLKETRQEMRISGASNALFKGLEITLWR 259

Query: 79  IFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNW-QRLSAGALCGGMSVLATYPLDLVRT 137
             P+SA+ +  YE+CK H++ +D +     L  +      G++ G ++ L T+P D+ +T
Sbjct: 260 DVPFSAIYWGSYEFCKTHLW-MDTSKSHSNLTFFINSFIGGSISGTIAALVTHPFDVGKT 318

Query: 138 RLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
           R  I              DI +   +++ L   +K EG    LY G+
Sbjct: 319 RWQISFMGNNDKSVVKSPDIEQTKNMFKFLRNIWKLEGW-GALYTGL 364

 Score = 41.6 bits (96), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 50/101 (49%), Gaps = 7/101 (6%)

Query: 39  LQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIF 98
           L  ++S+  +N G + A  +++K EG+  L+RG  +N +   P + V F  YE+ +    
Sbjct: 120 LNCKNSSVRFN-GTLEAFNKIWKLEGITTLWRGISINLLMAIPANIVYFTGYEYLR---- 174

Query: 99  HVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRL 139
             D +        +  L  GA+   ++     PL+L++T+L
Sbjct: 175 --DNSPLATSSPTFNPLMCGAIARILAASTVAPLELLKTKL 213

>CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534
           Saccharomyces cerevisiae YDL119c, hypothetical start
          Length = 297

 Score = 51.2 bits (121), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 55/119 (46%), Gaps = 18/119 (15%)

Query: 38  LLQVQSSTSAYNH-GIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKH 96
           +++V+  ++ YN+  I  A   +  +EG+ G FRG G  C+R  PYS +  ++YE  K  
Sbjct: 130 IIKVRYESTLYNYKSIAEAAKSIAAQEGIRGFFRGFGPTCLRDAPYSGLYVLLYEKLK-- 187

Query: 97  IFHVDGTVGKEQLLNWQ-------------RLSAGALCGGMSVLATYPLDLVRTRLSIQ 142
             H   T+  + LL                  ++  L   M+   T P D ++TR+ ++
Sbjct: 188 --HTLPTILPKSLLQLDSEGRYTAYTSTAINSTSAILSASMATTVTAPFDTIKTRMQLE 244

>YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [1101 bp, 366 aa]
          Length = 366

 Score = 51.2 bits (121), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 63/130 (48%), Gaps = 12/130 (9%)

Query: 27  TVVSPFERVKILLQV--QSSTSAYN----HGIINAVGQVYKEEGVA-GLFRGNGLNCVRI 79
           T ++P E VK  LQ   +SS S         ++N   Q  K  G +  LF+G  +   R 
Sbjct: 174 TSIAPLELVKTKLQSIPRSSKSTKTWMMVKDLLNETRQEMKMVGPSRALFKGLEITLWRD 233

Query: 80  FPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNW----QRLSAGALCGGMSVLATYPLDLV 135
            P+SA+ +  YE CK+ ++ +D T    +  NW       ++G + G ++ + T+P D+ 
Sbjct: 234 VPFSAIYWSSYELCKERLW-LDSTRFASKDANWVHFINSFASGCISGMIAAICTHPFDVG 292

Query: 136 RTRLSIQTAN 145
           +TR  I   N
Sbjct: 293 KTRWQISMMN 302

 Score = 37.0 bits (84), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 47/101 (46%), Gaps = 7/101 (6%)

Query: 39  LQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIF 98
           L  ++S+  +N G + A  ++   EG+  L+RG  L  +   P + V F  YE    +I 
Sbjct: 93  LHCKNSSLKFN-GTLEAFTKIASVEGITSLWRGISLTLLMAIPANMVYFSGYE----YIR 147

Query: 99  HVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRL 139
            V         LN   L  GA+    +  +  PL+LV+T+L
Sbjct: 148 DVSPIASTYPTLN--PLFCGAIARVFAATSIAPLELVKTKL 186

>AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH]
           complement(164665..165762) [1098 bp, 365 aa]
          Length = 365

 Score = 50.8 bits (120), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 68/171 (39%), Gaps = 29/171 (16%)

Query: 31  PFERVKILLQVQSSTSAYN-----------HGIIN------AVGQVYKEEGVAGLFRGNG 73
           PF+ VK  LQ      AY             G+++       +  VY +EG   LF+G G
Sbjct: 69  PFDVVKTRLQSDVFHGAYKTQATARTNVVYQGLMHFRETVGIIQNVYTQEGFRSLFKGLG 128

Query: 74  LNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLD 133
            N V + P  ++ F  Y   K     +   +   Q   W    AGA  G  +  AT P+ 
Sbjct: 129 PNLVGVIPARSINFFTYGVTKDTASRL---LNDGQEAPWIHFLAGATAGWATSTATNPIW 185

Query: 134 LVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
           LV+TRL +  A              +    W+ L    + E GI GLY+G+
Sbjct: 186 LVKTRLQLDKAADGRSR--------RYKNSWDCLKGVMRNE-GILGLYKGL 227

 Score = 34.7 bits (78), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 65/146 (44%), Gaps = 25/146 (17%)

Query: 13  IAFIXXXXXXXXSRTVVSPFERVKILLQVQSSTSAYNHGIINA---VGQVYKEEGVAGLF 69
           I F+        + T  +P   VK  LQ+  +    +    N+   +  V + EG+ GL+
Sbjct: 165 IHFLAGATAGWATSTATNPIWLVKTRLQLDKAADGRSRRYKNSWDCLKGVMRNEGILGLY 224

Query: 70  RG---NGLNCVRIFPYSAVQFVVYEWCKKHIFHVD-----GTVGKEQLLNWQRL------ 115
           +G   + L  V     S +Q+V+YE  K HI         G + +E    + ++      
Sbjct: 225 KGLSASYLGSVE----SILQWVLYEQMK-HIIRQRSIEEFGDISEENKTTYMKVKEWCQR 279

Query: 116 --SAGALCGGMSVLATYPLDLVRTRL 139
             SAGA     S+L TYP ++VRTRL
Sbjct: 280 SGSAGAAKLFASIL-TYPHEVVRTRL 304

>Kwal_27.12081
          Length = 369

 Score = 50.8 bits (120), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 70/175 (40%), Gaps = 32/175 (18%)

Query: 28  VVSPFERVKILLQ---VQSSTSAYNHG---------------IINAVGQVYKEEGVAGLF 69
           V  PF+ VK  LQ    QS+ +  +H                    +  +YK EG   LF
Sbjct: 69  VTCPFDVVKTRLQSDVFQSTYANLSHNKSSNVVSSGIRHFRETFGIISNLYKLEGFRSLF 128

Query: 70  RGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLAT 129
           +G G N V + P  ++ F  Y    K I+      G+E    W  L + A  G  +  AT
Sbjct: 129 KGLGPNLVGVIPARSINFFTYG-TTKQIYSRAFNNGEEA--PWIHLISAATAGWATSTAT 185

Query: 130 YPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
            P+ L++TRL +  A                   W+ L    ++E G  GLY+G+
Sbjct: 186 NPIWLIKTRLQLDKAGHTRQYK----------NSWDCLKHIIQKE-GFFGLYKGL 229

 Score = 32.7 bits (73), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 63/142 (44%), Gaps = 19/142 (13%)

Query: 13  IAFIXXXXXXXXSRTVVSPFERVKILLQVQSS--TSAYNHGIINAVGQVYKEEGVAGLFR 70
           I  I        + T  +P   +K  LQ+  +  T  Y +   + +  + ++EG  GL++
Sbjct: 169 IHLISAATAGWATSTATNPIWLIKTRLQLDKAGHTRQYKNSW-DCLKHIIQKEGFFGLYK 227

Query: 71  GNGLNCVRIFPYSAV-QFVVYEWCKK-----------HIFHVDGTVGKEQLLNW-QRLSA 117
           G  L+   +     + Q+++YE  K+           HI   +     E++  W QR  +
Sbjct: 228 G--LSASYLGSVEGILQWLLYEQMKQMIKMRSIEKFGHISEGEKNTS-EKIKEWCQRSGS 284

Query: 118 GALCGGMSVLATYPLDLVRTRL 139
             L   ++ + TYP ++VRTRL
Sbjct: 285 AGLAKFLASIVTYPHEVVRTRL 306

 Score = 28.5 bits (62), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 23/41 (56%)

Query: 51  GIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYE 91
           G+I +   + KEEG+A ++ G   + +R  P S + F  +E
Sbjct: 320 GLIQSFRVIIKEEGLASMYGGLTPHLLRTVPNSIIMFGTWE 360

>CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, hypothetical start
          Length = 307

 Score = 50.1 bits (118), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 59/121 (48%), Gaps = 12/121 (9%)

Query: 25  SRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSA 84
           +RT ++P + VKI LQV    + +N    N +  + K EG+ G ++GN    +    Y  
Sbjct: 29  ARTCIAPLDTVKIKLQV----TPHNKNA-NVLINILKREGIRGFWKGNVPGSIMYIIYGG 83

Query: 85  VQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSA--GALCGGMSVLATYPLDLVRTRLSIQ 142
            QF  Y +    +       G +  ++ Q  S   G+L G  S LA+YP D++RTR +  
Sbjct: 84  AQFGSYTYIGSFL-----RGGLDLNISPQLYSCLVGSLAGMTSSLASYPFDVLRTRFAAN 138

Query: 143 T 143
           +
Sbjct: 139 S 139

 Score = 47.0 bits (110), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 58/135 (42%), Gaps = 5/135 (3%)

Query: 54  NAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQ 113
           + +  ++  EG+ G F G G + + I   +A+ F VYE  K           +       
Sbjct: 148 DEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLL 207

Query: 114 RLSAGALCGGMSVLATYPLDLVRTRLSIQTA-NXXXXXXXXXXDIAKPPGVWELL---VK 169
              AG + G  S LAT+PLD VR R+ I+ + N          DI K       L   + 
Sbjct: 208 NELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGIS 267

Query: 170 TFKEEGGIRGLYRGI 184
             ++EG +  LYRG+
Sbjct: 268 MVQQEGPL-SLYRGV 281

>CAGL0F08305g complement(827705..828829) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 374

 Score = 49.7 bits (117), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 59/126 (46%), Gaps = 11/126 (8%)

Query: 27  TVVSPFERVKILLQVQSSTSAYNHGII------NAVGQVYKEEGVA-GLFRGNGLNCVRI 79
           T V+P E +K  LQ   S+S  N  +I      N +       GVA  +F+G  +   R 
Sbjct: 182 TSVAPLELIKTKLQSIPSSSMKNGSVIMYRDLFNEIKSEIAMRGVAQTMFKGLEITLWRD 241

Query: 80  FPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLS----AGALCGGMSVLATYPLDLV 135
            P+SA+ +  YE+ K  + ++  +   +   NW   +     G + G ++ + T+P D+ 
Sbjct: 242 VPFSAIYWASYEFYKTKVAYLSPSTFDKNSSNWFHFTNSFLGGFISGSLAAICTHPFDVG 301

Query: 136 RTRLSI 141
           +TR  I
Sbjct: 302 KTRQQI 307

 Score = 35.4 bits (80), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 42/90 (46%), Gaps = 6/90 (6%)

Query: 50  HGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQL 109
           +G + A  ++ K EGV  L+RG  +  +   P + V F  YE+ +          G    
Sbjct: 111 NGTLEAFEKIAKFEGVTTLWRGISITLLMAIPANVVYFTGYEYVRDR----SPLNGLYPT 166

Query: 110 LNWQRLSAGALCGGMSVLATYPLDLVRTRL 139
           +N   L  GA    ++  +  PL+L++T+L
Sbjct: 167 IN--PLICGAFARTLAATSVAPLELIKTKL 194

>AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033)
           [1035 bp, 344 aa]
          Length = 344

 Score = 49.3 bits (116), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 44/172 (25%), Positives = 70/172 (40%), Gaps = 20/172 (11%)

Query: 27  TVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEE-------GVAGLFRGNGLNCVRI 79
           T ++P E ++  LQ     +      I  +G + +E        G   LF+G  +   R 
Sbjct: 152 TTIAPLELLRTRLQ-SVPRARDTERTIYLIGDLLREMRHEVSVMGYRALFKGLEITLWRD 210

Query: 80  FPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGM----SVLATYPLDLV 135
            P+SA+ +  YE+CK   +            NW        CG M    + L T+P D+ 
Sbjct: 211 VPFSAIYWGTYEFCKTQFWARHAATHNAS--NWDHFIGSFACGSMGGAVAALLTHPFDVG 268

Query: 136 RTRLSIQTANXXXXX---XXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
           +TR+ I  A+             D ++  G++  L    K E GIR LY G+
Sbjct: 269 KTRMQIAIASPQQLTVGGKATKTDDSR--GMFSFLNAIRKSE-GIRALYTGL 317

 Score = 35.4 bits (80), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 43/94 (45%), Gaps = 6/94 (6%)

Query: 46  SAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVG 105
           +A   G +  + ++ + EG+  L+RG G+  V   P + V F  YE  +      D +  
Sbjct: 77  AARLQGTLEGLRKIAQLEGLPTLWRGLGITLVMAVPANVVYFSGYEALR------DNSPL 130

Query: 106 KEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRL 139
             +L     L  GA    ++     PL+L+RTRL
Sbjct: 131 ASRLPVANPLVCGAFARILAATTIAPLELLRTRL 164

 Score = 28.5 bits (62), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 23/47 (48%)

Query: 49  NHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKK 95
           + G+ + +  + K EG+  L+ G     ++I P  A+    YE  KK
Sbjct: 294 SRGMFSFLNAIRKSEGIRALYTGLLPRVMKIAPSCAIMISTYELSKK 340

>KLLA0E15532g complement(1383230..1384210) similar to sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4 RNA splicing
           protein and member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 326

 Score = 49.3 bits (116), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/159 (23%), Positives = 64/159 (40%), Gaps = 18/159 (11%)

Query: 28  VVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQF 87
           +++PF+ +K  LQ+QS +S  +  +      +YK EG    F           P++A+ F
Sbjct: 151 LMNPFDTIKQRLQLQSKSS--DSSMWRMAFNIYKNEGPMAFFYSYPTTLAMNIPFAALNF 208

Query: 88  VVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTANXX 147
           V+YE   K  F+            W     G + G      T PLD ++T L I+ ++  
Sbjct: 209 VIYESSTK-FFNPTNAYNP-----WIHCLCGGIAGATCAAVTTPLDCIKTVLQIRGSDTV 262

Query: 148 XXXXXXXXDIAKPP--GVWELLVKTFKEEGGIRGLYRGI 184
                   +  K     +W        +  G +G +RG+
Sbjct: 263 HVESFKTANTFKKAAQAIW--------QSYGWKGFWRGL 293

 Score = 34.7 bits (78), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 26/130 (20%), Positives = 48/130 (36%), Gaps = 16/130 (12%)

Query: 52  IINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLN 111
           ++  + ++   EG   L+RG     +   P  AV F  YE+CK+ +          Q L 
Sbjct: 78  LLQQISRISSTEGSLALWRGVQSMVMGAGPAHAVYFATYEFCKEQLIDAKD-FNTHQPLK 136

Query: 112 WQRLSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTF 171
                  A     +++   P D ++ RL +Q+ +                 +W +    +
Sbjct: 137 TAVSGVAATVAADALMN--PFDTIKQRLQLQSKSSDS-------------SMWRMAFNIY 181

Query: 172 KEEGGIRGLY 181
           K EG +   Y
Sbjct: 182 KNEGPMAFFY 191

 Score = 30.8 bits (68), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 17/77 (22%), Positives = 36/77 (46%), Gaps = 6/77 (7%)

Query: 28  VVSPFERVKILLQVQSSTSAY------NHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFP 81
           V +P + +K +LQ++ S + +       +    A   +++  G  G +RG     +   P
Sbjct: 243 VTTPLDCIKTVLQIRGSDTVHVESFKTANTFKKAAQAIWQSYGWKGFWRGLQPRVISNIP 302

Query: 82  YSAVQFVVYEWCKKHIF 98
            +A+ +  YE+ K  +F
Sbjct: 303 ATAISWTSYEFAKHLLF 319

>Scas_379.2
          Length = 301

 Score = 49.3 bits (116), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 34/157 (21%), Positives = 68/157 (43%), Gaps = 17/157 (10%)

Query: 28  VVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQF 87
           +++PF+ +K  +Q+ ++T+ +N        Q+YK EG +  +           P++A  F
Sbjct: 135 LMNPFDTLKQRMQLNTNTTVWN-----VTKQIYKNEGFSAFYYSYPTTLAMNIPFAAFNF 189

Query: 88  VVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTANXX 147
           ++YE   K     + T     L++     +G L G      T PLD ++T L ++ +   
Sbjct: 190 MIYESATKFF---NPTNDYNPLVH---CLSGGLSGATCAAITTPLDCIKTVLQVRGSE-- 241

Query: 148 XXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
                    + K    ++   K   +  G +G +RG+
Sbjct: 242 ----SVSLQVMKEANTFQKATKAIYQVHGAKGFWRGL 274

 Score = 38.5 bits (88), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/154 (22%), Positives = 66/154 (42%), Gaps = 29/154 (18%)

Query: 26  RTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAV 85
            +V+ P + +K  +Q  S+ S  N  +++ + ++   EG   L++G     +   P  AV
Sbjct: 38  HSVMFPIDALKTRIQSTSAKSTSN--MLSQMAKISTAEGSLALWKGVQSVILGAGPAHAV 95

Query: 86  QFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLAT----YPLDLVRTRLSI 141
            F  YE+ KK++      + ++ +   Q L   AL G ++ +A      P D ++ R+ +
Sbjct: 96  YFATYEYTKKYL------IDEKDMQTHQPLKT-ALSGTVATIAADALMNPFDTLKQRMQL 148

Query: 142 QTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEG 175
            T                   VW +  + +K EG
Sbjct: 149 NTNTT----------------VWNVTKQIYKNEG 166

 Score = 32.0 bits (71), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 33/77 (42%), Gaps = 7/77 (9%)

Query: 28  VVSPFERVKILLQVQSSTSAY------NHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFP 81
           + +P + +K +LQV+ S S         +    A   +Y+  G  G +RG         P
Sbjct: 224 ITTPLDCIKTVLQVRGSESVSLQVMKEANTFQKATKAIYQVHGAKGFWRGLQPRVFANMP 283

Query: 82  YSAVQFVVYEWCKKHIF 98
            +A+ +  YE C KH  
Sbjct: 284 ATAIAWTAYE-CAKHFL 299

>YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondrial
           inner membrane citrate transport protein, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [900 bp, 299 aa]
          Length = 299

 Score = 49.3 bits (116), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 42/156 (26%), Positives = 65/156 (41%), Gaps = 18/156 (11%)

Query: 25  SRTVVSPFERVKILL--QVQSSTSAYNH---GIINAVGQVYKEEGVAGLFRGNGLNCVRI 79
           S   V+PFE +K  L    QS+T  Y++   G++     + +++G +GL+RG     +R 
Sbjct: 123 SVAAVTPFEAIKTALIDDKQSATPKYHNNGRGVVRNYSSLVRDKGFSGLYRGVLPVSMRQ 182

Query: 80  FPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRL 139
               AV+   Y   K  I     +   + L +      GA  G ++V +T PLD V+TR+
Sbjct: 183 AANQAVRLGCYNKIKTLIQDYTDSPKDKPLSSGLTFLVGAFSGIVTVYSTMPLDTVKTRM 242

Query: 140 SIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEG 175
                           D  K           FKEEG
Sbjct: 243 Q-------------SLDSTKYSSTMNCFATIFKEEG 265

 Score = 28.9 bits (63), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 27/61 (44%), Gaps = 2/61 (3%)

Query: 31  PFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVY 90
           P + VK  +Q   ST       +N    ++KEEG+   ++G      R+     + F +Y
Sbjct: 234 PLDTVKTRMQSLDSTK--YSSTMNCFATIFKEEGLKTFWKGATPRLGRLVLSGGIVFTIY 291

Query: 91  E 91
           E
Sbjct: 292 E 292

>Scas_716.29
          Length = 316

 Score = 48.9 bits (115), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 54/117 (46%), Gaps = 7/117 (5%)

Query: 25  SRTVVSPFERVKILLQVQSS-TSAYNHGIINAV-GQVYKEEGVAGLFRGNGLNCVRIFPY 82
           +RTV++P + +KI LQ++ S T     G++  + G +  E G+   ++GN    +    Y
Sbjct: 36  ARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKGNVPGTMMYVLY 95

Query: 83  SAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRL 139
              QF  Y +            G+      Q L  GAL G  S   +YP D++RTR 
Sbjct: 96  GGAQFSSYSFYNNLFGETSDMNGQ-----LQSLVVGALAGMTSSFVSYPTDVLRTRF 147

 Score = 48.5 bits (114), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 53/111 (47%), Gaps = 7/111 (6%)

Query: 34  RVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWC 93
           R + +     + S+ +HG      +++  EG+ G FRG   +   I   +++ F  YE  
Sbjct: 144 RTRFIANQDVALSSLSHG----CKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYESI 199

Query: 94  KKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTA 144
           K    + D    +    N+ R SA ++ G  S + TYPLD +R R+ ++ +
Sbjct: 200 K---IYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNS 247

 Score = 29.6 bits (65), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/71 (23%), Positives = 33/71 (46%), Gaps = 10/71 (14%)

Query: 113 QRLSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFK 172
           Q L AG++ G ++     PLD ++ RL ++ +               P G+ +++     
Sbjct: 24  QSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQA----------PSGLLKMMKGMIL 73

Query: 173 EEGGIRGLYRG 183
            EGG+R  ++G
Sbjct: 74  NEGGLRSFWKG 84

>KLLA0F03212g 302915..303832 highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w ACR1 succinate-fumarate
           transporter, start by similarity
          Length = 305

 Score = 48.9 bits (115), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 56/134 (41%), Gaps = 16/134 (11%)

Query: 54  NAVGQVY---KEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLL 110
           NAV   Y   KEEG + L+RG  L   R        F VY   K+ +    G   +E L 
Sbjct: 154 NAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFL---QGYHNQEMLP 210

Query: 111 NWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKT 170
           +W+    G + G +   +  PLD ++TRL    +            I K     +L+   
Sbjct: 211 SWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGK-----QLI--- 262

Query: 171 FKEEGGIRGLYRGI 184
             +E G R LY+GI
Sbjct: 263 --QEEGFRALYKGI 274

 Score = 36.6 bits (83), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 38/71 (53%), Gaps = 4/71 (5%)

Query: 30  SPFERVKILLQVQSSTSAYNHGI--INAVG-QVYKEEGVAGLFRGNGLNCVRIFPYSAVQ 86
           +P + +K  LQ   ST   + G+  I  +G Q+ +EEG   L++G     +R+ P  AV 
Sbjct: 230 APLDTIKTRLQKDKSTKNMS-GLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVT 288

Query: 87  FVVYEWCKKHI 97
           F  YE+ +K +
Sbjct: 289 FTAYEFIRKEL 299

 Score = 35.8 bits (81), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 33/65 (50%), Gaps = 3/65 (4%)

Query: 31 PFERVKILLQVQSS---TSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQF 87
          P + +K+ +Q+  +   +     G I   G++Y+ EG    ++G G   + I P  A++F
Sbjct: 30 PLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRF 89

Query: 88 VVYEW 92
            YE+
Sbjct: 90 SSYEF 94

>CAGL0K11616g complement(1121834..1122796) highly similar to
           sp|P32332 Saccharomyces cerevisiae YKL120w, hypothetical
           start
          Length = 320

 Score = 48.9 bits (115), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (43%), Gaps = 25/170 (14%)

Query: 27  TVVSPFERVKILLQVQSSTSAYNHGI----INAVGQVYKEEGVAGLFRG--------NGL 74
           TV +P E VKI +Q+Q    A N  I      A+G V++ EG+ GL +G          L
Sbjct: 34  TVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGLVAAYIYQIAL 93

Query: 75  NCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDL 134
           N  R+  Y  ++ V+        F+ D    K Q +    + AGA  G +  +   PL L
Sbjct: 94  NGSRLGFYEPIRAVM-----NKTFYPDQESHKVQSVGIN-VFAGAASGIIGAVMGSPLFL 147

Query: 135 VRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
           V+TRL                +     GVW  L   +  E G++GL+RGI
Sbjct: 148 VKTRLQ------SYSNAIKIGEQTHYTGVWNGLKTIYMTE-GVKGLFRGI 190

 Score = 47.8 bits (112), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 66/159 (41%), Gaps = 23/159 (14%)

Query: 30  SPFERVKILLQVQSST-----SAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSA 84
           SP   VK  LQ  S+        +  G+ N +  +Y  EGV GLFRG     +R    S+
Sbjct: 143 SPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSS 202

Query: 85  VQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTA 144
           VQ  +Y   K  +   D       L     L+A  + G    +   P D++ TR+  Q  
Sbjct: 203 VQLPIYNTAKNFLLRNDIMEDGPSL----HLTASTISGLGVAVVMNPWDVILTRIYNQKG 258

Query: 145 NXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRG 183
                      D+ K P   + LVKT K E GI  LY+G
Sbjct: 259 -----------DLYKGP--IDCLVKTVKIE-GITALYKG 283

>Kwal_55.20868
          Length = 380

 Score = 48.1 bits (113), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 40/123 (32%), Positives = 59/123 (47%), Gaps = 16/123 (13%)

Query: 28  VVSPFERVKILLQVQ---SSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSA 84
            V P +  K  LQ Q   S+ S Y  GI+  +  + ++EG  GL++G     +  FP   
Sbjct: 92  TVCPLDVAKTRLQAQGLHSNPSNYYKGILGTLTTIIRDEGARGLYKGLVPIIMGYFPTWM 151

Query: 85  VQFVVYEWCKK---HIFHVDGTVGKEQLLNWQRLSAGALCGG-MSVLATYPLDLVRTRLS 140
           + F VYE  KK    IF            ++   SA AL  G +S + T P+ +V+TRL 
Sbjct: 152 IYFSVYERSKKLYPRIF---------PSFDFISHSASALTAGTVSTILTNPVWVVKTRLM 202

Query: 141 IQT 143
           +QT
Sbjct: 203 LQT 205

 Score = 44.7 bits (104), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 40/81 (49%), Gaps = 8/81 (9%)

Query: 25  SRTVVSPFERVKILLQVQSSTS--------AYNHGIINAVGQVYKEEGVAGLFRGNGLNC 76
           + T+  P E ++  +Q+++  +           HG+I  +   YK EG+ G + G   N 
Sbjct: 291 ASTLTYPHEILRTRMQLKAYPTDPLAALQKTSRHGLIRLIKHTYKSEGLRGFYSGFTANL 350

Query: 77  VRIFPYSAVQFVVYEWCKKHI 97
            R  P SA+  V +E+ +K++
Sbjct: 351 ARTLPASAITLVSFEYFRKYL 371

 Score = 40.0 bits (92), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 70/155 (45%), Gaps = 10/155 (6%)

Query: 34  RVKILLQVQ-SSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEW 92
           + +++LQ   +  S +     +A  ++Y  EG+   + G   + + +F + A+ F +YE 
Sbjct: 198 KTRLMLQTHVNKNSTHYTSTFDAFHKMYTTEGLRTFYAGLLPSLLGLF-HVAIHFPIYEK 256

Query: 93  CKKHIFHVDGTVGK--EQLLNWQRLSAGALCGGM-SVLATYPLDLVRTRLSIQTANXXXX 149
            K  + H   ++ +  +  LN  RL   +    M +   TYP +++RTR+ ++       
Sbjct: 257 LKVWL-HCTPSMSRTEDHNLNLARLIIASSASKMVASTLTYPHEILRTRMQLKAYPTDPL 315

Query: 150 XXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
                       G+  L+  T+K E G+RG Y G 
Sbjct: 316 AALQKTSRH---GLIRLIKHTYKSE-GLRGFYSGF 346

 Score = 29.6 bits (65), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 32/68 (47%), Gaps = 9/68 (13%)

Query: 117 AGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGG 176
           +GA+ G ++ +   PLD+ +TRL  Q  +                G+   L    ++EG 
Sbjct: 81  SGAMAGFLAGVTVCPLDVAKTRLQAQGLHSNPSNYYK--------GILGTLTTIIRDEGA 132

Query: 177 IRGLYRGI 184
            RGLY+G+
Sbjct: 133 -RGLYKGL 139

>CAGL0J04114g complement(384321..385232) similar to sp|Q99297
           Saccharomyces cerevisiae YOR222w ODC2 or sp|Q03028
           Saccharomyces cerevisiae YPL134c ODC1, start by
           similarity
          Length = 303

 Score = 47.8 bits (112), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 75/165 (45%), Gaps = 30/165 (18%)

Query: 28  VVSPFERVKILLQVQ-----SSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPY 82
           V+ P + VK  +Q+Q      S  AYN G+I+ +GQ+ K EG + L++G     +   P 
Sbjct: 25  VMYPLDVVKTRMQLQVGSGTGSGVAYN-GVIDCLGQIVKREGFSRLYKGISSPMLMEAPK 83

Query: 83  SAVQFVV---YEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRL 139
            A +F     Y+   K ++ VD      +L     + +G+L G        P +LV+ RL
Sbjct: 84  RATKFACNDSYQKMFKDLYGVD------KLTQQISILSGSLAGVTEACVIVPFELVKIRL 137

Query: 140 SIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
             Q  N            +K  G  E++ KT +E  GI  LY G+
Sbjct: 138 --QDVN------------SKFNGPMEVVFKTIRET-GILSLYNGL 167

 Score = 32.3 bits (72), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 33/68 (48%), Gaps = 8/68 (11%)

Query: 117 AGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGG 176
           +GA  G   +L  YPLD+V+TR+ +Q  +                GV + L +  K EG 
Sbjct: 14  SGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYN-------GVIDCLGQIVKREGF 66

Query: 177 IRGLYRGI 184
            R LY+GI
Sbjct: 67  SR-LYKGI 73

 Score = 29.3 bits (64), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 71/185 (38%), Gaps = 17/185 (9%)

Query: 2   DLKQLAKQESSIAFIXXXXXXXXSRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYK 61
           DL  + K    I+ +           V+ PFE VKI  ++Q   S +N G +  V +  +
Sbjct: 100 DLYGVDKLTQQISILSGSLAGVTEACVIVPFELVKI--RLQDVNSKFN-GPMEVVFKTIR 156

Query: 62  EEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALC 121
           E G+  L+ G      R   ++   F V       IF +   + K +  N ++ +   + 
Sbjct: 157 ETGILSLYNGLESTMWRNAFWNGGYFGV-------IFQIRALLPKAK-TNTEKTTNDLIA 208

Query: 122 GGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXD---IAKPPGVWELLVKTFKEEGGIR 178
           G +     Y  +   T LS+  +           D   + K    W  L K + EE G  
Sbjct: 209 GTIGGYCRYSTE--HTILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEE-GFT 265

Query: 179 GLYRG 183
            LY+G
Sbjct: 266 ALYKG 270

>Kwal_23.3529
          Length = 395

 Score = 48.1 bits (113), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 61/125 (48%), Gaps = 7/125 (5%)

Query: 25  SRTVVSPFERVKILLQVQSS------TSAYNH-GIINAVGQVYKEEGVAGLFRGNGLNCV 77
           S  V  P E +K  LQ+Q         S YN+  + +A+  + + EG   LF G      
Sbjct: 194 SSVVYVPSEVLKTRLQLQGCYNNPHFHSGYNYRNLRDAITAIVRLEGWQTLFFGYKATLC 253

Query: 78  RIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRT 137
           R  P+SA QF  YE  ++  F ++G    + L     L  GA  GG++ + T P+D+++T
Sbjct: 254 RDLPFSAFQFAFYEKFRQWAFTLEGKTPSQDLSLLNELLTGAAAGGLAGIITTPMDVIKT 313

Query: 138 RLSIQ 142
           R+  Q
Sbjct: 314 RIQTQ 318

 Score = 36.6 bits (83), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 58/117 (49%), Gaps = 7/117 (5%)

Query: 27  TVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVA-GLFRGNGLNCVRIFPYSAV 85
           +V+   + VK   Q   +   Y + +I+A  +++ EEG+  GL+ G     +  FP +A+
Sbjct: 101 SVMHSLDTVKTRQQGAPNAPKYRN-MISAYQKIFMEEGIRRGLYGGYTAAMLGSFPSAAI 159

Query: 86  QFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQ 142
            F  YE  K+ +  +D     E L     L+AG     +S +   P ++++TRL +Q
Sbjct: 160 FFGTYELTKRKL--IDDWGVNETL---SHLTAGLSGDLVSSVVYVPSEVLKTRLQLQ 211

 Score = 27.7 bits (60), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 36/79 (45%), Gaps = 9/79 (11%)

Query: 28  VVSPFERVKILLQVQ-SSTSAYN--------HGIINAVGQVYKEEGVAGLFRGNGLNCVR 78
           + +P + +K  +Q Q  ST A +        + +I  +  VY+ EG  G F G G   + 
Sbjct: 304 ITTPMDVIKTRIQTQMPSTVASDSTRLVRIENSLIKGLTAVYRSEGTLGFFSGVGPRFIW 363

Query: 79  IFPYSAVQFVVYEWCKKHI 97
               S++  ++Y+   K +
Sbjct: 364 TSIQSSIMLLLYQVTLKSL 382

>YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiamine
           pyrophosphate transporter, controls import of thiamine
           pyrophosphate during growth on fermentative carbon
           sources, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 47.8 bits (112), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 60/141 (42%), Gaps = 8/141 (5%)

Query: 25  SRTVVSPFERVKILLQVQSST--SAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPY 82
           +R++ +P + +KI LQ+  +     +   ++     + K EG+   ++GN    +    Y
Sbjct: 30  ARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGNIPGSLLYVTY 89

Query: 83  SAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQ 142
            + QF  Y    +++       G E  L+   L  GA  G  S + +YP D++RTRL   
Sbjct: 90  GSAQFSSYSLFNRYL----TPFGLEARLH--SLVVGAFAGITSSIVSYPFDVLRTRLVAN 143

Query: 143 TANXXXXXXXXXXDIAKPPGV 163
                        DI K  G+
Sbjct: 144 NQMHSMSITREVRDIWKLEGL 164

 Score = 42.0 bits (97), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 73/164 (44%), Gaps = 7/164 (4%)

Query: 25  SRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSA 84
           S  V  PF+ ++   ++ ++   ++  I   V  ++K EG+ G F+G+  +   I   ++
Sbjct: 126 SSIVSYPFDVLRT--RLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTAS 183

Query: 85  VQFVVYEWCKKHIFHVDGTVGKEQLLNWQRL--SAGALCGGMSVLATYPLDLVRTRLSIQ 142
           + F  YE  + +    + T    +      L  SAG + G ++ + T+PL+ +R R+   
Sbjct: 184 IMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFM 243

Query: 143 TANXXXXXXXXXXDIA--KPPGVWELLVKTFKEEGGIRGLYRGI 184
            +                K  G   + ++  K+E G+  LYRGI
Sbjct: 244 NSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQE-GVSSLYRGI 286

 Score = 32.3 bits (72), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 35/74 (47%), Gaps = 14/74 (18%)

Query: 112 WQRLSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPG--VWELLVK 169
           W+ L AGA+ G ++   T P+D ++ RL +  AN             KP G  V E+   
Sbjct: 17  WKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGL-----------KPFGSQVMEVARS 65

Query: 170 TFKEEGGIRGLYRG 183
             K E GIR  ++G
Sbjct: 66  MIKNE-GIRSFWKG 78

 Score = 28.1 bits (61), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 20/34 (58%)

Query: 58  QVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYE 91
           Q+ K+EGV+ L+RG  +   +  P + V F  YE
Sbjct: 272 QILKQEGVSSLYRGILVALSKTIPTTFVSFWGYE 305

>YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate
           transporter, specific for 2-oxoadipate and
           2-oxoglutarate, member of the mitochondrial carrier
           family (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 47.4 bits (111), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 77/183 (42%), Gaps = 35/183 (19%)

Query: 15  FIXXXXXXXXSRTVVSPFERVKILLQVQSSTSA----------YNHGIINAVGQVYKEEG 64
           FI          TV+ P + VK   Q++ +T            YN G+I+ + ++ K+EG
Sbjct: 16  FISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYN-GVIDCLKKIVKKEG 74

Query: 65  VAGLFRGNGLNCVRIFPYSAVQFVV---YEWCKKHIFHVDGTVGKEQLLNWQRLSAGALC 121
            + L+RG     +   P  A +F     Y+   K++F+ + T  K        ++AGA  
Sbjct: 75  FSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKIS------IAAGASA 128

Query: 122 GGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLY 181
           G        P +L++ R+    ++                G  + L KT K E GI GLY
Sbjct: 129 GMTEAAVIVPFELIKIRMQDVKSSYL--------------GPMDCLKKTIKNE-GIMGLY 173

Query: 182 RGI 184
           +GI
Sbjct: 174 KGI 176

 Score = 38.9 bits (89), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 76/157 (48%), Gaps = 18/157 (11%)

Query: 28  VVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQF 87
           V+ PFE +KI  ++Q   S+Y  G ++ + +  K EG+ GL++G      R   ++   F
Sbjct: 135 VIVPFELIKI--RMQDVKSSY-LGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYF 191

Query: 88  -VVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTANX 146
            V+Y+   ++   V  T G++       L AGA+ G +  +   P D+V++R  IQ+ + 
Sbjct: 192 GVIYQV--RNSMPVAKTKGQK---TRNDLIAGAIGGTVGTMLNTPFDVVKSR--IQSVDA 244

Query: 147 XXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRG 183
                     + K       L+  ++EE G R LY+G
Sbjct: 245 VSSA------VKKYNWCLPSLLVIYREE-GFRALYKG 274

 Score = 29.3 bits (64), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 34/65 (52%), Gaps = 5/65 (7%)

Query: 30  SPFERVKILLQ----VQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAV 85
           +PF+ VK  +Q    V S+   YN   + ++  +Y+EEG   L++G      R+ P  ++
Sbjct: 230 TPFDVVKSRIQSVDAVSSAVKKYNW-CLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSL 288

Query: 86  QFVVY 90
             VV+
Sbjct: 289 MLVVF 293

>Scas_640.25
          Length = 306

 Score = 47.4 bits (111), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/163 (28%), Positives = 75/163 (46%), Gaps = 24/163 (14%)

Query: 28  VVSPFERVKILLQVQSSTSA------YNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFP 81
           V+ P + VK  +Q+Q ST A      +  G+I+ + Q+ K+EG   +++G     +   P
Sbjct: 30  VMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMYKGISSPMLMEAP 89

Query: 82  YSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSI 141
             AV+F   +   K    V GT   +QL     + +GA  G    L   P +LV+ RL  
Sbjct: 90  KRAVKFASNDEFIKLWKSVFGT---KQLTQQISVLSGASAGITEALVIVPFELVKIRL-- 144

Query: 142 QTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
           Q  N            +K  G  E+L    K++ G++GLY G+
Sbjct: 145 QDVN------------SKFKGPVEVLKHIIKQD-GLKGLYSGV 174

 Score = 36.2 bits (82), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 36/71 (50%), Gaps = 6/71 (8%)

Query: 114 RLSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKE 173
           +  AGA+ G   ++  YPLD+V+TR+ +Q +                 GV + L +  K+
Sbjct: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYK-----GVIDCLSQIVKK 70

Query: 174 EGGIRGLYRGI 184
           EG +  +Y+GI
Sbjct: 71  EGPMH-MYKGI 80

 Score = 27.7 bits (60), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 35/67 (52%), Gaps = 8/67 (11%)

Query: 30  SPFERVKILLQVQSSTSAYNHGIIN------AVGQVYKEEGVAGLFRGNGLNCVRIFPYS 83
           +PF+ VK   ++QS  +   +G+        +V ++Y EEG   L++G     +R+ P  
Sbjct: 228 TPFDVVK--SRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGG 285

Query: 84  AVQFVVY 90
           AV  VV+
Sbjct: 286 AVLLVVF 292

>AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH]
           complement(1314627..1315508) [882 bp, 293 aa]
          Length = 293

 Score = 47.0 bits (110), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/157 (22%), Positives = 67/157 (42%), Gaps = 18/157 (11%)

Query: 28  VVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQF 87
           + +P   +K  +   S    Y     + V ++Y+ EGV   +RG   + + +    A+ F
Sbjct: 130 LTNPIWVIKTRIMATSRAGPYK-STFDGVYKLYQTEGVLAFWRGVVPSLLGV-SQGAIYF 187

Query: 88  VVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTANXX 147
            +Y+  K H  H      + +L   + +    +   +SV + YP  L++++L        
Sbjct: 188 ALYDTLKFHYLHSSTDKAERRLSVSEIIGITCISKMISVTSVYPFQLLKSKLQ------- 240

Query: 148 XXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
                   D   P G+ +L+   +  EG IRG YRG+
Sbjct: 241 --------DFGAPSGITQLVQTVYSREG-IRGFYRGL 268

 Score = 43.1 bits (100), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 35/70 (50%), Gaps = 4/70 (5%)

Query: 25  SRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSA 84
           S T V PF+ +K  LQ   + S    GI   V  VY  EG+ G +RG   N +R  P + 
Sbjct: 225 SVTSVYPFQLLKSKLQDFGAPS----GITQLVQTVYSREGIRGFYRGLSANLLRAVPATC 280

Query: 85  VQFVVYEWCK 94
           + F VYE  K
Sbjct: 281 ITFFVYENIK 290

>YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses mitochondrial
           splicing defects [945 bp, 314 aa]
          Length = 314

 Score = 47.0 bits (110), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 56/118 (47%), Gaps = 11/118 (9%)

Query: 25  SRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSA 84
           S  +++PF+ +K  +Q+ +S S +         Q+Y+ EG+A  +       V   P++A
Sbjct: 144 SDALMNPFDTIKQRIQLNTSASVWQ-----TTKQIYQSEGLAAFYYSYPTTLVMNIPFAA 198

Query: 85  VQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQ 142
             FV+YE   K +   + +     L++      G++ G      T PLD ++T L I+
Sbjct: 199 FNFVIYESSTKFL---NPSNEYNPLIH---CLCGSISGSTCAAITTPLDCIKTVLQIR 250

 Score = 39.7 bits (91), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 30/150 (20%), Positives = 59/150 (39%), Gaps = 19/150 (12%)

Query: 26  RTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAV 85
            +V+ P + +K  +Q  ++ S     +++ +  +   EG   L++G     +   P  AV
Sbjct: 48  HSVMFPIDALKTRIQSANAKSLSAKNMLSQISHISTSEGTLALWKGVQSVILGAGPAHAV 107

Query: 86  QFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTAN 145
            F  YE+CKK++     T         +   +GA     S     P D ++ R+ + T+ 
Sbjct: 108 YFGTYEFCKKNLIDSSDTQTHHPF---KTAISGACATTASDALMNPFDTIKQRIQLNTSA 164

Query: 146 XXXXXXXXXXDIAKPPGVWELLVKTFKEEG 175
                            VW+   + ++ EG
Sbjct: 165 ----------------SVWQTTKQIYQSEG 178

 Score = 30.4 bits (67), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 33/77 (42%), Gaps = 7/77 (9%)

Query: 28  VVSPFERVKILLQVQSSTSAY------NHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFP 81
           + +P + +K +LQ++ S +              A   +Y+  G  G +RG     V   P
Sbjct: 236 ITTPLDCIKTVLQIRGSQTVSLEIMRKADTFSKAASAIYQVYGWKGFWRGWKPRIVANMP 295

Query: 82  YSAVQFVVYEWCKKHIF 98
            +A+ +  YE C KH  
Sbjct: 296 ATAISWTAYE-CAKHFL 311

>Kwal_23.2913
          Length = 320

 Score = 47.0 bits (110), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 55/118 (46%), Gaps = 20/118 (16%)

Query: 28  VVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQF 87
           + +P ERVK++LQ   S S      + A   + +E GV  LF+G      R  P SA+ F
Sbjct: 158 ITAPTERVKVVLQTSESGS-----FLGAARTLIREGGVRSLFQGTLATLARDGPGSALYF 212

Query: 88  VVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALC-----GGMSV-LATYPLDLVRTRL 139
             YE  K+ +     T           LS  ++C      GMS+ +  +P+D ++T+L
Sbjct: 213 ASYEVSKRFLSRNQDT---------DALSVVSICVAGGVAGMSMWIGVFPIDTIKTKL 261

 Score = 36.6 bits (83), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 4/67 (5%)

Query: 29  VSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFV 88
           V P + +K  LQ    +S+ +  ++ A  ++Y   G+ G F G G   +R FP +A  F+
Sbjct: 251 VFPIDTIKTKLQ----SSSRSQSMVQAAREIYTRAGLRGFFPGLGPALMRSFPANAATFL 306

Query: 89  VYEWCKK 95
             E+  +
Sbjct: 307 GVEFTHQ 313

 Score = 30.4 bits (67), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 37/171 (21%), Positives = 67/171 (39%), Gaps = 40/171 (23%)

Query: 31  PFERVKILLQVQSSTSAYNHGIINAVGQVYKE----------EGVAGLFRGNGLNCVRIF 80
           PF+ +K+  Q   ++     G ++A+ +V  E            + G +RG     + + 
Sbjct: 48  PFDLLKVRCQSNQAS-----GTLDAISRVLHEAKSKSGPLPLNQIKGFYRGVIPPLLGVT 102

Query: 81  PYSAVQFVVYE-------WCKKHIFHVDGTVGKEQLLNWQRLS-AGALCGGMSVLATYPL 132
           P  AV F  Y+       W    +  + G+  K   L   +L+ AG      + L T P 
Sbjct: 103 PIFAVSFWGYDVGKRLVTWGSNPVTDIAGSSSKLTPLTTSQLALAGFFSAIPTTLITAPT 162

Query: 133 DLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRG 183
           +  R ++ +QT+                 G +    +T   EGG+R L++G
Sbjct: 163 E--RVKVVLQTSES---------------GSFLGAARTLIREGGVRSLFQG 196

>AFR253W [3445] [Homologous to ScYFR045W - SH]
           complement(892939..892986,893047..894033) [1035 bp, 344
           aa]
          Length = 344

 Score = 46.6 bits (109), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 54/120 (45%), Gaps = 11/120 (9%)

Query: 25  SRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSA 84
           +R V +  ER   LL  +   S++  G    V ++Y+  GV G  +G      R    S 
Sbjct: 173 ARPVQTAHER--WLLHYERQPSSHFAGT---VLEIYRTRGVRGFLQGAMPTIFRQLGNSV 227

Query: 85  VQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTA 144
           V+F  Y W       V      + L  +Q  +AGAL     V  T P+D+++TR+  +TA
Sbjct: 228 VRFTTYAWI------VQSLSPHKALDEYQAFAAGALSSAAVVALTQPIDVIKTRMQSKTA 281

>Kwal_47.18216
          Length = 333

 Score = 46.6 bits (109), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 68/191 (35%), Gaps = 50/191 (26%)

Query: 28  VVSPFERVKILLQVQ--------------------------------SSTSAYNHGIINA 55
           VV+P E VKI LQ Q                                ++T  Y + I  A
Sbjct: 127 VVNPMEVVKIRLQAQHVRYVPLKAQLAGSVTSSSATFSSATTATENVAATPKYRNAI-QA 185

Query: 56  VGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRL 115
              + KEEG   L+RG  L   R        F VY   K  +     T   + L +W+  
Sbjct: 186 AYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQT---DMLPSWETS 242

Query: 116 SAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLV--KTFKE 173
             G + G +   +  PLD ++TRL    +             +K  G   +L   +    
Sbjct: 243 LIGLISGALGPFSNAPLDTIKTRLQKDKST------------SKDSGWSRILAIGRQLIR 290

Query: 174 EGGIRGLYRGI 184
           E G R LY+GI
Sbjct: 291 EEGFRALYKGI 301

 Score = 40.8 bits (94), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 38/70 (54%), Gaps = 2/70 (2%)

Query: 30  SPFERVKILLQVQSSTSAYNH-GIINAVG-QVYKEEGVAGLFRGNGLNCVRIFPYSAVQF 87
           +P + +K  LQ   STS  +    I A+G Q+ +EEG   L++G     +R+ P  AV F
Sbjct: 257 APLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTF 316

Query: 88  VVYEWCKKHI 97
            VYE  +K +
Sbjct: 317 TVYELIRKKL 326

 Score = 36.2 bits (82), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 50/116 (43%), Gaps = 8/116 (6%)

Query: 31  PFERVKILLQVQSSTSAYNH---GIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQF 87
           P + +K+ +Q+ S          G I     +  +EG   L++G G   + I P  A++F
Sbjct: 30  PLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYKGLGAVVIGIIPKMAIRF 89

Query: 88  VVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCG-GMSVLATYPLDLVRTRLSIQ 142
             YE+ +  +   D   G     N     AG   G   +V+   P+++V+ RL  Q
Sbjct: 90  TSYEFFRTLL--ADRQTGVVSTGNT--FVAGVGAGITEAVMVVNPMEVVKIRLQAQ 141

>YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1122 bp, 373 aa]
          Length = 373

 Score = 46.2 bits (108), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 74/169 (43%), Gaps = 28/169 (16%)

Query: 25  SRTVVSPFERVKILLQVQSSTS----AYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIF 80
           S   V P +  K  LQ Q   +     Y  GI+  +  + ++EG  GL++G     +  F
Sbjct: 91  SGVAVCPLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTIVRDEGPRGLYKGLVPIVLGYF 150

Query: 81  PYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGAL-CGGMSVLATYPLDLVRTRL 139
           P   + F VYE+ KK  FH     G     ++   S  A+  G  S   T P+ +V+TRL
Sbjct: 151 PTWMIYFSVYEFSKK-FFH-----GIFPQFDFVAQSCAAITAGAASTTLTNPIWVVKTRL 204

Query: 140 SIQTANXXXXXXXXXXDIAKPP----GVWELLVKTFKEEGGIRGLYRGI 184
            +Q+            ++ + P    G ++   K F +E G + LY G+
Sbjct: 205 MLQS------------NLGEHPTHYKGTFDAFRKLFYQE-GFKALYAGL 240

 Score = 45.8 bits (107), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 43/168 (25%), Positives = 79/168 (47%), Gaps = 25/168 (14%)

Query: 25  SRTVVSPFERVKILLQVQSST---SAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFP 81
           S T+ +P   VK  L +QS+      +  G  +A  +++ +EG   L+ G   + + +F 
Sbjct: 190 STTLTNPIWVVKTRLMLQSNLGEHPTHYKGTFDAFRKLFYQEGFKALYAGLVPSLLGLF- 248

Query: 82  YSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRL-SAGALCGGMSVLATYPLDLVRTRLS 140
           + A+ F +YE  K   FH          +N QRL  A ++   ++   TYP +++RTR+ 
Sbjct: 249 HVAIHFPIYEDLKVR-FHCYSRENNTNSINLQRLIMASSVSKMIASAVTYPHEILRTRMQ 307

Query: 141 IQTANXXXXXXXXXXDIAKPPGV----WELLVKTFKEEGGIRGLYRGI 184
           +++            DI  P  +    + L+  T+ +E G++G Y G 
Sbjct: 308 LKS------------DI--PDSIQRRLFPLIKATYAQE-GLKGFYSGF 340

 Score = 37.0 bits (84), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 37/78 (47%), Gaps = 1/78 (1%)

Query: 28  VVSPFERVKILLQVQSS-TSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQ 86
           V  P E ++  +Q++S    +    +   +   Y +EG+ G + G   N VR  P SA+ 
Sbjct: 295 VTYPHEILRTRMQLKSDIPDSIQRRLFPLIKATYAQEGLKGFYSGFTTNLVRTIPASAIT 354

Query: 87  FVVYEWCKKHIFHVDGTV 104
            V +E+ +  + ++   V
Sbjct: 355 LVSFEYFRNRLENISTMV 372

 Score = 29.6 bits (65), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 31/68 (45%), Gaps = 8/68 (11%)

Query: 117 AGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGG 176
           +GA  G +S +A  PLD+ +TRL  Q                   G+   L    ++EG 
Sbjct: 83  SGAFAGFLSGVAVCPLDVAKTRLQAQGLQTRFENPYYR-------GIMGTLSTIVRDEGP 135

Query: 177 IRGLYRGI 184
            RGLY+G+
Sbjct: 136 -RGLYKGL 142

>KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida
           albicans peroxisomal membrane protein (by homology),
           start by similarity
          Length = 304

 Score = 46.2 bits (108), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 50/115 (43%), Gaps = 5/115 (4%)

Query: 53  INAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNW 112
           +  + ++Y + G+ G F G       +   + V +  YEWC K          K+ L  W
Sbjct: 50  LETIKEIYNKNGIIGYFLGLESAVYGMATTNFVYYYFYEWCAKT---ARTLTTKQYLSTW 106

Query: 113 QRLSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELL 167
           + + A  + G M+ +A+ P+ +  TR+++  +N          DI K  G   LL
Sbjct: 107 ESILASTIAGSMTAVASNPIWVANTRMTVAKSN--HSTLRTVIDIVKTDGPLTLL 159

>KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces
           cerevisiae YKL120w PMT, start by similarity
          Length = 319

 Score = 46.2 bits (108), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 50/168 (29%), Positives = 69/168 (41%), Gaps = 41/168 (24%)

Query: 30  SPFERVKILLQVQSS----------TSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRI 79
           SP   VK  +Q  S+          TSA+N      +  +++ EG+ GLFRG     +R 
Sbjct: 145 SPLFLVKTRMQSYSNAIHIGQQTHYTSAFN-----GLATIFRSEGIKGLFRGVDAAMLRT 199

Query: 80  FPYSAVQFVVYEWCK----KHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLV 135
              SAVQ  +Y  CK    KH    DGT           LS+     G+ V A  P D+V
Sbjct: 200 GIGSAVQLPIYNICKNFLLKHDLMNDGT-------GLHLLSSTIAGFGVGV-AMNPWDVV 251

Query: 136 RTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRG 183
            TR+  Q  N                G  +  +KT + E G+  LY+G
Sbjct: 252 LTRVYNQKGNLYS-------------GPIDCFIKTVRNE-GLSALYKG 285

 Score = 43.9 bits (102), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 81/183 (44%), Gaps = 25/183 (13%)

Query: 14  AFIXXXXXXXXSRTVVSPFERVKILLQVQSSTSAYNHGI----INAVGQVYKEEGVAGLF 69
           +F+        + TV +PF+ VK  +Q+Q    A    +    I A G ++K EG+AGL 
Sbjct: 23  SFVAGGLAACIAVTVTNPFDCVKTRMQLQGELHANAAKVYTNPIQAFGVIFKNEGIAGLQ 82

Query: 70  RG--------NGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALC 121
           +G          LN  R+  Y  ++ ++      ++F+ +    K Q +    ++AGA  
Sbjct: 83  KGLASAYLYQIALNGSRLGFYEPIRGIL-----NNVFYPNVESHKVQHIGIN-VAAGATS 136

Query: 122 GGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLY 181
           G +      PL LV+TR+    +N            A     +  L   F+ E GI+GL+
Sbjct: 137 GVVGAFIGSPLFLVKTRMQ-SYSNAIHIGQQTHYTSA-----FNGLATIFRSE-GIKGLF 189

Query: 182 RGI 184
           RG+
Sbjct: 190 RGV 192

 Score = 28.1 bits (61), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 15/65 (23%), Positives = 32/65 (49%)

Query: 37  ILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKH 96
           +L +V +       G I+   +  + EG++ L++G G   +RI P++ +     E   K 
Sbjct: 251 VLTRVYNQKGNLYSGPIDCFIKTVRNEGLSALYKGFGAQILRIGPHTVLCLTFMEQTLKL 310

Query: 97  IFHVD 101
           ++ V+
Sbjct: 311 VYSVE 315

>ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH]
           (771097..772119) [1023 bp, 340 aa]
          Length = 340

 Score = 45.8 bits (107), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 45/89 (50%), Gaps = 1/89 (1%)

Query: 51  GIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLL 110
           G ++A+ ++Y  EGVAGL+RG G + V  F  S   F  Y   +KH F +    G +   
Sbjct: 74  GALDALQRIYGAEGVAGLYRGLGSSTVAGFIQSFSYFFWYTLVRKHYFRLKQARGGDARF 133

Query: 111 NW-QRLSAGALCGGMSVLATYPLDLVRTR 138
           +  + L  G +    S L   P+++V TR
Sbjct: 134 STPEELVLGIVAAATSQLFVNPINVVATR 162

>YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of
           the mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses defects in
           splicing of mitochondrial introns [915 bp, 304 aa]
          Length = 304

 Score = 45.8 bits (107), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 69/161 (42%), Gaps = 25/161 (15%)

Query: 28  VVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQF 87
           +++PF+ VK  LQ+ +     N  + N   Q+Y+ EG A  +           P++A  F
Sbjct: 137 LMNPFDTVKQRLQLDT-----NLRVWNVTKQIYQNEGFAAFYYSYPTTLAMNIPFAAFNF 191

Query: 88  VVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMS----VLATYPLDLVRTRLSIQT 143
           ++YE   K  F+   +     L++        LCGG+S       T PLD ++T L ++ 
Sbjct: 192 MIYESASK-FFNPQNSYNP--LIH-------CLCGGISGATCAALTTPLDCIKTVLQVRG 241

Query: 144 ANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
           +           +I K    +    +   E  G +G +RG+
Sbjct: 242 SE------TVSIEIMKDANTFGRASRAILEVHGWKGFWRGL 276

 Score = 40.8 bits (94), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 55/122 (45%), Gaps = 11/122 (9%)

Query: 26  RTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAV 85
            +++ P + +K  +Q      A + G+I+ + ++   EG   L++G     +   P  AV
Sbjct: 38  HSLMFPIDALKTRVQAAGLNKAASTGMISQISKISTMEGSMALWKGVQSVILGAGPAHAV 97

Query: 86  QFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLAT----YPLDLVRTRLSI 141
            F  YE+CK  +      +  E +   Q +   AL G ++ +A      P D V+ RL +
Sbjct: 98  YFGTYEFCKARL------ISPEDMQTHQPMKT-ALSGTIATIAADALMNPFDTVKQRLQL 150

Query: 142 QT 143
            T
Sbjct: 151 DT 152

>Scas_489.4
          Length = 297

 Score = 45.4 bits (106), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 61/156 (39%), Gaps = 18/156 (11%)

Query: 25  SRTVVSPFERVKILL--QVQSSTSAYNH---GIINAVGQVYKEEGVAGLFRGNGLNCVRI 79
           S   V+PFE +K  L    Q+    Y +   G++   G + +++G+ GL+RG     +R 
Sbjct: 121 SVVAVTPFEAIKTALIDDKQALKPKYQNNGRGMLRNYGSLVRDQGIMGLYRGVLPVSMRQ 180

Query: 80  FPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRL 139
               AV+   Y   K  +           L +      GA  G ++V  T P+D V+TR+
Sbjct: 181 AANQAVRLGCYNKIKTMVQDYTNAPKDRPLSSGLTFIVGAFSGVVTVYTTMPIDTVKTRM 240

Query: 140 SIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEG 175
                           D  K         K FKEEG
Sbjct: 241 Q-------------SLDATKYTSTVNCFAKIFKEEG 263

 Score = 29.3 bits (64), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/82 (21%), Positives = 34/82 (41%), Gaps = 2/82 (2%)

Query: 10  ESSIAFIXXXXXXXXSRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLF 69
            S + FI        +     P + VK  +Q   +T   +   +N   +++KEEG+   +
Sbjct: 211 SSGLTFIVGAFSGVVTVYTTMPIDTVKTRMQSLDATKYTST--VNCFAKIFKEEGLKTFW 268

Query: 70  RGNGLNCVRIFPYSAVQFVVYE 91
           +G      R+     + F +YE
Sbjct: 269 KGATPRLGRLILSGGIVFTIYE 290

 Score = 27.7 bits (60), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 15/25 (60%)

Query: 117 AGALCGGMSVLATYPLDLVRTRLSI 141
           AGAL G +    TYP +  +TRL +
Sbjct: 16  AGALAGAIEASITYPFEFAKTRLQL 40

 Score = 27.7 bits (60), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 28/128 (21%), Positives = 52/128 (40%), Gaps = 7/128 (5%)

Query: 14  AFIXXXXXXXXSRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNG 73
           +FI          ++  PFE  K  LQ+   TS  +   +  +    K +G   ++ G  
Sbjct: 13  SFIAGALAGAIEASITYPFEFAKTRLQLIDKTSTASRNPLVLIYNTAKTQGTGAIYVGCP 72

Query: 74  LNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGM--SVLATYP 131
              V     + ++F+ ++  K  +   D   G+   L+  R     L  G+  SV+A  P
Sbjct: 73  AFIVGNTAKAGIRFLGFDTIKNML--RDPVTGE---LSGPRGVVAGLGAGLLESVVAVTP 127

Query: 132 LDLVRTRL 139
            + ++T L
Sbjct: 128 FEAIKTAL 135

>Kwal_26.7967
          Length = 297

 Score = 45.1 bits (105), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 64/156 (41%), Gaps = 18/156 (11%)

Query: 25  SRTVVSPFERVKILL--QVQSSTSAYNH---GIINAVGQVYKEEGVAGLFRGNGLNCVRI 79
           S   V+PFE +K  L    QS++  Y++   G++     +  ++G +GL+RG     +R 
Sbjct: 120 SVVAVTPFEAIKTALIDDKQSASPKYHNNGRGMLRNYSSLVYDKGFSGLYRGVLPVSMRQ 179

Query: 80  FPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRL 139
               AV+   Y   K  I     +   + L +      GA  G ++V  T P+D V+TR+
Sbjct: 180 AANQAVRLGCYNKIKTMIQDYTNSAKDKPLSSGMTFVVGAFSGIVTVYTTMPIDTVKTRM 239

Query: 140 SIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEG 175
                           D +K           F+EEG
Sbjct: 240 Q-------------SLDSSKYSSTINCFATVFREEG 262

 Score = 29.3 bits (64), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 29/61 (47%), Gaps = 2/61 (3%)

Query: 31  PFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVY 90
           P + VK   ++QS  S+     IN    V++EEG+   ++G      R+     + F +Y
Sbjct: 231 PIDTVKT--RMQSLDSSKYSSTINCFATVFREEGLKTFWKGATPRLGRLILSGGIVFTIY 288

Query: 91  E 91
           E
Sbjct: 289 E 289

 Score = 28.1 bits (61), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 19/36 (52%)

Query: 106 KEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSI 141
           K+Q+       AG+L G +    TYP +  +TRL +
Sbjct: 4   KKQVDPLHSFLAGSLAGAVEASITYPFEFAKTRLQL 39

>Kwal_23.4731
          Length = 314

 Score = 44.7 bits (104), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/158 (22%), Positives = 72/158 (45%), Gaps = 13/158 (8%)

Query: 28  VVSPFERVKILLQVQSSTSAYNHGII-NAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQ 86
           + +P   +K  +   SS ++  +    + + +VY  EG +G +RG   +   +    A+ 
Sbjct: 144 LTNPIWVIKTRIMSTSSQASERYKTTWDGIRKVYAHEGFSGFWRGLVPSLFGV-AQGAIY 202

Query: 87  FVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTANX 146
           F +Y+  +   F   G    E++ N + ++  ++   +SV A YP  L+++ L    A  
Sbjct: 203 FTIYDSLRHQYFARRGITEDEKMGNLENIAITSVSKMLSVTAVYPFQLLKSNLQSFAA-- 260

Query: 147 XXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
                    +       W  LVK+  ++ G++GLY+G+
Sbjct: 261 --------VEKRDSYRFWN-LVKSIHQKEGLQGLYKGL 289

 Score = 40.0 bits (92), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 38/68 (55%), Gaps = 1/68 (1%)

Query: 25  SRTVVSPFERVKILLQVQSSTSAYN-HGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYS 83
           S T V PF+ +K  LQ  ++    + +   N V  ++++EG+ GL++G   N +R  P +
Sbjct: 241 SVTAVYPFQLLKSNLQSFAAVEKRDSYRFWNLVKSIHQKEGLQGLYKGLSANLLRAIPST 300

Query: 84  AVQFVVYE 91
            + F +YE
Sbjct: 301 CITFCIYE 308

 Score = 30.4 bits (67), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 18/25 (72%)

Query: 117 AGALCGGMSVLATYPLDLVRTRLSI 141
           AG   G ++ +AT+PLDLV+ RL +
Sbjct: 19  AGLAAGTLTTIATHPLDLVKLRLQL 43

>KLLA0F04697g complement(461126..462049) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1 FAD carrier
           protein (MCF), mitochondrial, start by similarity
          Length = 307

 Score = 44.7 bits (104), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/178 (21%), Positives = 74/178 (41%), Gaps = 14/178 (7%)

Query: 8   KQESSIAFIXXXXXXXXSRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAG 67
           K  SS+  +        +  + +P   +K  +    S+  Y   I+NA+ ++Y EEG+  
Sbjct: 120 KMTSSMYLVSAGASGLATALLTNPMWVIKTRIMSTKSSQGYT-SILNAITRIYTEEGLKT 178

Query: 68  LFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVL 127
            +RG   +   +    A+ F +Y+  K    H    + + +L   + +   +L   +SV 
Sbjct: 179 FWRGLVPSLFGV-TQGALYFAIYDTLKLKYLHDRNDIQERRLNAVETIGIISLSKMISVS 237

Query: 128 ATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGIY 185
           + YPL L++T L  QT                       L+++     GI G Y+G++
Sbjct: 238 SVYPLQLLKTNL--QTFRTEHNENSKMNS----------LIRSIWHTNGIAGFYKGLF 283

 Score = 37.0 bits (84), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 36/73 (49%), Gaps = 1/73 (1%)

Query: 25  SRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSA 84
           S + V P + +K  LQ   +    N  + + +  ++   G+AG ++G   N VR  P + 
Sbjct: 235 SVSSVYPLQLLKTNLQTFRTEHNENSKMNSLIRSIWHTNGIAGFYKGLFANLVRAIPSTC 294

Query: 85  VQFVVYEWCKKHI 97
           + F VYE   KHI
Sbjct: 295 ITFGVYEHF-KHI 306

 Score = 27.7 bits (60), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 17/72 (23%), Positives = 32/72 (44%), Gaps = 16/72 (22%)

Query: 117 AGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGG 176
           +G   G ++ + T+PLDL++ RL +   +             KP   +  + +  K+  G
Sbjct: 18  SGLTAGTITTIVTHPLDLIKLRLQLAAIDL------------KPSSYYNQVQRIIKDGSG 65

Query: 177 IRGL----YRGI 184
            + L    YRG+
Sbjct: 66  TQQLLKEAYRGL 77

>Scas_709.9
          Length = 365

 Score = 44.7 bits (104), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 57/122 (46%), Gaps = 14/122 (11%)

Query: 28  VVSPFERVKILLQ---VQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSA 84
           +V P +  K  LQ   +QS  + Y  G++  +  +  +EGV GL++G     +  FP   
Sbjct: 81  IVCPLDVTKTRLQAQGIQSIENPYYRGVLGTMSTIVVDEGVRGLYKGLIPIILGYFPTWM 140

Query: 85  VQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLS---AGALCGGMSVLATYPLDLVRTRLSI 141
           + F VYE+ K         +    L N   +S   +    G  S + T P+ +V+TRL +
Sbjct: 141 IYFSVYEFAKD--------LYPRVLPNSDFISHSCSAITAGAASTVLTNPIWVVKTRLML 192

Query: 142 QT 143
           QT
Sbjct: 193 QT 194

 Score = 43.5 bits (101), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 79/167 (47%), Gaps = 21/167 (12%)

Query: 25  SRTVVSPFERVKILLQVQS---STSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFP 81
           S  + +P   VK  L +Q+    +  +  G I+A  ++  +EGV  L+ G   +   +  
Sbjct: 176 STVLTNPIWVVKTRLMLQTPLGESRTHYRGTIDAFKKIITQEGVRTLYTGLVPSMFGLL- 234

Query: 82  YSAVQFVVYEWCKKHIFHVDGTVG----KEQLLNWQRLSAGALCGGM-SVLATYPLDLVR 136
           + A+ F VYE  K  + H D   G    +E  L+  RL   +    M + + TYP +++R
Sbjct: 235 HVAIHFPVYEKLKNRL-HCDTITGGHNSQEHSLHLTRLIIASSASKMLASILTYPHEILR 293

Query: 137 TRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRG 183
           TR+ +++             I+K   + +L+ +T++ E G+ G Y G
Sbjct: 294 TRMQLKSDKLL---------ISK-HKLLDLIKRTYRYE-GLLGFYSG 329

 Score = 41.2 bits (95), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/98 (22%), Positives = 47/98 (47%), Gaps = 5/98 (5%)

Query: 9   QESSIAFIXXXXXXXXSRTVVS----PFERVKILLQVQSSTSAYN-HGIINAVGQVYKEE 63
           QE S+           S+ + S    P E ++  +Q++S     + H +++ + + Y+ E
Sbjct: 262 QEHSLHLTRLIIASSASKMLASILTYPHEILRTRMQLKSDKLLISKHKLLDLIKRTYRYE 321

Query: 64  GVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVD 101
           G+ G + G   N +R  P SA+  V +E+ +  +  ++
Sbjct: 322 GLLGFYSGFATNLLRTVPASAITLVSFEYFRNALLKIN 359

 Score = 31.2 bits (69), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 45/91 (49%), Gaps = 16/91 (17%)

Query: 99  HVDGTVGKEQL-LNWQRLSA--GALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXX 155
           H+  TV + +L L+  +++A  GAL G +S +   PLD+ +TRL  Q             
Sbjct: 49  HIASTVIQSKLHLSDPKITALSGALAGFLSGIIVCPLDVTKTRLQAQGIQ---------- 98

Query: 156 DIAKP--PGVWELLVKTFKEEGGIRGLYRGI 184
            I  P   GV   +     +E G+RGLY+G+
Sbjct: 99  SIENPYYRGVLGTMSTIVVDE-GVRGLYKGL 128

>KLLA0A09383g complement(818752..819852) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 366

 Score = 44.3 bits (103), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 58/131 (44%), Gaps = 20/131 (15%)

Query: 27  TVVSPFERVKILLQV------QSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIF 80
           T V+P E +K  LQ        ++T      ++       +  G   LF+G  +   R  
Sbjct: 169 TTVAPLELIKTRLQSIPRSRKDTTTQMMFKDLLKETRNEIRSGGYKVLFKGLEITLWRDV 228

Query: 81  PYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNW----------QRLSAGALCGGMSVLATY 130
           P+SA+ +  YE+ KK+ F +D +   EQ L W               G++ G  + L T+
Sbjct: 229 PFSAIYWGSYEFYKKN-FWIDFS---EQCLRWNLSPNWDFFINSFIGGSVSGSSAALLTH 284

Query: 131 PLDLVRTRLSI 141
           P D+ +TR+ I
Sbjct: 285 PFDVGKTRMQI 295

 Score = 35.0 bits (79), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 33/147 (22%), Positives = 62/147 (42%), Gaps = 15/147 (10%)

Query: 39  LQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIF 98
           +Q ++S   +N     A  ++ + EG+A L+RG  +  +   P + V F  YE  + H  
Sbjct: 88  IQCKNSALRFN-STWEAFTKISEVEGLATLWRGLSITLLMAIPANVVYFSGYEMFRDH-- 144

Query: 99  HVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRL-SIQTANXXXXXXXXXXDI 157
               +  ++   +   L  GA    ++     PL+L++TRL SI  +           D+
Sbjct: 145 ----SPMRDSYPSLNPLFCGATARMVAATTVAPLELIKTRLQSIPRSRKDTTTQMMFKDL 200

Query: 158 AKPPGVWELLVKTFKEEGGIRGLYRGI 184
            K         +     GG + L++G+
Sbjct: 201 LKE-------TRNEIRSGGYKVLFKGL 220

>Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement
          Length = 296

 Score = 43.9 bits (102), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 57/120 (47%), Gaps = 5/120 (4%)

Query: 25  SRTVVSPFERVKILL--QVQSSTSAYNH---GIINAVGQVYKEEGVAGLFRGNGLNCVRI 79
           S   V+PFE +K  L    QS+T  Y++   G++     + +++G++GL+RG     +R 
Sbjct: 120 SVVAVTPFEAIKTALIDDKQSATPKYHNNGKGMLRNYTALVRKQGLSGLYRGVLPVSMRQ 179

Query: 80  FPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRL 139
               AV+   Y   K  +         + L +      GA  G ++V  T P+D V+TR+
Sbjct: 180 AANQAVRLGCYNKIKVMVQDYTNAPKDKPLSSGLTFVVGAFSGIVTVYTTMPIDTVKTRM 239

 Score = 32.3 bits (72), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 29/61 (47%), Gaps = 2/61 (3%)

Query: 31  PFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVY 90
           P + VK   ++QS  S      IN    ++KEEG+   ++G      R+F    + F VY
Sbjct: 231 PIDTVKT--RMQSLDSKRYSSTINCFTTIFKEEGLKAFWKGATPRLGRLFLSGGIVFTVY 288

Query: 91  E 91
           E
Sbjct: 289 E 289

 Score = 27.3 bits (59), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 31/139 (22%), Positives = 57/139 (41%), Gaps = 7/139 (5%)

Query: 3   LKQLAKQESSIAFIXXXXXXXXSRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKE 62
           + Q  + + S +FI          +V  PFE  K  LQ+    S  +   +  +    K 
Sbjct: 1   MSQSKQVDPSKSFIAGCLAGAVEASVTYPFEFAKTRLQLLDKASKASRNPLVLIYNTAKT 60

Query: 63  EGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCG 122
           +G+  ++ G     V     + V+F+ ++  K  +   D   G+   L+  R     L  
Sbjct: 61  QGIGSVYVGCPAFIVGNTAKAGVRFLGFDTIKNLL--RDPKTGE---LSGPRGVIAGLGA 115

Query: 123 GM--SVLATYPLDLVRTRL 139
           G+  SV+A  P + ++T L
Sbjct: 116 GLLESVVAVTPFEAIKTAL 134

>AGR383W [4694] [Homologous to ScYDL119C - SH]
           complement(1436769..1437650) [882 bp, 293 aa]
          Length = 293

 Score = 43.9 bits (102), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 60/128 (46%), Gaps = 18/128 (14%)

Query: 28  VVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQF 87
           V  P   +K+  + +S+  AYN G+  A   +++ EG  G F+G     +R  PY+ +  
Sbjct: 121 VTMPITVIKV--RYESTLYAYN-GLAEATRHIWRSEGARGFFKGAAATTLRDAPYAGLYV 177

Query: 88  VVYEWCKKHIFHV--DGTVGKEQLLNWQRLSAGA----------LCGGMSVLATYPLDLV 135
           ++YE  K+ +        +G ++     +L+A A          L   ++   T P D +
Sbjct: 178 LLYEQAKEMLPRALPATLLGADE---SGKLTAPASAMVNGVSAFLSASLATTLTAPFDTI 234

Query: 136 RTRLSIQT 143
           +TR+ +Q+
Sbjct: 235 KTRMQLQS 242

 Score = 29.6 bits (65), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 31/65 (47%), Gaps = 4/65 (6%)

Query: 27  TVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQ 86
           T+ +PF+ +K  +Q+QS    +  G +  +  +  EE    LF G  L   R    + + 
Sbjct: 226 TLTAPFDTIKTRMQLQS----HPVGFVQTLRHIVCEERARTLFDGLSLRLCRKAMSACIA 281

Query: 87  FVVYE 91
           + +YE
Sbjct: 282 WGIYE 286

>Scas_696.9
          Length = 312

 Score = 43.9 bits (102), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 64/139 (46%), Gaps = 26/139 (18%)

Query: 54  NAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQF----VVYEWCKKHIFHVDGTVGKEQL 109
           N    +Y +EG+ G+++G     +R       +F    +V +W +K      G    E  
Sbjct: 155 NVFRSIYAKEGLRGIYKGVNAVAIRQMTNWGSRFGFSRLVEDWVRK----ATGKTKPEDR 210

Query: 110 LN-WQRLSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLV 168
           LN W+++ A A+ GG+S     P++++R  +  +             D  +P  +   + 
Sbjct: 211 LNAWEKIGATAVGGGLSAW-NQPIEVIRVEMQSK-----------KEDPNRPKNL--TVA 256

Query: 169 KTFK---EEGGIRGLYRGI 184
           KTFK   +  G++GLYRG+
Sbjct: 257 KTFKYIMKTNGVKGLYRGV 275

>Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement
          Length = 305

 Score = 43.5 bits (101), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 53/117 (45%), Gaps = 7/117 (5%)

Query: 31  PFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVY 90
           PF+  K+ LQ    TS+     ++ V ++ K EG  G ++G     V +    +VQF V 
Sbjct: 43  PFDTTKVRLQ----TSSVPTTALDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVN 98

Query: 91  EWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGM--SVLATYPLDLVRTRLSIQTAN 145
           E  K+     +G  G  + L   +       GG   S LA+ P++ VR RL  QT  
Sbjct: 99  EAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLAS-PIEHVRIRLQTQTGT 154

 Score = 40.4 bits (93), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 50/112 (44%), Gaps = 7/112 (6%)

Query: 28  VVSPFERVKILLQVQSSTSAYN--HGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAV 85
           + SP E V+I LQ Q+ T A    HG ++ + ++        L RG     +R      V
Sbjct: 137 LASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNS---LMRGLTPTMLRESHGCGV 193

Query: 86  QFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRT 137
            F+ YE    +  H    V + ++  W+    GA  G    L  YPLD++++
Sbjct: 194 YFLTYEALIANELHKG--VSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKS 243

>Kwal_55.21338
          Length = 323

 Score = 43.5 bits (101), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 72/159 (45%), Gaps = 18/159 (11%)

Query: 27  TVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSA-V 85
           T  +P       + VQ S    + G ++ +  + K+EG++GLF+  GLN   I   +  +
Sbjct: 134 TAANPLWVANTRMTVQKS----DRGTLSTIFDIVKDEGISGLFK--GLNPALILVINPII 187

Query: 86  QFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTAN 145
           Q+ VYE  K  I     T  +    +W  +  GA+    +  +TYP   ++ R+ +   +
Sbjct: 188 QYTVYEQLKNWILSSRQT--RTLSPSWAFI-LGAVGKLAATGSTYPYVTMKARMHLLGEH 244

Query: 146 XXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
                       A P  +  L+ +  K++ GI GLYRGI
Sbjct: 245 KSSTA-------APPRSLLSLMAEIIKKD-GILGLYRGI 275

 Score = 35.0 bits (79), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 35/58 (60%)

Query: 34  RVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYE 91
           R+ +L + +SST+A    +++ + ++ K++G+ GL+RG G+  V+    +A  F   E
Sbjct: 237 RMHLLGEHKSSTAAPPRSLLSLMAEIIKKDGILGLYRGIGIKLVQSILTAAFLFFFKE 294

>Sklu_1275.1 , Contig c1275 314-1249
          Length = 311

 Score = 43.1 bits (100), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 56/114 (49%), Gaps = 7/114 (6%)

Query: 31  PFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVY 90
           PF+  K+ +Q    TS+ +   I  +  + K EG+   ++G  +  + +    + QF V 
Sbjct: 43  PFDITKVRMQ----TSSGSPTAIEVIKNLVKNEGLLAFYKGTLVPLIGVGACVSCQFGVN 98

Query: 91  EWCKKHIFHVDGTVGKEQLLN-WQRLSAGALCGGMSVLATYPLDLVRTRLSIQT 143
           E  K++   V+G   K+Q L+  Q  + G + G  +     P++ VR RL +QT
Sbjct: 99  EAMKRYFLRVNGY--KDQHLSLLQYYTCGFVSGSANAFLATPIEHVRIRLQLQT 150

 Score = 33.5 bits (75), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 50/112 (44%), Gaps = 7/112 (6%)

Query: 28  VVSPFERVKILLQVQSST--SAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAV 85
           + +P E V+I LQ+Q+     A   G ++ + ++ K++    L RG     +R      V
Sbjct: 135 LATPIEHVRIRLQLQTKALAKAEYRGSLDCMKKLLKQKA---LMRGFTATLMRTSHGFGV 191

Query: 86  QFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRT 137
            F+ YE    +       V ++ +  W+    GA  G      TYP D+V++
Sbjct: 192 YFLTYEALIMN--QNKNGVLRKDIPPWKVCVFGAFSGAFFWAMTYPFDVVKS 241

>KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces
           cerevisiae YNL003c PET8 member of the mitochondrial
           carrier (MCF) family, start by similarity
          Length = 274

 Score = 43.1 bits (100), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 70/155 (45%), Gaps = 22/155 (14%)

Query: 31  PFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVA-GLFRGNGLNCVRIFPYSAVQFVV 89
           P E +K   Q   + S+     + A+ +    EG+   L+RG     +R  P++ +QF +
Sbjct: 116 PAEVIKQRTQTHRTNSSLQ--TLQALLRNENGEGLRRNLYRGWSTTIMREIPFTCIQFPL 173

Query: 90  YEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXX 149
           YE+ KK    V G   KE+   WQ    G + GG++  AT PLD+++TR+ +   +    
Sbjct: 174 YEYMKKRWAEVQG---KERAAPWQGSVCGCIAGGIAAAATTPLDVLKTRIMLHHKSVSAL 230

Query: 150 XXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
                            L KT  +E G++  + G+
Sbjct: 231 H----------------LAKTMLQEEGVKVFFSGV 249

>Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement
          Length = 278

 Score = 43.1 bits (100), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 52/114 (45%), Gaps = 5/114 (4%)

Query: 28  VVSPFERVKILLQVQ--SSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAV 85
           V++P E +K  LQV   S+T   +  I+  +  V  E G  GL++G     +R     A 
Sbjct: 117 VLTPVELIKCKLQVSNLSTTKTSHTKILPTIKSVLSERGFLGLWQGQSGTFIRESGGGAA 176

Query: 86  QFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRL 139
            F  YE  K ++         EQ   W+ L++GA  G     + +P D +++ +
Sbjct: 177 WFTTYEVVKNYL---ASRRQAEQNTTWELLASGASAGLAFNASIFPADTIKSTM 227

 Score = 36.6 bits (83), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query: 44  STSAYNH-GIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYE 91
           ST   +H  + +A  ++Y  +G+AG +RG G+  +R  P +A  F  YE
Sbjct: 225 STMQTDHIDLSSATRKIYARQGIAGFYRGLGITLIRAVPANAAIFYTYE 273

 Score = 36.6 bits (83), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 29/67 (43%), Gaps = 13/67 (19%)

Query: 118 GALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGI 177
           G++ G +  +  YP D V+ RL  Q A+               P  W  +  T+  EG  
Sbjct: 13  GSIAGAVGKVIEYPFDTVKVRLQTQPAHMF-------------PTTWSCIKFTYDNEGLW 59

Query: 178 RGLYRGI 184
           RG Y+GI
Sbjct: 60  RGFYQGI 66

>Sklu_2442.8 YNL003C, Contig c2442 12309-13136
          Length = 275

 Score = 43.1 bits (100), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 55/110 (50%), Gaps = 6/110 (5%)

Query: 31  PFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGV-AGLFRGNGLNCVRIFPYSAVQFVV 89
           P E +K   Q   + S++       + Q    EGV   L+RG     +R  P++ +QF +
Sbjct: 115 PAEVIKQRTQTHKTNSSWQ--TFTKILQNENGEGVLRNLYRGWNTTIMREIPFTCIQFPL 172

Query: 90  YEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRL 139
           YE+ KK     +G   ++ +  WQ    G++ G ++   T PLD+++TRL
Sbjct: 173 YEFLKKTWAKRNG---QDHVAPWQGSVCGSVAGAIAAATTTPLDVLKTRL 219

>YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1
           mutant that affects mitochondrial HMG-like DNA-binding
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 43.1 bits (100), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 62/131 (47%), Gaps = 18/131 (13%)

Query: 58  QVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLN-WQRLS 116
            +YK+EG+ G+ +G     +R       +F +    +  I  + G   K+  LN ++++ 
Sbjct: 161 NIYKKEGIRGINKGVNAVAIRQMTNWGSRFGLSRLVEDGIRKITGKTNKDDKLNPFEKIG 220

Query: 117 AGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFK---E 173
           A AL GG+S     P++++R  +  +             D  +P  +   + KTFK   +
Sbjct: 221 ASALGGGLSAW-NQPIEVIRVEMQSK-----------KEDPNRPKNL--TVGKTFKYIYQ 266

Query: 174 EGGIRGLYRGI 184
             G++GLYRG+
Sbjct: 267 SNGLKGLYRGV 277

>Scas_667.22
          Length = 306

 Score = 43.1 bits (100), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 57/120 (47%), Gaps = 8/120 (6%)

Query: 28  VVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQF 87
           V  PF+  K+ LQ  S+ +      +  + ++ K EG  G ++G     + +    ++QF
Sbjct: 42  VGQPFDTTKVRLQTSSTPTT----AMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQF 97

Query: 88  VVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGM--SVLATYPLDLVRTRLSIQTAN 145
            V E  K+  FH        Q+L+  +     L GG+  S LA+ P++ VR RL  QT +
Sbjct: 98  GVNEAMKR-FFHSRNPDSTSQILSLPQYYICGLTGGITNSFLAS-PIEHVRIRLQTQTGS 155

 Score = 35.0 bits (79), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 51/118 (43%), Gaps = 5/118 (4%)

Query: 28  VVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQF 87
           + SP E V+I LQ Q+  S  N      +  + K     G  RG     +R        F
Sbjct: 138 LASPIEHVRIRLQTQTG-SGPNVEFKGPLDCIRKLRAQGGFMRGLTPTMLREGHGCGTYF 196

Query: 88  VVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTAN 145
           +VYE    +   ++    + ++  W+    GAL G    +  YPLD++++   +QT N
Sbjct: 197 LVYEAMVAN--EINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKS--VMQTDN 250

>Scas_718.5
          Length = 324

 Score = 42.7 bits (99), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 62/123 (50%), Gaps = 10/123 (8%)

Query: 28  VVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQF 87
           V  PF+  K+ +Q    TSA + G ++ + ++ K EGV   ++G+ +  V +    +VQF
Sbjct: 56  VGQPFDTTKVRMQ----TSAKSVGALDIIRKLVKNEGVWAFYKGSLIPIVGVGACVSVQF 111

Query: 88  VVYEWCKKHIFHVD---GTVGKEQLLNWQRLSAGALCGGM--SVLATYPLDLVRTRLSIQ 142
            V E  K+     +   GT  ++  L   +     L GG+  S LA+ P++ VR RL  Q
Sbjct: 112 GVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLAS-PIEHVRIRLQTQ 170

Query: 143 TAN 145
           T N
Sbjct: 171 TGN 173

 Score = 40.4 bits (93), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 57/124 (45%), Gaps = 19/124 (15%)

Query: 28  VVSPFERVKILLQVQSSTSAYNH--GIINAVGQVYKEEGVAGLFR------GNGLNCVRI 79
           + SP E V+I LQ Q+         G ++ + ++ KE+ +    R      G+GL C   
Sbjct: 156 LASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLMRGLRPMMLRAGHGLGCY-- 213

Query: 80  FPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRL 139
                  F+ YE    +   +     + ++ +W+  S G+L G +  LA YPLD+V++ +
Sbjct: 214 -------FLTYEALIAN--EIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMI 264

Query: 140 SIQT 143
              T
Sbjct: 265 QTDT 268

 Score = 37.7 bits (86), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 15/64 (23%), Positives = 33/64 (51%), Gaps = 1/64 (1%)

Query: 29  VSPFERVKILLQVQS-STSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQF 87
           + P + VK ++Q  +     + + + N +  +Y+E+G++  F+G     +R  P +   F
Sbjct: 254 IYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATF 313

Query: 88  VVYE 91
           V +E
Sbjct: 314 VTFE 317

>CAGL0G01166g complement(111298..112185) highly similar to tr|Q06143
           Saccharomyces cerevisiae YLR348c DIC1, hypothetical
           start
          Length = 295

 Score = 42.7 bits (99), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 53/115 (46%), Gaps = 10/115 (8%)

Query: 31  PFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVY 90
           P +  K+ LQ           I+  +  + K EG+ GL+ G   + +R   Y+  +F +Y
Sbjct: 26  PLDLTKVRLQAAPIPKP---TIVQMLRSILKNEGIVGLYAGLSASLLRQCTYTTARFGMY 82

Query: 91  EWCKKHIFHVDGTVGKEQLLN-WQRLSAGALCGGMSVLATYPLDLVRTRLSIQTA 144
           +  K+H+      + +++L N W  L A  + G +  LA    DL+  R+   +A
Sbjct: 83  DALKEHV------IPRDKLTNMWYLLGASMVSGALGGLAGNFADLINIRMQNDSA 131

 Score = 31.6 bits (70), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 35/73 (47%), Gaps = 1/73 (1%)

Query: 25  SRTVVSPFERVKILLQVQSSTSAYNH-GIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYS 83
           + TV SP + +K ++        +NH      + +   +EG + +FRG   +  R+ P++
Sbjct: 214 ATTVCSPADVIKTIVMNAHKKPGHNHDSSFKILMEAINKEGPSFMFRGWVPSFTRLAPFT 273

Query: 84  AVQFVVYEWCKKH 96
            + F   E  KK+
Sbjct: 274 MLIFFAMEQLKKY 286

 Score = 28.9 bits (63), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 30/67 (44%), Gaps = 15/67 (22%)

Query: 118 GALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGI 177
           G   G  +V+ T+PLDL + RL                 I KP  V ++L    K E GI
Sbjct: 13  GGAAGIFAVMNTHPLDLTKVRLQ-------------AAPIPKPTIV-QMLRSILKNE-GI 57

Query: 178 RGLYRGI 184
            GLY G+
Sbjct: 58  VGLYAGL 64

>Sklu_2398.4 , Contig c2398 9476-10405
          Length = 309

 Score = 42.7 bits (99), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 51/113 (45%), Gaps = 5/113 (4%)

Query: 31  PFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVY 90
           PF+  K+ +Q    TSA +   ++ V  + K EG+ G ++G     V +    + QF V 
Sbjct: 43  PFDITKVRMQ----TSAGSATAVDVVTSLIKNEGILGFYKGTLAPLVGVGACVSCQFGVN 98

Query: 91  EWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQT 143
           E  K+    ++G   K   L  Q    G   G  +     P++ VR RL +QT
Sbjct: 99  EAMKRRFRRMNGDPSKPLSLK-QYYVCGVASGCANAFLATPIEHVRIRLQLQT 150

 Score = 32.3 bits (72), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 52/112 (46%), Gaps = 7/112 (6%)

Query: 28  VVSPFERVKILLQVQSST--SAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAV 85
           + +P E V+I LQ+Q+ +  +A   G ++ + ++ K+     L RG     +R      +
Sbjct: 135 LATPIEHVRIRLQLQTKSLANAEYQGSLDCMRKLLKQ---GALMRGFTATLMRTCHGFGI 191

Query: 86  QFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRT 137
            F  YE    +  H  G + ++ +  W+    GA  G       YP+D+V++
Sbjct: 192 YFSTYEALIANQ-HKKG-IPRKDIAPWKVCIFGAFSGACYWAMAYPIDVVKS 241

>Kwal_56.23011
          Length = 303

 Score = 42.7 bits (99), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 53/112 (47%), Gaps = 7/112 (6%)

Query: 28  VVSPFERVKILLQVQ--SSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAV 85
           + +P E V+I LQ+Q  SS++A  HG ++   ++ K+     L RG     +R      +
Sbjct: 135 LATPIEHVRIRLQLQTASSSAAEYHGSLDCARKLLKQ---GALMRGFTATTLRTSHGFGI 191

Query: 86  QFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRT 137
            F+ YE    +  H    V +E +  W+    GA  G      TYP D+V++
Sbjct: 192 YFLTYETLIANQAH--HGVLRENIPAWKVCVYGAFSGAFFWAMTYPFDVVKS 241

 Score = 38.9 bits (89), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 51/129 (39%), Gaps = 5/129 (3%)

Query: 31  PFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVY 90
           PF+  K+ LQ    TS         +  + K EG+   ++G       +    + QF V 
Sbjct: 43  PFDITKVRLQ----TSPVPTTAAQVIKSLVKNEGLLAFYKGTLAPLAGVGACVSCQFGVN 98

Query: 91  EWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXX 150
           E  KK     DG   +   L  Q  + G + G  +     P++ VR RL +QTA+     
Sbjct: 99  EALKKWFRKKDGNFDQPLALR-QYYACGFVSGTANAFLATPIEHVRIRLQLQTASSSAAE 157

Query: 151 XXXXXDIAK 159
                D A+
Sbjct: 158 YHGSLDCAR 166

>CAGL0M05225g 563163..564308 highly similar to sp|P38127
           Saccharomyces cerevisiae YBR192w RIM2 mitochondrial
           carrier protein, start by similarity
          Length = 381

 Score = 42.7 bits (99), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 60/132 (45%), Gaps = 14/132 (10%)

Query: 53  INAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNW 112
           ++ +G VY++EG   LF+G G N V + P  ++ F  Y    K I+      G+E    W
Sbjct: 124 VSIIGNVYRQEGFRSLFKGLGPNLVGVIPARSINFFTYG-TTKDIYSKAFNNGQEA--PW 180

Query: 113 QRLSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFK 172
             L A A  G  +  AT P+ +V+TR+ +  A                   ++ L    +
Sbjct: 181 IHLMAAATAGWATATATNPIWMVKTRVQLDKAGKTRTYK----------NSYDCLKSILR 230

Query: 173 EEGGIRGLYRGI 184
            E GI GLYRG+
Sbjct: 231 NE-GIYGLYRGL 241

 Score = 35.0 bits (79), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 61/126 (48%), Gaps = 21/126 (16%)

Query: 30  SPFERVKILLQVQSS--TSAYNHGIINAVGQVYKEEGVAGLFRG---NGLNCVRIFPYSA 84
           +P   VK  +Q+  +  T  Y +   + +  + + EG+ GL+RG   + L  V       
Sbjct: 198 NPIWMVKTRVQLDKAGKTRTYKNSY-DCLKSILRNEGIYGLYRGLSASYLGSVE----GI 252

Query: 85  VQFVVYEWCKKHI---------FHVDGTVGK-EQLLNWQRLSAGA-LCGGMSVLATYPLD 133
           +Q+++YE  K  I          H + T+   +++  W + S GA L   M+ + TYP +
Sbjct: 253 LQWLLYEQLKHLIKKRSIEKFGAHDESTMTTTDKIKQWCQRSGGAGLAKFMASIVTYPHE 312

Query: 134 LVRTRL 139
           +VRTRL
Sbjct: 313 VVRTRL 318

 Score = 28.9 bits (63), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 12/41 (29%), Positives = 23/41 (56%)

Query: 51  GIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYE 91
           G++ +   + KEEG+A ++ G   + +R  P S + F  +E
Sbjct: 332 GLVQSFRVIIKEEGLASMYSGLTPHLMRTVPNSIIMFGTWE 372

>Scas_715.45
          Length = 305

 Score = 42.4 bits (98), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 28/137 (20%), Positives = 67/137 (48%), Gaps = 7/137 (5%)

Query: 8   KQESSIAFIXXXXXXXXSRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAG 67
           K  +SI  +        +  ++ PFE +K+  + Q++   + + +I    ++Y +EG+ G
Sbjct: 112 KYRTSIYLLSSATAEFFADIMLCPFEAIKV--KQQTTMPPWCNNVIEGWKKMYAKEGLNG 169

Query: 68  LFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLS----AGALCGG 123
            ++G      R  PY+  +F  +E   + I+    T  K ++   Q++S     G + G 
Sbjct: 170 FYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPT-KKSEMSALQQISVSFVGGYMAGI 228

Query: 124 MSVLATYPLDLVRTRLS 140
           +  + ++P D++ ++++
Sbjct: 229 LCAIVSHPADVMVSKIN 245

 Score = 32.0 bits (71), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 5/54 (9%)

Query: 25 SRTVVSPFERVKILLQVQSSTSAYN-HGIINAVGQVYKEEGVAGLFRGNGLNCV 77
          + + V+P + +K  LQV  +    N  GII    Q+ K+EG+  LF G G  C+
Sbjct: 30 THSSVTPLDLIKCRLQVDPTLYRSNTSGII----QILKKEGLGKLFTGVGATCI 79

>Kwal_33.14050
          Length = 314

 Score = 42.0 bits (97), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 57/119 (47%), Gaps = 17/119 (14%)

Query: 28  VVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQF 87
           +++PF+ +K  +Q+++ +      + +   ++Y+ EG+A  F           P++A  F
Sbjct: 137 LMNPFDTIKQRMQLRTFS---KDRMWSVASRIYRNEGLAAFFYSYPTTIAMNIPFAAFNF 193

Query: 88  VVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMS----VLATYPLDLVRTRLSIQ 142
            +YE   K  F+ + T     L++        LCGG+S       T PLD ++T L ++
Sbjct: 194 AIYESATK-FFNPENTYNP--LIH-------CLCGGISGATCAAITTPLDCIKTVLQVR 242

 Score = 35.0 bits (79), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 27/128 (21%), Positives = 52/128 (40%), Gaps = 16/128 (12%)

Query: 26  RTVVSPFERVKILLQVQSST-------SAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVR 78
            +++ P + +K  +Q  S+T       +     I+  + ++   EG   L++G     + 
Sbjct: 31  HSIMFPIDAIKTRMQALSATIGSANAAAKLPSNIVQQIARISTTEGSMALWKGVQSVILG 90

Query: 79  IFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATY---PLDLV 135
             P  AV F  YE CK ++      +  +     Q L   A     +V A     P D +
Sbjct: 91  AGPAHAVYFATYEMCKSYL------IDPQDFQTHQPLKTAASGIAATVAADLLMNPFDTI 144

Query: 136 RTRLSIQT 143
           + R+ ++T
Sbjct: 145 KQRMQLRT 152

 Score = 32.0 bits (71), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 34/75 (45%), Gaps = 7/75 (9%)

Query: 28  VVSPFERVKILLQVQSSTSAYN------HGIINAVGQVYKEEGVAGLFRGNGLNCVRIFP 81
           + +P + +K +LQV+ S S  +           A   + K  G +G +RG     +   P
Sbjct: 228 ITTPLDCIKTVLQVRGSESVVDPLFRQADTFSRAASAISKVYGWSGFWRGLKPRIISNMP 287

Query: 82  YSAVQFVVYEWCKKH 96
            +A+ +  YE C KH
Sbjct: 288 ATAISWTAYE-CAKH 301

>Kwal_33.15597
          Length = 305

 Score = 42.0 bits (97), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 59/121 (48%), Gaps = 8/121 (6%)

Query: 25  SRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSA 84
           + + + P + VK  +Q++ +   YN G+I++  Q+   EG   L  G G   +      +
Sbjct: 27  THSAMVPIDVVKTRIQLEPTV--YNKGMISSFKQIISSEGAGALLTGFGPTLLGYSLQGS 84

Query: 85  VQFVVYEWCKKHIFHVDGTVGKEQLLNWQR---LSAGALCGGMSVLATYPLDLVRTRLSI 141
            +F  YE  KK    +D T+G +Q +N++    + + A+    + +A  PL+  R RL  
Sbjct: 85  FKFGGYEVFKK--LFID-TLGYDQAVNYKNSIYIGSAAIAEFFADIALCPLEATRIRLVS 141

Query: 142 Q 142
           Q
Sbjct: 142 Q 142

 Score = 35.0 bits (79), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 36/72 (50%), Gaps = 3/72 (4%)

Query: 31  PFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVY 90
           P E  +I L  Q +   + +G++    ++ KEEG++  + G      +  PY+  +F+V+
Sbjct: 131 PLEATRIRLVSQPT---FANGLVGGFSRILKEEGLSSFYNGFTPILFKQIPYNIAKFLVF 187

Query: 91  EWCKKHIFHVDG 102
           E   +  F + G
Sbjct: 188 ERAAEVYFGMAG 199

 Score = 29.6 bits (65), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 29/61 (47%)

Query: 37  ILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKH 96
           +L +V  +  A     I  +GQ+ KE G  G F G     V +   +++QF +Y   KK 
Sbjct: 234 LLSKVNKAKKAPGQSTIGLLGQLAKELGFVGSFAGLPTRLVMVGTLTSLQFGIYGSLKKT 293

Query: 97  I 97
           +
Sbjct: 294 L 294

>Kwal_27.11419
          Length = 298

 Score = 42.0 bits (97), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/117 (23%), Positives = 51/117 (43%), Gaps = 10/117 (8%)

Query: 38  LLQVQSSTSAYNHGII-NAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKH 96
           +L+V+  ++ YN+  +  A   +Y+ EG+ GLF G G   +R  PY+ +  + YE  K  
Sbjct: 131 VLKVRFESTMYNYKSLGEAATHIYRSEGIRGLFSGCGATVMRDAPYAGLYVLFYEQSKLQ 190

Query: 97  ---------IFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTA 144
                    + H +  V   +        A      ++   T P D ++TR+ +  +
Sbjct: 191 LPRILPVWMVEHNESGVFSTKTSTIINSIAAFSSASLATTITSPFDTIKTRMQLNPS 247

>AAL014C [173] [Homologous to ScYNL003C (PET8) - SH]
           (317388..318203) [816 bp, 271 aa]
          Length = 271

 Score = 41.6 bits (96), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 56/123 (45%), Gaps = 20/123 (16%)

Query: 63  EGVA-GLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALC 121
           EGV  GL+RG     +R  P++ +QF +YE+ KK           E++  WQ    G+L 
Sbjct: 143 EGVVRGLYRGWWTTIMREIPFTCIQFPLYEYLKKKW---AAYAEIERVSAWQGAVCGSLA 199

Query: 122 GGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLY 181
           GG++  AT PLD+++TR+ +                         L +T   E G R  +
Sbjct: 200 GGIAAAATTPLDVLKTRMMLHERRVPMLH----------------LARTLFREEGARVFF 243

Query: 182 RGI 184
           RGI
Sbjct: 244 RGI 246

 Score = 35.4 bits (80), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 53/133 (39%), Gaps = 15/133 (11%)

Query: 53  INAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGT-VGKEQLLN 111
           + A G  +   G  G++RG G   V   P +++ FV Y+  K+ +  V G     EQL  
Sbjct: 33  LQAKGGFFHNGGYRGIYRGLGSAVVASAPGASLFFVTYDSMKQQLRPVMGRWTASEQLAE 92

Query: 112 WQRLSAGALCGGMSV-LATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKT 170
                  +  G MS  L   P ++++ R      N                    L+++ 
Sbjct: 93  VLTHMLSSSLGEMSACLVRVPAEVIKQRTQTHHTNSSLQTL-------------RLILRD 139

Query: 171 FKEEGGIRGLYRG 183
              EG +RGLYRG
Sbjct: 140 PTGEGVVRGLYRG 152

>Scas_589.10
          Length = 316

 Score = 41.6 bits (96), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 79/182 (43%), Gaps = 19/182 (10%)

Query: 5   QLAKQESSIAFIXXXXXXXXSRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEG 64
           +L +  S++  +           +V PFE VKI  ++Q + S Y   I      + + +G
Sbjct: 116 KLKEVTSTVTLLAGTFAGITESLIVVPFELVKI--RLQDAQSDYRSPI-RCTRTIIENQG 172

Query: 65  VAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGM 124
           + G++ G      R   ++A  F +    KK I     T   + + N      GA+ G M
Sbjct: 173 LFGIYAGFESTIWRNTIWNASYFGLIFQVKKFIPRAKSTTKFQGIRN--DFLVGAIAGCM 230

Query: 125 SVLATYPLDLVRTRL--SIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYR 182
           S   + P D+V+TR+  S +T++                  W+ +   ++ E GI+G+Y+
Sbjct: 231 SCFLSVPFDVVKTRMQGSKKTSSGMCYGW-----------AWQSVFLIYRTE-GIKGIYK 278

Query: 183 GI 184
           GI
Sbjct: 279 GI 280

 Score = 35.0 bits (79), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 33/71 (46%), Gaps = 6/71 (8%)

Query: 117 AGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPP---GVWELLVKTFKE 173
           +GA+ G    +  YPLD+V+TR  +Q              + K P    +   L K  KE
Sbjct: 19  SGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVA--VPKQPEHSSILSCLSKILKE 76

Query: 174 EGGIRGLYRGI 184
           E G + LY+G+
Sbjct: 77  E-GFKNLYKGM 86

 Score = 32.7 bits (73), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 30/137 (21%), Positives = 54/137 (39%), Gaps = 15/137 (10%)

Query: 15  FIXXXXXXXXSRTVVSPFERVKILLQVQSSTSAY------------NHGIINAVGQVYKE 62
           FI           ++ P + VK   Q+Q +  A             +  I++ + ++ KE
Sbjct: 17  FISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSCLSKILKE 76

Query: 63  EGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCG 122
           EG   L++G     +   P  AV+F   E  ++ +         +++ +   L AG   G
Sbjct: 77  EGFKNLYKGMSPPLLMEVPKRAVKFASNEQFQQIMMK---KFKLKEVTSTVTLLAGTFAG 133

Query: 123 GMSVLATYPLDLVRTRL 139
               L   P +LV+ RL
Sbjct: 134 ITESLIVVPFELVKIRL 150

>Kwal_23.4354
          Length = 343

 Score = 41.6 bits (96), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/169 (21%), Positives = 68/169 (40%), Gaps = 19/169 (11%)

Query: 27  TVVSPFERVKILLQV------QSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIF 80
           T V+P E  +  LQ       +S+T+     +I        + G   LFRG  +   R  
Sbjct: 156 TTVAPLELFRTRLQSIPRSSPKSTTAMMIKDLIKESRYEISKVGYKALFRGLEITLWRDV 215

Query: 81  PYSAVQFVVYEWCKKHI-FHVDGTVGKEQLLNWQR----LSAGALCGGMSVLATYPLDLV 135
           P+S++ +  YE+ K ++    + ++      NW         G+  G ++ + T+P D+ 
Sbjct: 216 PFSSIYWGCYEFYKSNVSIDSEKSIVNSSNSNWNHFVNSFVGGSFGGAVAAVLTHPFDVG 275

Query: 136 RTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
           +TR+ I   N             KP       +   ++  G+  LY G+
Sbjct: 276 KTRMQITYLNSTLE--------KKPSKNMFKYLNQMRKSEGLAALYTGL 316

 Score = 40.4 bits (93), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 69/154 (44%), Gaps = 19/154 (12%)

Query: 32  FERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYE 91
           FE V+     ++S   YN    +A G++ K EGV  L+RG  +  +   P + V F+ YE
Sbjct: 72  FEDVR----CKTSPVRYN-STWDAFGKIAKIEGVQSLWRGLSITLLMAAPANMVYFIGYE 126

Query: 92  WCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRL-SIQTANXXXXX 150
             +      D +  +++      L  GAL   ++     PL+L RTRL SI  ++     
Sbjct: 127 SLR------DKSRLQDKYPTLNPLMCGALARVLAATTVAPLELFRTRLQSIPRSSPKSTT 180

Query: 151 XXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
                D+ K    +E+       + G + L+RG+
Sbjct: 181 AMMIKDLIK-ESRYEI------SKVGYKALFRGL 207

 Score = 33.9 bits (76), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 32/69 (46%), Gaps = 4/69 (5%)

Query: 31  PFERVKILLQVQSSTSAY----NHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQ 86
           PF+  K  +Q+    S      +  +   + Q+ K EG+A L+ G     ++I P  A+ 
Sbjct: 271 PFDVGKTRMQITYLNSTLEKKPSKNMFKYLNQMRKSEGLAALYTGLVPRVIKIAPSCAIM 330

Query: 87  FVVYEWCKK 95
              YE CK+
Sbjct: 331 ISTYEVCKR 339

>CAGL0D01606g complement(169066..169983) highly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, start by
           similarity
          Length = 305

 Score = 41.6 bits (96), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 65/161 (40%), Gaps = 13/161 (8%)

Query: 31  PFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVY 90
           PF+  K+ LQ    TS         V  + K EG  G ++G     V +    ++QF V 
Sbjct: 45  PFDTTKVRLQ----TSKVPTSAAEVVKNLLKNEGPKGFYKGTLTPLVGVGACVSIQFGVN 100

Query: 91  EWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGM--SVLATYPLDLVRTRLSIQTANXXX 148
           E  K+  FH    V     L+  +     L GGM  S LA+ P++ VR RL  QT +   
Sbjct: 101 EAMKR-FFHAR-NVDHNATLSLSQYYLCGLTGGMTNSFLAS-PIEHVRIRLQTQTGSGAQ 157

Query: 149 XXXXXXXDIAKP----PGVWELLVKTFKEEGGIRGLYRGIY 185
                  D  K      G+   L+ T   EG   G Y  +Y
Sbjct: 158 AEFKGPIDCIKKLRSQKGLMRGLIPTMLREGHGCGTYFLVY 198

 Score = 38.5 bits (88), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 55/120 (45%), Gaps = 7/120 (5%)

Query: 28  VVSPFERVKILLQVQSSTSAYNH--GIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAV 85
           + SP E V+I LQ Q+ + A     G I+ + ++  ++G   L RG     +R       
Sbjct: 137 LASPIEHVRIRLQTQTGSGAQAEFKGPIDCIKKLRSQKG---LMRGLIPTMLREGHGCGT 193

Query: 86  QFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTAN 145
            F+VYE        ++  + + ++  W+    GAL G    L  YP+D+V++ +     N
Sbjct: 194 YFLVYEALVSK--QINQGLKRTEIPPWKLCLYGALSGTALWLMVYPIDVVKSVMQTDNLN 251

 Score = 32.0 bits (71), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 17/69 (24%), Positives = 30/69 (43%), Gaps = 1/69 (1%)

Query: 28  VVSPFERVKILLQVQSSTSAYN-HGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQ 86
           +V P + VK ++Q  +     N   +I     +Y  EG+   F+G G   +R  P +   
Sbjct: 234 MVYPIDVVKSVMQTDNLNKPQNGKNMIQVARNLYAREGLKAFFKGFGPTMLRAAPANGGT 293

Query: 87  FVVYEWCKK 95
           F  +E   +
Sbjct: 294 FATFELAMR 302

>Scas_662.12
          Length = 308

 Score = 41.6 bits (96), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 38/70 (54%), Gaps = 4/70 (5%)

Query: 29  VSPFERVKILLQ----VQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSA 84
           V PF+ +K  LQ    V ++    ++  I  + ++Y++ G+ GL++G   N +R  P + 
Sbjct: 236 VYPFQLLKSNLQTFRSVTNNIPQNDYHFITLIRKIYRDNGIKGLYKGLSANLLRAIPSTC 295

Query: 85  VQFVVYEWCK 94
           + F +YE  K
Sbjct: 296 ITFCIYENFK 305

 Score = 34.3 bits (77), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 51/103 (49%), Gaps = 11/103 (10%)

Query: 84  AVQFVVYEWCKKHIFHVDGTVGKEQLLN--WQRLSAGALCGGMSVLATYPLDLVRTRLSI 141
           A+ F++Y+  K H F+V+    K+   N   + +   +L   +SV++ YP  L+++ L  
Sbjct: 190 AIYFMIYDNLKLH-FNVNLNKSKKDNANANLKIVLISSLSKMLSVMSVYPFQLLKSNL-- 246

Query: 142 QTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
           QT            +I +    +  L++    + GI+GLY+G+
Sbjct: 247 QT------FRSVTNNIPQNDYHFITLIRKIYRDNGIKGLYKGL 283

>CAGL0L02079g 243467..244360 highly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, hypothetical start
          Length = 297

 Score = 41.2 bits (95), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 57/126 (45%), Gaps = 5/126 (3%)

Query: 25  SRTVVSPFERVKILL--QVQSSTSAY-NHGIINAVGQV--YKEEGVAGLFRGNGLNCVRI 79
           S   V+PFE +K +L    QS    Y N+G   A   +   K+EG  GL+ G     +R 
Sbjct: 121 SVVAVTPFEAIKTVLIDDKQSVRPKYQNNGRSMARNYISLVKDEGFRGLYGGVLPVSMRQ 180

Query: 80  FPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRL 139
               AV+   Y   K  +    G    + L +      GA  G ++V AT P+D V+TR+
Sbjct: 181 AANQAVRLGCYNKIKVLVQDYTGAPKDKPLTSGLTFIVGAFSGVVTVYATMPIDTVKTRM 240

Query: 140 SIQTAN 145
              TA+
Sbjct: 241 QSLTAS 246

 Score = 30.8 bits (68), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 35/81 (43%), Gaps = 2/81 (2%)

Query: 11  SSIAFIXXXXXXXXSRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFR 70
           S + FI        +     P + VK   ++QS T++     +N    +YKEEG+   ++
Sbjct: 212 SGLTFIVGAFSGVVTVYATMPIDTVKT--RMQSLTASKYSSTLNCFTTIYKEEGLKTFWK 269

Query: 71  GNGLNCVRIFPYSAVQFVVYE 91
           G      R+     + F +YE
Sbjct: 270 GATPRLGRLILSGGIVFTIYE 290

 Score = 28.1 bits (61), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 39/183 (21%), Positives = 72/183 (39%), Gaps = 14/183 (7%)

Query: 4   KQLAKQESSIAFIXXXXXXXXSRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEE 63
           K   K + + +F+          ++  PFE  K  LQ+   +S  +   +  +    K +
Sbjct: 3   KDSKKVDPTKSFVAGALAGAVEASITYPFEFAKTRLQLIDKSSKASRNPLVLIYNTAKTQ 62

Query: 64  GVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGG 123
           GV  ++ G     V     +A +F+ Y+  +  +   D   G+   L+  R     L  G
Sbjct: 63  GVGAIYVGCPAFIVGNTAKAATRFLGYDTIRNLL--KDKKTGE---LSGPRGVLAGLGAG 117

Query: 124 M--SVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLY 181
           +  SV+A  P + ++T L     +           +A+        +   K+E G RGLY
Sbjct: 118 LLESVVAVTPFEAIKTVLIDDKQSVRPKYQNNGRSMARN------YISLVKDE-GFRGLY 170

Query: 182 RGI 184
            G+
Sbjct: 171 GGV 173

>Kwal_26.7653
          Length = 325

 Score = 41.2 bits (95), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 76/183 (41%), Gaps = 25/183 (13%)

Query: 14  AFIXXXXXXXXSRTVVSPFERVKILLQVQSSTSAYNHGI----INAVGQVYKEEGVAGLF 69
           +FI        + TV +P E VK  +Q+Q   SA    I    + A+  ++K EG+ GL 
Sbjct: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86

Query: 70  RG--------NGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALC 121
           +G         GLN  R+  Y  ++ V+        F+      K Q +    +S GA  
Sbjct: 87  KGLSCAYIYQIGLNGSRLGFYEPIRSVL-----NKTFYPAMDPHKVQNVAVNVVS-GATS 140

Query: 122 GGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLY 181
           G +  +   PL L++TR+   +             I      W  L   ++ E G +GLY
Sbjct: 141 GIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSI------WNGLSSIYRAE-GFKGLY 193

Query: 182 RGI 184
           RG+
Sbjct: 194 RGV 196

 Score = 38.5 bits (88), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 66/164 (40%), Gaps = 33/164 (20%)

Query: 30  SPFERVKILLQ-----VQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSA 84
           SP   +K  +Q     +Q     +   I N +  +Y+ EG  GL+RG     +R    S+
Sbjct: 149 SPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSS 208

Query: 85  VQFVVYEWCK----KHIFHVDGTVGKEQLLNWQRLSAGALCG-GMSVLATYPLDLVRTRL 139
           VQ  +Y   K    KH    +GT           L A  + G G+ V+   P D++ TR+
Sbjct: 209 VQLPIYNTAKHFLLKHDLMKEGT--------GLHLVASTVSGFGVGVVMN-PWDVILTRV 259

Query: 140 SIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRG 183
             Q  N                G  +  VKT + E GI  LY+G
Sbjct: 260 YNQKGNLYK-------------GPLDCFVKTVRIE-GIGALYKG 289

>KLLA0E18810g 1663220..1664353 some similarities with sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), hypothetical start
          Length = 377

 Score = 41.2 bits (95), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 55/120 (45%), Gaps = 5/120 (4%)

Query: 25  SRTVVSPFERVKILL--QVQSSTSAYNH---GIINAVGQVYKEEGVAGLFRGNGLNCVRI 79
           S   V+PFE +K  L    Q++   Y +   G+++   ++  ++G +GL+RG     +R 
Sbjct: 201 SVVAVTPFEAIKTALIDDKQAAVPKYQNNGKGMVSNYAKLLSDQGFSGLYRGVLPVSMRQ 260

Query: 80  FPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRL 139
               AV+   Y   K  +         + L +      GA  G ++V  T P+D V+TR+
Sbjct: 261 AANQAVRLGCYNKIKTLVQDYTNVPKDKPLSSGLTFIVGAFSGIVTVYTTMPIDTVKTRM 320

 Score = 28.9 bits (63), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 19/82 (23%), Positives = 33/82 (40%), Gaps = 2/82 (2%)

Query: 10  ESSIAFIXXXXXXXXSRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLF 69
            S + FI        +     P + VK   ++QS  +      IN    ++KEEG+   +
Sbjct: 291 SSGLTFIVGAFSGIVTVYTTMPIDTVKT--RMQSLNAGQYSSTINCFATIFKEEGLKTFW 348

Query: 70  RGNGLNCVRIFPYSAVQFVVYE 91
           +G      R+     + F +YE
Sbjct: 349 KGATPRLGRLILSGGIVFTIYE 370

>Scas_632.9
          Length = 292

 Score = 41.2 bits (95), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 34/65 (52%), Gaps = 6/65 (9%)

Query: 31  PFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVY 90
           P + VK ++Q +  T      +INAV +V    G+ G +RG G+  +R  P +A  F +Y
Sbjct: 233 PADTVKSMMQTEHIT------LINAVKKVLTTYGITGFYRGLGITLIRAVPANATVFYMY 286

Query: 91  EWCKK 95
           E   K
Sbjct: 287 ETLSK 291

 Score = 34.3 bits (77), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 28/67 (41%), Gaps = 13/67 (19%)

Query: 118 GALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGI 177
           G++ G    +  YP D V+ RL  Q ++               P  W  +  T+  EG  
Sbjct: 24  GSIAGAFGKIIEYPFDTVKVRLQTQGSHIF-------------PTTWSCIKYTYHNEGVW 70

Query: 178 RGLYRGI 184
           RG ++GI
Sbjct: 71  RGFFQGI 77

 Score = 33.9 bits (76), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 54/120 (45%), Gaps = 8/120 (6%)

Query: 28  VVSPFERVKILLQVQSSTSAY-----NHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPY 82
           V++P E +K  LQV +  +A      +  II  +  V +E+G+ GL++G     +R    
Sbjct: 128 VLTPVELIKCKLQVSNLQTAVEGQIKHTKIIPTLMYVLREKGILGLWQGQSSTFIRESLG 187

Query: 83  SAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQ 142
               F  YE  K+ +   D     E    W+ L +GA  G     + +P D V++ +  +
Sbjct: 188 GVAWFATYEVMKQGL--KDRRKDTEN-KTWELLVSGASAGLAFNASIFPADTVKSMMQTE 244

 Score = 33.9 bits (76), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 61/158 (38%), Gaps = 23/158 (14%)

Query: 31  PFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGV-AGLFRGNGLNCVRIFPYSAVQFVV 89
           PF+ VK+ LQ Q   S       + +   Y  EGV  G F+G G         +A  FV 
Sbjct: 37  PFDTVKVRLQTQG--SHIFPTTWSCIKYTYHNEGVWRGFFQGIGSPLFGAALENATLFVS 94

Query: 90  YEWCKKHIFHVDGTVGKEQLLNWQRLS----AGALCGGMSVLATYPLDLVRTRLSIQTAN 145
           Y  C   +         E+  N   LS    +GA  G  +     P++L++ +L  Q +N
Sbjct: 95  YNQCSNVL---------EKFTNVSPLSNILLSGAFAGSCASFVLTPVELIKCKL--QVSN 143

Query: 146 XXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRG 183
                          P +  +L      E GI GL++G
Sbjct: 144 LQTAVEGQIKHTKIIPTLMYVL-----REKGILGLWQG 176

>Scas_721.129
          Length = 323

 Score = 40.8 bits (94), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/197 (24%), Positives = 86/197 (43%), Gaps = 27/197 (13%)

Query: 2   DLKQLAKQESSI--AFIXXXXXXXXSRTVVSPFERVKILLQVQSSTSAYNHGI----INA 55
           ++++ A Q+ S   +FI        + T  +P E VKI +Q+Q   +A    +    I  
Sbjct: 10  EIEKTAAQKVSKFGSFIAGGMAACIAVTFTNPIELVKIRMQLQGELAAVGQKVYRNPIQG 69

Query: 56  VGQVYKEEGVAGLFRG--------NGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKE 107
           +G +++ EG+ GL +G         GLN  R+  Y  ++  +        F+ +    K 
Sbjct: 70  MGVIFRNEGIRGLQKGLVAAYIYQIGLNGSRLGFYEPIRNAL-----NSTFYPNEESHKI 124

Query: 108 QLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELL 167
           Q ++   ++AGA  G +  +   PL LV+TR+   +            +      VW  L
Sbjct: 125 QKVSIN-VAAGASSGIIGAVIGSPLFLVKTRMQSYSDAIKIGEQTHYRN------VWNGL 177

Query: 168 VKTFKEEGGIRGLYRGI 184
               + E G +GL+RGI
Sbjct: 178 STIARTE-GFKGLFRGI 193

 Score = 28.1 bits (61), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 15/77 (19%), Positives = 38/77 (49%), Gaps = 2/77 (2%)

Query: 28  VVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQF 87
           V++P++   IL ++ +       G ++   +  + EG++ L++G     +RI P++ +  
Sbjct: 245 VMNPWD--VILTRIYNQKGNLYKGPVDCFVKTVRTEGISALYKGFQAQILRIAPHTIICL 302

Query: 88  VVYEWCKKHIFHVDGTV 104
              E   K ++ V+  +
Sbjct: 303 TFMEQTMKLVYSVESKI 319

>Sklu_1119.1 YJR077C, Contig c1119 366-1289
          Length = 307

 Score = 40.8 bits (94), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 57/121 (47%), Gaps = 8/121 (6%)

Query: 25  SRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSA 84
           + + + P + VK  +Q++ +   YN G+I++  Q+   EG   L  G G   +      +
Sbjct: 27  THSAMVPIDVVKTRIQLEPTV--YNKGMISSFKQIISSEGAGALLTGFGPTLLGYSLQGS 84

Query: 85  VQFVVYEWCKKHIFHVDGTVGKEQLLNWQR---LSAGALCGGMSVLATYPLDLVRTRLSI 141
            +F  YE  KK    V   +G +Q +N++    + + A+    + +A  PL+  R RL  
Sbjct: 85  FKFGGYEVFKKLFIDV---LGYDQAVNYKNSIYIGSAAIAEFFADIALCPLEATRIRLVS 141

Query: 142 Q 142
           Q
Sbjct: 142 Q 142

 Score = 36.2 bits (82), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 26/114 (22%), Positives = 51/114 (44%), Gaps = 9/114 (7%)

Query: 31  PFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVY 90
           P E  +I L  Q +   + +G++    ++ KEEG    + G      +  PY+  +F+V+
Sbjct: 131 PLEATRIRLVSQPT---FANGLVGGFSRILKEEGAGSFYNGFTPILFKQIPYNIAKFLVF 187

Query: 91  EWCKKHIFHVDGTVGKEQLLNWQ----RLSAGALCGGMSVLATYPLDLVRTRLS 140
           E   +  F + G   KE L         L +G   G  + + + P D + ++++
Sbjct: 188 ERAAEVYFGMAGP--KESLSTASTTGINLLSGLTAGLAAAIVSQPADTLLSKVN 239

>Kwal_26.8669
          Length = 296

 Score = 40.8 bits (94), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/159 (28%), Positives = 71/159 (44%), Gaps = 22/159 (13%)

Query: 28  VVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQF 87
           VV PFE VKI LQ  SS+     G I+ V ++  +EGV  ++ G      R   ++A  F
Sbjct: 125 VVVPFELVKIRLQDVSSS---YKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYF 181

Query: 88  VVYEWCKKHIFHVDGTVGKEQLLNWQR---LSAGALCGGMSVLATYPLDLVRTRLSIQTA 144
            +       IF V   + + +  + Q    L AG++ G +  L + P D+V++R+   TA
Sbjct: 182 GI-------IFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQ-NTA 233

Query: 145 NXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRG 183
                              W  +   +KEE G R LY+G
Sbjct: 234 VVAGGARKYNWS-------WPSIFTIYKEE-GFRALYKG 264

 Score = 37.0 bits (84), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 53/114 (46%), Gaps = 5/114 (4%)

Query: 28  VVSPFERVKILLQVQSS--TSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAV 85
           V+ P + VK  +Q+Q S        G+++ + Q+  +EG + L++G     +   P  A 
Sbjct: 26  VMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISSPVLMEAPKRAT 85

Query: 86  QFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRL 139
           +F   +  +K I+  +   G E+L     + +GA  G        P +LV+ RL
Sbjct: 86  KFACNDEFQK-IYKRE--FGVEKLTQSLSILSGASAGCCEAFVVVPFELVKIRL 136

 Score = 34.7 bits (78), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 36/71 (50%), Gaps = 10/71 (14%)

Query: 114 RLSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKE 173
           + +AGA+ G   +L  YPLD+V+TR+ +Q +                 GV + + +   +
Sbjct: 12  QFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYK---------GVVDCIKQIVAK 62

Query: 174 EGGIRGLYRGI 184
           EG  R LY+GI
Sbjct: 63  EGASR-LYKGI 72

 Score = 29.6 bits (65), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 32/68 (47%), Gaps = 5/68 (7%)

Query: 30  SPFERVKILLQ----VQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAV 85
           +PF+ VK  +Q    V      YN     ++  +YKEEG   L++G     +R+ P   +
Sbjct: 220 TPFDVVKSRIQNTAVVAGGARKYNWSW-PSIFTIYKEEGFRALYKGFVPKVLRLGPGGGI 278

Query: 86  QFVVYEWC 93
             VV+  C
Sbjct: 279 LLVVFTGC 286

>CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11, start by
           similarity
          Length = 301

 Score = 40.8 bits (94), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 37/67 (55%), Gaps = 6/67 (8%)

Query: 29  VSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFV 88
           + P + VK ++Q +      + G+  A+ +++ E+G+ G +RG G+  +R  P +A  F 
Sbjct: 240 IFPADTVKSMMQTE------HLGLKTAIKKIFVEKGLRGFYRGLGITLIRAIPANATVFY 293

Query: 89  VYEWCKK 95
           VYE   K
Sbjct: 294 VYETLSK 300

 Score = 38.1 bits (87), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 71/172 (41%), Gaps = 33/172 (19%)

Query: 28  VVSPFERVKILLQVQS-----------STSAYNHG-IINAVGQVYKEEGVAGLFRGNGLN 75
           V++P E +K  LQV +           +T    H  II  +  V K  G  GL++G    
Sbjct: 124 VLTPVELIKCKLQVSNLQSLPLGVAGGNTVTERHTRIIPTIQAVIKNRGFIGLWQGQSGT 183

Query: 76  CVRIFPYSAVQFVVYEWCKKHI---FHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPL 132
            +R        F  YE  KK++    +++          W+ L++GA  G     + +P 
Sbjct: 184 FIRESFGGVAWFATYELMKKYLKSRHNIEDPSLPNDNKTWELLASGASAGLAFNASIFPA 243

Query: 133 DLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
           D V++ +  QT +                G+   + K F E+ G+RG YRG+
Sbjct: 244 DTVKSMM--QTEHL---------------GLKTAIKKIFVEK-GLRGFYRGL 277

 Score = 37.7 bits (86), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 30/67 (44%), Gaps = 13/67 (19%)

Query: 118 GALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGI 177
           G++ G +  +  YP D V+ RL  Q  +               P  W  +  T+K EG I
Sbjct: 20  GSIAGALGKVIEYPFDTVKVRLQTQGRHVF-------------PDTWSCITYTYKNEGII 66

Query: 178 RGLYRGI 184
           +G ++GI
Sbjct: 67  KGFFQGI 73

>KLLA0E02772g complement(261895..262749) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11 ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 284

 Score = 40.4 bits (93), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 35/67 (52%), Gaps = 6/67 (8%)

Query: 29  VSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFV 88
           V P + VK + Q +      +  I+NA+ +V +  G+ G +RG G+  +R  P +A  F 
Sbjct: 222 VFPADTVKSVCQTE------HVSIVNALKKVLRTHGITGFYRGLGITLIRAAPANATVFY 275

Query: 89  VYEWCKK 95
            YE  KK
Sbjct: 276 TYETLKK 282

 Score = 38.5 bits (88), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 54/115 (46%), Gaps = 7/115 (6%)

Query: 28  VVSPFERVKILLQVQS-----STSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPY 82
           +++P E VK  LQV +     S +  +  +   +  V KE+G+ GL++G     VR    
Sbjct: 118 ILTPVELVKCKLQVSNISNSLSQTTRHTSVWPTIKSVIKEKGLLGLWQGQLSTFVRECLG 177

Query: 83  SAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRT 137
            AV F  YE  K     +     +++   W+ L +GA  G +   + +P D V++
Sbjct: 178 GAVWFTTYEIMKMKFASLHP--AEKENHTWELLVSGASAGVLFNASVFPADTVKS 230

 Score = 37.4 bits (85), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 33/72 (45%), Gaps = 13/72 (18%)

Query: 113 QRLSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFK 172
           + ++ G++ G +  +  YP D V+ RL  Q A+               P  W  +  T+ 
Sbjct: 9   KDIAYGSVAGAIGKVIEYPFDTVKVRLQTQPAHLY-------------PTTWSCIRSTYT 55

Query: 173 EEGGIRGLYRGI 184
           +EG  +G Y+GI
Sbjct: 56  DEGIWKGFYQGI 67

>YBR192W (RIM2) [375] chr2 (607609..608742) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, required for respiration [1134 bp, 377 aa]
          Length = 377

 Score = 40.8 bits (94), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 71/183 (38%), Gaps = 38/183 (20%)

Query: 28  VVSPFERVKILLQVQSSTSAYNHGIINA--------------------------VGQVYK 61
           V  PF+ VK  LQ      AY    +N                           +G VYK
Sbjct: 69  VTCPFDLVKTRLQSDIFLKAYKSQAVNISKGSTRPKSINYVIQAGTHFKETLGIIGNVYK 128

Query: 62  EEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALC 121
           +EG   LF+G G N V + P  ++ F  Y    K ++      G+E  +    L A A  
Sbjct: 129 QEGFRSLFKGLGPNLVGVIPARSINFFTYG-TTKDMYAKAFNNGQETPM--IHLMAAATA 185

Query: 122 GGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLY 181
           G  +  AT P+ L++TR+ +  A            + +    W+ L    + E G  GLY
Sbjct: 186 GWATATATNPIWLIKTRVQLDKAG--------KTSVRQYKNSWDCLKSVIRNE-GFTGLY 236

Query: 182 RGI 184
           +G+
Sbjct: 237 KGL 239

 Score = 35.8 bits (81), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 50/98 (51%), Gaps = 14/98 (14%)

Query: 54  NAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAV-QFVVYEWCKKHI---------FHVDGT 103
           + +  V + EG  GL++G  L+   +     + Q+++YE  K+ I         +  +GT
Sbjct: 221 DCLKSVIRNEGFTGLYKG--LSASYLGSVEGILQWLLYEQMKRLIKERSIEKFGYQAEGT 278

Query: 104 VG-KEQLLNW-QRLSAGALCGGMSVLATYPLDLVRTRL 139
               E++  W QR  +  L   ++ +ATYP ++VRTRL
Sbjct: 279 KSTSEKVKEWCQRSGSAGLAKFVASIATYPHEVVRTRL 316

>KLLA0E08877g complement(791157..792041) similar to sgd|S0002277
           Saccharomyces cerevisiae YDL119c, start by similarity
          Length = 294

 Score = 40.4 bits (93), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 53/117 (45%), Gaps = 10/117 (8%)

Query: 38  LLQVQSSTSAYNHGIIN-AVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKH 96
           +++V+  ++ Y +  +  A   +++ EG+ G FRG G   +R  PY+ +  + Y+  K  
Sbjct: 127 VIKVRYESTLYQYTSLRYATSHIFRTEGLRGFFRGFGATALRDAPYAGLYMLFYDRMKVL 186

Query: 97  I-FHVDGTVGKEQLLNWQRLSAGALCGGMSVLA--------TYPLDLVRTRLSIQTA 144
           +   +   V K    N     A  L  G S  +        T P D V+TR+ ++ A
Sbjct: 187 VPTLLPSNVVKLNSDNRYSTYASTLINGSSAFSAAVIATSITAPFDTVKTRMQLEPA 243

>AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH]
           complement(702404..703249) [846 bp, 281 aa]
          Length = 281

 Score = 40.4 bits (93), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 34/73 (46%), Gaps = 13/73 (17%)

Query: 112 WQRLSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTF 171
           ++ L  G + G +  L  YP D V+ RL  Q+A             A  P  W  +  T+
Sbjct: 9   YKDLLYGGVAGSLGKLVEYPFDTVKVRLQTQSA-------------ALFPTTWSCVSHTY 55

Query: 172 KEEGGIRGLYRGI 184
           K+EG  RG Y+G+
Sbjct: 56  KQEGLWRGFYQGM 68

 Score = 37.7 bits (86), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%)

Query: 41  VQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYE 91
           V+S+    + G+  AV  V K+ G  G +RG G+  +R  P +AV F VYE
Sbjct: 226 VKSTMQTEHLGLGPAVRTVLKKHGPTGFYRGVGITLLRALPANAVIFYVYE 276

 Score = 34.3 bits (77), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 54/118 (45%), Gaps = 8/118 (6%)

Query: 26  RTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGV-AGLFRGNGLNCVRIFPYSA 84
           + V  PF+ VK+ LQ QS  +A      + V   YK+EG+  G ++G        F   A
Sbjct: 23  KLVEYPFDTVKVRLQTQS--AALFPTTWSCVSHTYKQEGLWRGFYQGMASPVFGAFLEHA 80

Query: 85  VQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQ 142
           V FV +   +  + +       E++     + AGA+ G  +     P++LV+ +L + 
Sbjct: 81  VLFVSFNRAQAVLENCYSCGPLEKV-----VFAGAIAGACTSYVLTPVELVKCKLQVS 133

 Score = 31.2 bits (69), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 39/164 (23%), Positives = 67/164 (40%), Gaps = 32/164 (19%)

Query: 28  VVSPFERVKILLQVQSSTSAYN---HGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSA 84
           V++P E VK  LQV + T         ++  +  + K+ G+ GL++G     +R     A
Sbjct: 119 VLTPVELVKCKLQVSNLTGVSGPRYTAVLPTLRAIVKQNGLGGLWQGQSGTFIRESAGGA 178

Query: 85  VQFVVYE----WCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLS 140
           V F  YE    W  +     + TV       W+ L++GA  G     + +P D V++ + 
Sbjct: 179 VWFTAYEVLKGWLARRRGSTENTV-------WELLASGAGAGAAFHASIFPADTVKSTMQ 231

Query: 141 IQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
            +              +   P      V+T  ++ G  G YRG+
Sbjct: 232 TE-------------HLGLGPA-----VRTVLKKHGPTGFYRGV 257

>CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces
           cerevisiae YBR104w YMC2 or sp|P32331 Saccharomyces
           cerevisiae YPR058w YMC1, start by similarity
          Length = 311

 Score = 40.4 bits (93), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 33/68 (48%), Gaps = 1/68 (1%)

Query: 29  VSPFERVKILLQVQS-STSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQF 87
           V P + VK +LQ  S     Y + II A   +YK+ G+   F+G     +R  P +A  F
Sbjct: 241 VYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATF 300

Query: 88  VVYEWCKK 95
           V +E   +
Sbjct: 301 VSFEMTMR 308

 Score = 36.2 bits (82), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 52/118 (44%), Gaps = 7/118 (5%)

Query: 28  VVSPFERVKILLQVQSSTSAYNH--GIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAV 85
           + +P E V+I LQ Q+S        G  + + ++ K +    L RG     +R       
Sbjct: 143 LAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKA---LMRGLLPTMIRAGHGLGT 199

Query: 86  QFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQT 143
            F  YE      F   GT  + Q+  W+  S GAL G +  L  YP+D+V++ L   +
Sbjct: 200 YFAAYEALVVKEFE-KGT-PRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQTDS 255

 Score = 33.5 bits (75), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 55/119 (46%), Gaps = 10/119 (8%)

Query: 31  PFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVY 90
           PF+  K+ LQ    TS    G+I  V  + + EG    ++G     + +    +VQF V 
Sbjct: 46  PFDTTKVRLQ----TSKTKIGVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVN 101

Query: 91  EWCKKHI--FHVDGTVGKEQL-LNWQRLSAGALCGGM--SVLATYPLDLVRTRLSIQTA 144
           E  K+    ++ D    ++ + L   +     L GG+  S LA  P++ VR RL  QT+
Sbjct: 102 ESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAA-PIEHVRIRLQTQTS 159

>Kwal_55.21106
          Length = 328

 Score = 40.4 bits (93), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 72/179 (40%), Gaps = 39/179 (21%)

Query: 28  VVSPFERVKILLQVQSSTS--------------------AYNHGIINAVGQVYKEEGVAG 67
           VV P + VK L+Q Q+                        Y H + +A+ +++K +GV G
Sbjct: 20  VVYPLDLVKTLIQTQNKEPNIGSEAGVKPQAKKSRVQEIRYKHSL-DALIKIFKTKGVLG 78

Query: 68  LFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFH---VDGTVGKEQLLNWQRLSAGALCGGM 124
           L++G   + +  F  S   F  Y   +K  F    + G +GK      + L  G +   +
Sbjct: 79  LYQGLWTSIIAGFLQSFSYFFWYSIVRKSFFRYKLLRGRLGK--FSTPEELLLGIVAAAV 136

Query: 125 SVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRG 183
           S + T P+ ++ TR    T+                 G  E+L + + E+  I G +RG
Sbjct: 137 SQIFTSPIGVISTRQQTSTS-------------GSKGGFREVLHQIYSEQNNITGFWRG 182

 Score = 34.3 bits (77), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 36/77 (46%), Gaps = 9/77 (11%)

Query: 117 AGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWEL--------LV 168
            GA+   ++ +  YPLDLV+T +  Q               AK   V E+        L+
Sbjct: 9   TGAVASSLANVVVYPLDLVKTLIQTQNKEPNIGSEAGVKPQAKKSRVQEIRYKHSLDALI 68

Query: 169 KTFKEEGGIRGLYRGIY 185
           K FK + G+ GLY+G++
Sbjct: 69  KIFKTK-GVLGLYQGLW 84

>KLLA0B08503g complement(753498..754409) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 303

 Score = 40.0 bits (92), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 52/119 (43%), Gaps = 7/119 (5%)

Query: 28  VVSPFERVKILLQV-QSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQ 86
           V  PF+  K+ LQ  ++ST+A     +  +  + K EG  G ++G     V +    ++Q
Sbjct: 40  VGQPFDTTKVRLQTSETSTNA-----VKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQ 94

Query: 87  FVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTAN 145
           F V E  K+  FH       + L   Q    G   G  +     P++ +R RL  QT +
Sbjct: 95  FGVNEAMKR-FFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGS 152

 Score = 35.4 bits (80), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 55/121 (45%), Gaps = 11/121 (9%)

Query: 28  VVSPFERVKILLQVQ--SSTSAYNHGIINAVGQVYKEEGVAG-LFRGNGLNCVRIFPYSA 84
           + SP E ++I LQ Q  S  +A   G I+ +    K+  V G L RG     +R      
Sbjct: 135 LASPIEHIRIRLQTQTGSGATAEFKGPIDCI----KKLRVNGQLMRGLTPTMLRESHGCG 190

Query: 85  VQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTA 144
           V F+ YE    H   V   + ++ +  W+    GA  G +     YPLD++++ +  QT 
Sbjct: 191 VYFLTYEALIGH--QVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVM--QTD 246

Query: 145 N 145
           N
Sbjct: 247 N 247

 Score = 28.9 bits (63), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 27  TVVSPFERVKILLQVQSSTSAYNHGIINAVGQ-VYKEEGVAGLFRGNGLNCVR 78
           T+V P + +K ++Q  +  +  N   I  VG+ +   +GV+GLF+G     +R
Sbjct: 231 TMVYPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283

>KLLA0D14036g complement(1203522..1204817) some similarities with
           sp|P40556 Saccharomyces cerevisiae YIL006w, hypothetical
           start
          Length = 431

 Score = 40.0 bits (92), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 35/72 (48%), Gaps = 3/72 (4%)

Query: 25  SRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSA 84
           + T+  P E ++  LQ++S        II      Y +EG+ G + G   N  R  P SA
Sbjct: 349 ASTLTYPHEILRTRLQLKSDMKPSIKSIIRTT---YAKEGIRGFYSGFLTNMFRTVPASA 405

Query: 85  VQFVVYEWCKKH 96
           +  V +E+ +KH
Sbjct: 406 ITLVSFEYFRKH 417

 Score = 39.3 bits (90), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 47/181 (25%), Positives = 80/181 (44%), Gaps = 39/181 (21%)

Query: 25  SRTVVSPFERVKILLQVQSSTS----AYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIF 80
           S T+ +P   VK  L +QS  +     +    ++A  ++YK EG+   + G   +   + 
Sbjct: 229 STTLTNPIWVVKTRLMLQSGKNIKGMTHYKNTLDAFIKIYKVEGIKSFYSGLIPSLFGLL 288

Query: 81  PYSAVQFVVYEWCKK------------HIFHVDGTVGKEQL--LNWQ--RLSAGALCGGM 124
            + A+ F VYE  KK               +V+G    +     N+Q  RL   A CG  
Sbjct: 289 -HVAIHFPVYEKLKKVLHCYPSGRPNQETMNVNGNSNPQTTGSTNFQLGRLIV-ASCGSK 346

Query: 125 SVLAT--YPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYR 182
            + +T  YP +++RTRL +++            D+   P +  ++  T+ +E GIRG Y 
Sbjct: 347 MIASTLTYPHEILRTRLQLKS------------DMK--PSIKSIIRTTYAKE-GIRGFYS 391

Query: 183 G 183
           G
Sbjct: 392 G 392

 Score = 36.6 bits (83), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 59/139 (42%), Gaps = 17/139 (12%)

Query: 48  YNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKE 107
           Y  GI   +  + ++E + GL++G     +  FP   + F VYE CK             
Sbjct: 157 YYSGIWGTLTTIVRDESIRGLYKGIVPIVLGYFPTWMIYFSVYERCK---LSYPRYFNNS 213

Query: 108 QLL--NWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWE 165
           + L  +   L+AGA+    S   T P+ +V+TRL +Q+             +       +
Sbjct: 214 EFLSHSMSALTAGAI----STTLTNPIWVVKTRLMLQSGKNIKGMTHYKNTL-------D 262

Query: 166 LLVKTFKEEGGIRGLYRGI 184
             +K +K E GI+  Y G+
Sbjct: 263 AFIKIYKVE-GIKSFYSGL 280

 Score = 35.0 bits (79), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 34/74 (45%), Gaps = 7/74 (9%)

Query: 117 AGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKP------PGVWELLVKT 170
           +GAL G ++ +   PLD+ +TRL  Q              +A         G+W  L   
Sbjct: 109 SGALAGFLAGVIVCPLDVAKTRLQAQGLQLNGPVTRPVGSVATTFGGKYYSGIWGTLTTI 168

Query: 171 FKEEGGIRGLYRGI 184
            ++E  IRGLY+GI
Sbjct: 169 VRDE-SIRGLYKGI 181

>Kwal_55.21335
          Length = 317

 Score = 39.7 bits (91), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 51/117 (43%), Gaps = 5/117 (4%)

Query: 28  VVSPFERVKILLQVQS--STSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAV 85
           V++P E +K  LQV +    +  +  I   V  + + +G+ GL++G     +R     AV
Sbjct: 156 VLTPVELIKCTLQVSNLEGATTRHSKIWPTVKHIVQHKGIGGLWQGQSSTFIRECAGGAV 215

Query: 86  QFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQ 142
            F  YE  K ++              W+ L++GA  G     + +P D +++    Q
Sbjct: 216 WFTTYESLKSYLARRRNDTENH---TWELLASGASAGVAFNASIFPADTIKSTAQTQ 269

 Score = 39.7 bits (91), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 30/51 (58%)

Query: 41  VQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYE 91
           ++S+    + GI++A  ++    G AGL+RG G+  +R  P +A+ F  YE
Sbjct: 262 IKSTAQTQHLGIVDATKRILARSGPAGLYRGLGITLIRAAPANAIVFYTYE 312

 Score = 38.1 bits (87), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 32/67 (47%), Gaps = 13/67 (19%)

Query: 118 GALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGI 177
           G++ G    +  YPLD ++ RL  Q A+               P  W  +  T+++EG +
Sbjct: 52  GSIAGAAGKVIEYPLDTIKVRLQTQPAHVF-------------PTSWSCIKYTYQKEGFV 98

Query: 178 RGLYRGI 184
           +G Y+G+
Sbjct: 99  KGFYQGV 105

>CAGL0K07436g complement(734496..735419) highly similar to sp|Q04013
           Saccharomyces cerevisiae YMR241w, hypothetical start
          Length = 307

 Score = 39.7 bits (91), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 62/130 (47%), Gaps = 18/130 (13%)

Query: 59  VYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGK-EQLLNWQRLSA 117
           +YK+EG+ G+ +G     +R       +F +    +  I  + G  GK ++L   +++ A
Sbjct: 155 IYKKEGIRGINKGVNAVAIRQMTNWGSRFGLSRLVEDGIRKLTGKTGKDDKLTALEKIMA 214

Query: 118 GALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFK---EE 174
            A+ GG+S     P++++R  +  +             D  +P  +   + KTFK   + 
Sbjct: 215 SAIGGGLSAW-NQPIEVIRVEMQSK-----------KEDPNRPKNL--TVGKTFKYIYQS 260

Query: 175 GGIRGLYRGI 184
            G++GLYRG+
Sbjct: 261 NGLKGLYRGV 270

>CAGL0K08250g complement(820185..821078) highly similar to sp|P23500
           Saccharomyces cerevisiae YKR052c Mitochondrial RNA
           splicing protein, hypothetical start
          Length = 297

 Score = 39.7 bits (91), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 31/157 (19%), Positives = 62/157 (39%), Gaps = 17/157 (10%)

Query: 28  VVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQF 87
           +++PF+ +K  +Q+ +  S ++         +Y +EG A  +       V   P++A  F
Sbjct: 129 LMNPFDVIKQRMQLNTRESVWH-----VTKNIYHKEGFAAFYYSYPTTLVMNIPFAAFNF 183

Query: 88  VVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTANXX 147
            +YE   K +          +   +    +G L G      T PLD ++T L ++ +   
Sbjct: 184 AIYESATKFM------NPSNEYNPFIHCISGGLSGATCAAITTPLDCIKTVLQVRGSE-- 235

Query: 148 XXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
                   +I K    ++       +  G +G  RG+
Sbjct: 236 ----TVSNEIMKQANTFQRAASAIYKIHGWKGFLRGL 268

 Score = 34.7 bits (78), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 34/77 (44%), Gaps = 7/77 (9%)

Query: 28  VVSPFERVKILLQVQSSTSAYN------HGIINAVGQVYKEEGVAGLFRGNGLNCVRIFP 81
           + +P + +K +LQV+ S +  N      +    A   +YK  G  G  RG     +   P
Sbjct: 218 ITTPLDCIKTVLQVRGSETVSNEIMKQANTFQRAASAIYKIHGWKGFLRGLKPRVIANMP 277

Query: 82  YSAVQFVVYEWCKKHIF 98
            +A+ +  YE C KH  
Sbjct: 278 ATAISWTSYE-CAKHFL 293

>AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH]
           complement(1408478..1409410) [933 bp, 310 aa]
          Length = 310

 Score = 39.7 bits (91), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 59/130 (45%), Gaps = 17/130 (13%)

Query: 58  QVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSA 117
           Q++  EG+ G+ +G     +R       +F +    +  I  V      E+L   +++ A
Sbjct: 159 QIFAAEGLRGINKGVNAVAIRQMTNWGSRFGLSRLVEDGIRRVTHKRSDEKLSAMEKIVA 218

Query: 118 GALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFK---EE 174
            AL GG+S     P++++R  +  +T            D  +P  +   + KTF+   E 
Sbjct: 219 SALGGGLSAW-NQPIEVIRVEMQSRT-----------NDPNRPKNL--TVGKTFRYIYEN 264

Query: 175 GGIRGLYRGI 184
            G+RGLYRG+
Sbjct: 265 NGLRGLYRGV 274

>KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyces
           cerevisiae YPR128c, start by similarity
          Length = 355

 Score = 39.7 bits (91), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 42/92 (45%), Gaps = 2/92 (2%)

Query: 48  YNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGK- 106
           Y H + + + +VY+ EG  GL+ G   + +  F  S   F  Y   ++H F V    G+ 
Sbjct: 87  YKHAL-DVIVKVYRNEGFGGLYHGLSASLLGTFIQSFSYFFWYTLIRRHYFRVKKVKGEA 145

Query: 107 EQLLNWQRLSAGALCGGMSVLATYPLDLVRTR 138
            +    + L    L    S L T P+++V T+
Sbjct: 146 ARFSTIEELLLSMLAAATSQLFTNPINIVSTK 177

 Score = 29.3 bits (64), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 16/25 (64%)

Query: 118 GALCGGMSVLATYPLDLVRTRLSIQ 142
           GA+  G + LA YPLDL +T +  Q
Sbjct: 10  GAVSSGFANLAVYPLDLAKTVIQTQ 34

>YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF) of membrane transporters [879 bp, 292 aa]
          Length = 292

 Score = 39.3 bits (90), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 65/158 (41%), Gaps = 24/158 (15%)

Query: 31  PFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVA-GLFRGNGLNCVRIFPYSAVQFVV 89
           PF+ VK+ LQ Q+S         + +   Y+ EG+A G F+G     V     +A  FV 
Sbjct: 33  PFDTVKVRLQTQASNVFPT--TWSCIKFTYQNEGIARGFFQGIASPLVGACLENATLFVS 90

Query: 90  YEWCKKHIFHVDGTVGKEQLLN----WQRLSAGALCGGMSVLATYPLDLVRTRLSIQTAN 145
           Y  C K +         E+  N     Q L +G + G  + L   P++LV+ +L  Q AN
Sbjct: 91  YNQCSKFL---------EKHTNVFPLGQILISGGVAGSCASLVLTPVELVKCKL--QVAN 139

Query: 146 XXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRG 183
                         P       +K    E G+ GL++G
Sbjct: 140 LQVASAKTKHTKVLPT------IKAIITERGLAGLWQG 171

 Score = 35.4 bits (80), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 29/67 (43%), Gaps = 13/67 (19%)

Query: 118 GALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGI 177
           G++ G    +  +P D V+ RL  Q +N               P  W  +  T++ EG  
Sbjct: 20  GSIAGACGKVIEFPFDTVKVRLQTQASNVF-------------PTTWSCIKFTYQNEGIA 66

Query: 178 RGLYRGI 184
           RG ++GI
Sbjct: 67  RGFFQGI 73

 Score = 35.4 bits (80), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 37/163 (22%), Positives = 67/163 (41%), Gaps = 24/163 (14%)

Query: 28  VVSPFERVKILLQV---QSSTSAYNHG-IINAVGQVYKEEGVAGLFRGNGLNCVRIFPYS 83
           V++P E VK  LQV   Q +++   H  ++  +  +  E G+AGL++G     +R     
Sbjct: 124 VLTPVELVKCKLQVANLQVASAKTKHTKVLPTIKAIITERGLAGLWQGQSGTFIRESFGG 183

Query: 84  AVQFVVYEWCKKHI--FHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSI 141
              F  YE  KK +   H      +++   W+ L +G   G     + +P D V++ +  
Sbjct: 184 VAWFATYEIVKKSLKDRHSLDDPKRDESKIWELLISGGSAGLAFNASIFPADTVKSVMQT 243

Query: 142 QTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
           +  +                      VK    + G++G YRG+
Sbjct: 244 EHISLTNA------------------VKKIFGKFGLKGFYRGL 268

 Score = 34.7 bits (78), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 33/61 (54%), Gaps = 6/61 (9%)

Query: 31  PFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVY 90
           P + VK ++Q +      +  + NAV +++ + G+ G +RG G+   R  P +A  F ++
Sbjct: 233 PADTVKSVMQTE------HISLTNAVKKIFGKFGLKGFYRGLGITLFRAVPANAAVFYIF 286

Query: 91  E 91
           E
Sbjct: 287 E 287

>Scas_582.7
          Length = 329

 Score = 39.3 bits (90), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 27/118 (22%), Positives = 51/118 (43%), Gaps = 17/118 (14%)

Query: 29  VSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFV 88
           ++PF+ +K  +Q+   +      + N   ++Y  EG++  +           P++A  F+
Sbjct: 153 MNPFDTIKQRMQI---SDLKKEKVYNVAKKIYNLEGLSAFYYSYPTTIAMNIPFAAFNFM 209

Query: 89  VYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMS----VLATYPLDLVRTRLSIQ 142
           +YE   K             L ++  L    LCGG+S       T PLD ++T + I+
Sbjct: 210 IYESASKFF---------NPLHHYNPL-IHCLCGGISGAIAAAVTTPLDCIKTVIQIR 257

 Score = 31.6 bits (70), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 27/118 (22%), Positives = 50/118 (42%), Gaps = 13/118 (11%)

Query: 31  PFERVKILLQVQSS--TSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFV 88
           P + +K  +Q  ++  T   +  II  + ++   EG   L++G     +   P  AV F 
Sbjct: 56  PIDALKTRIQSTTTKGTEQTSTSIIKQISKISTMEGSLALWKGVQSVILGAGPAHAVYFA 115

Query: 89  VYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLAT----YPLDLVRTRLSIQ 142
            YE+ K H+      +   Q    Q +   A+ G  + +A+     P D ++ R+ I 
Sbjct: 116 TYEFTKAHL------IPDSQRETHQPIKV-AVSGATATVASDFFMNPFDTIKQRMQIS 166

>Scas_562.12
          Length = 300

 Score = 38.9 bits (89), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 72/158 (45%), Gaps = 24/158 (15%)

Query: 28  VVSPFERVKILLQVQSSTSAYN-HGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQ 86
           V+ P + +KI  + Q++  A+   G +    ++ K+EG+  L+RG G    R  P S   
Sbjct: 135 VLLPLDVLKI--KRQTNPEAFKGRGFV----KILKDEGIFNLYRGWGWTAARNAPGSFAL 188

Query: 87  FVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTANX 146
           F    + K++I  ++         N+     GA C   S++ + PLD+++TR+  ++ + 
Sbjct: 189 FGGNAFAKEYILGLEDYSQASWSQNFISSIVGASC---SLIVSAPLDVIKTRIQNRSFD- 244

Query: 147 XXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
                        P     ++  TFK E GI   ++G+
Sbjct: 245 ------------NPETGLTIVKNTFKNE-GITAFFKGL 269

>CAGL0D04774g complement(467712..468680) similar to tr|Q06497
           Saccharomyces cerevisiae YPR128c, start by similarity
          Length = 322

 Score = 38.9 bits (89), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 54/129 (41%), Gaps = 19/129 (14%)

Query: 27  TVVSPFERVKILLQVQ--------SSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVR 78
           T V P +  K L+Q Q        S        +I+ + +++K+ G  GL++G   N   
Sbjct: 19  TTVYPLDLAKTLIQTQHKNADSGDSKEEEKYKNVIDCIIKIFKKRGFLGLYQGLATNVAA 78

Query: 79  IFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLN---------WQRLSAGALCGGMSVLAT 129
            F  + + F  Y   + + F      G+ QL +          + L+ G   G M+ + T
Sbjct: 79  NFVQNFIYFFWYSLIRSNYFVFKA--GRLQLKDDSKFIELSTIEELALGMSAGAMTQVVT 136

Query: 130 YPLDLVRTR 138
            P+ ++ TR
Sbjct: 137 NPISVISTR 145

 Score = 33.9 bits (76), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 4/67 (5%)

Query: 118 GALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGI 177
           GA+   ++    YPLDL +T +  Q  N          +  K   V + ++K FK+ G +
Sbjct: 10  GAVASSLAATTVYPLDLAKTLIQTQHKN---ADSGDSKEEEKYKNVIDCIIKIFKKRGFL 66

Query: 178 RGLYRGI 184
            GLY+G+
Sbjct: 67  -GLYQGL 72

>AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 315
           aa]
          Length = 315

 Score = 38.9 bits (89), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 52/115 (45%), Gaps = 5/115 (4%)

Query: 53  INAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNW 112
           + AV ++Y++EGV G + G       +   S   +  YE   +    V G+    +L   
Sbjct: 61  LEAVREIYRKEGVVGFYYGLESAMYGMAANSLNYYYFYELAARATMRVRGS---RRLNTS 117

Query: 113 QRLSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELL 167
           + + + A+ G M+ +A+ P+ +V TR+++  A           DI +  GV  L 
Sbjct: 118 EAILSSAVAGSMTAIASNPIWVVNTRMTV--AKSEQSTLAVLLDIVRKDGVTALF 170

>YBR104W (YMC2) [293] chr2 (449624..450613) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [990 bp, 329 aa]
          Length = 329

 Score = 38.9 bits (89), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 63/159 (39%), Gaps = 18/159 (11%)

Query: 28  VVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQF 87
           + SP E+++I LQ Q+S    +         + K +   GL RG     +R        F
Sbjct: 159 LASPIEQIRIRLQTQTSNGG-DREFKGPWDCIKKLKAQGGLMRGLFPTMIRAGHGLGTYF 217

Query: 88  VVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTANXX 147
           +VYE        +   + + ++  W+    GA  G M  L  YPLD+V++ +        
Sbjct: 218 LVYEALVAR--EIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDVVKSIIQ------- 268

Query: 148 XXXXXXXXDIAKP--PGVWELLVKTFKEEGGIRGLYRGI 184
                   D+ KP        + KT   + GIR  ++G 
Sbjct: 269 ------NDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGF 301

 Score = 33.5 bits (75), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 31/71 (43%), Gaps = 1/71 (1%)

Query: 28  VVSPFERVKILLQVQS-STSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQ 86
            V P + VK ++Q        Y + I      +Y +EG+   F+G G   VR  P +   
Sbjct: 256 TVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGAT 315

Query: 87  FVVYEWCKKHI 97
           F+ +E   + +
Sbjct: 316 FLTFELVMRFL 326

 Score = 32.3 bits (72), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 43/168 (25%), Positives = 71/168 (42%), Gaps = 29/168 (17%)

Query: 28  VVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQF 87
           V  PF+  K+ LQ  ++ +     + N V    K EGV   ++G     + +    +VQF
Sbjct: 51  VGQPFDTTKVRLQTATTRTTTLEVLRNLV----KNEGVFAFYKGALTPLLGVGICVSVQF 106

Query: 88  VVYEWCKK-----------HIFHVDGTVGKEQLLNWQRLSAGALCGGM--SVLATYPLDL 134
            V E  K+           ++   D  + +   L   +     L GG+  S LA+ P++ 
Sbjct: 107 GVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGVVNSFLAS-PIEQ 165

Query: 135 VRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGI-RGLY 181
           +R RL  QT+N                G W+  +K  K +GG+ RGL+
Sbjct: 166 IRIRLQTQTSNGGDREFK---------GPWD-CIKKLKAQGGLMRGLF 203

>Scas_673.17
          Length = 314

 Score = 38.5 bits (88), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 56/115 (48%), Gaps = 8/115 (6%)

Query: 31  PFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVY 90
           P + VK  +Q++ +   YN G++ +  ++  +EG   L  G G   +      A +F  Y
Sbjct: 40  PVDVVKTRIQLEPT--VYNKGMVGSFKKIIADEGAGALLTGFGPTLLGYSVQGAFKFGGY 97

Query: 91  EWCKKHIFHVDGTVGKEQLLNWQR---LSAGALCGGMSVLATYPLDLVRTRLSIQ 142
           E  KK    +D T+G E  ++++    + + A+   ++ +A  PL+  R RL  Q
Sbjct: 98  EVFKK--LSID-TIGYENAVHYKNSVYMGSAAVAEFLADIALCPLEATRIRLVSQ 149

 Score = 37.0 bits (84), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/114 (22%), Positives = 52/114 (45%), Gaps = 9/114 (7%)

Query: 31  PFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVY 90
           P E  +I L  Q +   + +G++    ++ KEEGV   + G      +  PY+  +F+V+
Sbjct: 138 PLEATRIRLVSQPT---FANGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIAKFLVF 194

Query: 91  EWCKKHIFHVDGTVGKEQLLNWQ----RLSAGALCGGMSVLATYPLDLVRTRLS 140
           E   +  + + G   KE L +       L +G   G  +   + P D + ++++
Sbjct: 195 ERASEVYYGIVGA--KETLSDMTNTGINLLSGLTAGFAAAFVSQPADTLLSKVN 246

>AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH]
           complement(587623..588513) [891 bp, 296 aa]
          Length = 296

 Score = 38.5 bits (88), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 44/100 (44%), Gaps = 14/100 (14%)

Query: 84  AVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQT 143
           AV+F  Y   K+ +    GT   + L + Q    GAL G ++V AT P+D V+TR+    
Sbjct: 184 AVRFGCYTQLKQAVQRYAGTPADQPLGSGQTFLVGALSGIVTVYATMPVDTVKTRMQ--- 240

Query: 144 ANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRG 183
                       D A+            +EE G+R L+RG
Sbjct: 241 ----------ALDAARYGSTVGCFRAVVREE-GVRALWRG 269

>YPL134C (ODC1) [5311] chr16 complement(298570..299502)
           2-Oxodicarboxylate transporter, has specificity for
           2-oxoadipate and 2-oxoglutarate, member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [933 bp, 310 aa]
          Length = 310

 Score = 38.5 bits (88), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 37/72 (51%), Gaps = 2/72 (2%)

Query: 114 RLSAGALCGGMSVLATYPLDLVRTRLSIQ-TANXXXXXXXXXXDIAKPPGVWELLVKTFK 172
           + +AGA+ G   +L  YPLD+V+TR+ +Q T             +    GV + L K  K
Sbjct: 14  QFTAGAIAGVSELLVMYPLDVVKTRMQLQVTTKGHPAVVAAKAAVDHYTGVMDCLTKIVK 73

Query: 173 EEGGIRGLYRGI 184
           +E G   LY+GI
Sbjct: 74  KE-GFSHLYKGI 84

 Score = 34.7 bits (78), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 28/127 (22%), Positives = 58/127 (45%), Gaps = 19/127 (14%)

Query: 28  VVSPFERVKILLQVQSSTSAY----------NH--GIINAVGQVYKEEGVAGLFRGNGLN 75
           V+ P + VK  +Q+Q +T  +          +H  G+++ + ++ K+EG + L++G    
Sbjct: 28  VMYPLDVVKTRMQLQVTTKGHPAVVAAKAAVDHYTGVMDCLTKIVKKEGFSHLYKGITSP 87

Query: 76  CVRIFPYSAVQFV---VYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPL 132
            +   P  A++F     ++   K IF        +++     + +GA  G +      P 
Sbjct: 88  ILMEAPKRAIKFSGNDTFQTFYKKIFPTPNGEMTQKI----AIYSGASAGAVEAFVVAPF 143

Query: 133 DLVRTRL 139
           +LV+ RL
Sbjct: 144 ELVKIRL 150

 Score = 31.6 bits (70), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 49/112 (43%), Gaps = 7/112 (6%)

Query: 28  VVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQF 87
           VV+PFE VKI LQ     ++     I  V     + GV  LF G      R   ++A  F
Sbjct: 139 VVAPFELVKIRLQ---DVNSQFKTPIEVVKNSVVKGGVLSLFNGLEATIWRHVLWNAGYF 195

Query: 88  VVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRL 139
            +    +K +     +  K +      L AGA+ G +  L   P D+V++R+
Sbjct: 196 GIIFQIRKLLPAAKTSTEKTR----NDLIAGAIGGTVGCLLNTPFDVVKSRI 243

 Score = 30.8 bits (68), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 31/61 (50%)

Query: 30  SPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVV 89
           +PF+ VK  +Q  S      +  + +V  VY+EEG   L++G     +R+ P   +  VV
Sbjct: 234 TPFDVVKSRIQRSSGPLRKYNWSLPSVLLVYREEGFKALYKGFAPKVMRLAPGGGLLLVV 293

Query: 90  Y 90
           +
Sbjct: 294 F 294

>CAGL0G08910g complement(853693..854562) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1, hypothetical
           start
          Length = 289

 Score = 38.5 bits (88), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 66/147 (44%), Gaps = 8/147 (5%)

Query: 28  VVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEG--VAGLFRGNGLNCVRIFPYSAV 85
           +V P +  K+ LQ+   TS    G  N   ++   +      L+RG  +N V       +
Sbjct: 25  IVHPLDLFKVRLQLLI-TSTTKKGYRNLWSEIVGSDLSLTRELYRGLTVNLVGNTIAWGL 83

Query: 86  QFVVYEWCKKHIFHVDGTVGKEQ-LLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTA 144
            F  Y   K ++ + +  +  ++ L +W  LSA A  G ++ + T PL +++TR+ +  A
Sbjct: 84  YFASYRVAKDYLINYNHRIRNDKDLSSWMYLSASASSGMLTTVLTNPLWVIKTRM-MSKA 142

Query: 145 NXXXXXXXXXXDIAKPPGV---WELLV 168
           N          D+ K  GV   W+ LV
Sbjct: 143 NSDLTSMKVLRDLIKNDGVQGLWKGLV 169

 Score = 34.7 bits (78), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 35/68 (51%), Gaps = 3/68 (4%)

Query: 25  SRTVVSPFERVKILLQ-VQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYS 83
           S + V PF+ +K  LQ  Q+S + +   ++     +Y   G+ G ++G   N +R  P +
Sbjct: 218 STSAVYPFQLLKSNLQSFQASENDFK--LLPLSKMIYSRSGLLGFYKGLSANLLRSVPST 275

Query: 84  AVQFVVYE 91
            + F +YE
Sbjct: 276 CITFCIYE 283

>AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH]
           (1500683..1501609) [927 bp, 308 aa]
          Length = 308

 Score = 38.1 bits (87), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 38/79 (48%), Gaps = 5/79 (6%)

Query: 31  PFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVY 90
           P E  +I L  Q +   + +G++    ++ KEEG+   + G      +  PY+  +FVV+
Sbjct: 133 PLEATRIRLVSQPT---FANGLVGGFARILKEEGIGSFYNGFTPILFKQIPYNIAKFVVF 189

Query: 91  EWCKKHIFHVDGTVGKEQL 109
           E      F + G+  KE L
Sbjct: 190 EHAANAYFGLAGS--KENL 206

>Scas_714.18
          Length = 305

 Score = 38.1 bits (87), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 54/133 (40%), Gaps = 22/133 (16%)

Query: 52  IINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLN 111
           II  +  + KE+G+ GL++G     +R    S V F  YE  K+ +      V       
Sbjct: 170 IIPTIKSIIKEKGLFGLWQGQSSTFIRESIGSVVWFATYELMKQTLRDPKSEVNT----T 225

Query: 112 WQRLSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTF 171
           WQ L +GA  G     + +P D V++ +  QT +                      V++ 
Sbjct: 226 WQLLISGATAGLAFNGSVFPADTVKSIM--QTEHLALMET----------------VRSI 267

Query: 172 KEEGGIRGLYRGI 184
            E  G+ G YRG+
Sbjct: 268 LERDGVAGFYRGL 280

 Score = 38.1 bits (87), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 29/68 (42%), Gaps = 13/68 (19%)

Query: 117 AGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGG 176
           AG++ G +     YP D V+ RL  Q A                P  W  +  T++ EG 
Sbjct: 18  AGSIAGAIGKFIEYPFDTVKVRLQTQEAYMF-------------PSTWSCIKYTYENEGI 64

Query: 177 IRGLYRGI 184
           + G Y+GI
Sbjct: 65  LEGFYQGI 72

 Score = 37.0 bits (84), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 34/67 (50%), Gaps = 6/67 (8%)

Query: 29  VSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFV 88
           V P + VK ++Q +      +  ++  V  + + +GVAG +RG G+  +R  P +A  F 
Sbjct: 243 VFPADTVKSIMQTE------HLALMETVRSILERDGVAGFYRGLGITLLRAVPSNAAVFY 296

Query: 89  VYEWCKK 95
            YE   K
Sbjct: 297 TYEKLSK 303

>Kwal_33.12988
          Length = 303

 Score = 38.1 bits (87), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/150 (23%), Positives = 61/150 (40%), Gaps = 14/150 (9%)

Query: 31  PFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVY 90
           PF+  K+ LQ  S+ +      +  V  + K EG+ G ++G  L  + +    + QF   
Sbjct: 43  PFDITKVRLQTSSTPTT----ALRVVQDLVKNEGLRGFYKGTTLPLIGVGLCVSSQFGTN 98

Query: 91  EWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXX 150
           E  K++ FH         L   +  + G + G  +     P++ VR  L +QT +     
Sbjct: 99  EAMKRY-FHKRNNFQSTSLRLPEYYACGFVSGCANAFLATPIEHVRILLQVQTKSRAD-- 155

Query: 151 XXXXXDIAKPPGVWELLVKTFKEEGGIRGL 180
                  A+  G  + + K  KE   +RG 
Sbjct: 156 -------AEYQGAMDCIKKLLKEGKLMRGF 178

>YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 38.1 bits (87), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 56/120 (46%), Gaps = 9/120 (7%)

Query: 28  VVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQF 87
           V  PF+  K+ LQ  S+ +      +  V ++   EG  G ++G     + +    ++QF
Sbjct: 42  VGQPFDTTKVRLQTSSTPTT----AMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQF 97

Query: 88  VVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGM--SVLATYPLDLVRTRLSIQTAN 145
            V E  K+   H +  +     L+  +  A  + GG+  S LA+ P++ VR RL  QT +
Sbjct: 98  GVNEAMKRFFHHRNADM--SSTLSLPQYYACGVTGGIVNSFLAS-PIEHVRIRLQTQTGS 154

 Score = 37.7 bits (86), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 67/161 (41%), Gaps = 20/161 (12%)

Query: 28  VVSPFERVKILLQVQ--SSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAV 85
           + SP E V+I LQ Q  S T+A   G +  + ++   +    L RG     +R       
Sbjct: 137 LASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKA---LLRGLTPTILREGHGCGT 193

Query: 86  QFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTAN 145
            F+VYE    +  +    + ++ +  W+    GAL G    L  YPLD++++   +QT N
Sbjct: 194 YFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKS--VMQTDN 251

Query: 146 XXXXXXXXXXDIAKPP--GVWELLVKTFKEEGGIRGLYRGI 184
                      + KP        + KT    GGI   ++G 
Sbjct: 252 -----------LQKPKFGNSISSVAKTLYANGGIGAFFKGF 281

>Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement
          Length = 288

 Score = 37.7 bits (86), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 52/114 (45%), Gaps = 7/114 (6%)

Query: 30  SPFERVKILLQVQSSTSA-YNHGIINAVGQVYK---EEGVAGLFRGNGLNCVRIFPYSAV 85
           +P + V I +Q  SS  A       NA   +YK    EGVA LF G   N VR    ++ 
Sbjct: 119 NPADVVNIRMQNDSSLPAELRRNYKNAADGLYKICSGEGVAKLFTGWQPNLVRGILMTSS 178

Query: 86  QFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRL 139
           Q V Y+  K ++      VG ++       ++  L G ++     P D+++TR+
Sbjct: 179 QVVTYDIAKNYLVQ---NVGLDKDNKSTHFASSLLAGLVATTVCSPADVIKTRV 229

 Score = 34.3 bits (77), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 47/110 (42%), Gaps = 10/110 (9%)

Query: 31  PFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVY 90
           P +  K+ LQ   +  A    ++    Q+ + EGV GL+ G     +R   Y+  +F VY
Sbjct: 28  PLDLAKVRLQ---TAPAPKPTLVRMASQILRNEGVPGLYSGLTAAILRQCTYTTARFGVY 84

Query: 91  EWCKKHIFHVDGTVGKEQLLNW-QRLSAGALCGGMSVLATYPLDLVRTRL 139
           ++ K+        + KE L +    L      G +  L   P D+V  R+
Sbjct: 85  DFVKERY------IPKEYLNSMLYLLPCSMFSGAVGGLIGNPADVVNIRM 128

 Score = 32.3 bits (72), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 41/91 (45%), Gaps = 2/91 (2%)

Query: 6   LAKQESSIAFIXXXXXXXXSRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGV 65
           L K   S  F         + TV SP + +K   +V ++    +   +  +    K+EG 
Sbjct: 196 LDKDNKSTHFASSLLAGLVATTVCSPADVIKT--RVMNAHKHSHDSAVRILLDAVKQEGP 253

Query: 66  AGLFRGNGLNCVRIFPYSAVQFVVYEWCKKH 96
           + +FRG   + VR+ P + + F+  E  +KH
Sbjct: 254 SFMFRGWLPSFVRLGPNTILIFLTVEQLRKH 284

>ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C
           (ODC1) - SH] complement(546745..547644) [900 bp, 299 aa]
          Length = 299

 Score = 37.7 bits (86), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 51/114 (44%), Gaps = 5/114 (4%)

Query: 28  VVSPFERVK--ILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAV 85
           V+ P + VK  + LQVQ     +  G+++ + ++   EGV  L++G     +   P  A 
Sbjct: 28  VMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISSPILMEAPKRAT 87

Query: 86  QFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRL 139
           +F   +  +K         G E+L     + AGA  G +      P +LV+ RL
Sbjct: 88  KFACNDEFQKLYKQ---AFGVEKLSQPLSMLAGASAGCVEAFVVVPFELVKIRL 138

 Score = 34.3 bits (77), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 72/163 (44%), Gaps = 30/163 (18%)

Query: 28  VVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQF 87
           VV PFE VKI  ++Q ++S+Y  G ++ V ++   EGV  ++ G      R   ++   F
Sbjct: 127 VVVPFELVKI--RLQDASSSYK-GPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYF 183

Query: 88  VVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTANXX 147
            +    +  +        K Q +    +S    C    +L+T P D+V++R+        
Sbjct: 184 GIIFQARALL---PAAHNKTQCITNDLISDSIGCSIGCMLST-PFDVVKSRIQ------- 232

Query: 148 XXXXXXXXDIAKPPGV-----WEL--LVKTFKEEGGIRGLYRG 183
                   + A  PGV     W L  L+  ++EE G R LY+G
Sbjct: 233 --------NTAVIPGVVRKYNWSLPSLLTIYREE-GFRALYKG 266

 Score = 32.3 bits (72), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 34/70 (48%), Gaps = 14/70 (20%)

Query: 117 AGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKP--PGVWELLVKTFKEE 174
           AGA+ G   +L  YPLD+V+TR+ +Q               A P   GV + L K    E
Sbjct: 17  AGAVAGVSEILVMYPLDVVKTRMQLQVQGG-----------AGPHYTGVVDCLKKIVAGE 65

Query: 175 GGIRGLYRGI 184
           G  R LY+GI
Sbjct: 66  GVGR-LYKGI 74

>YLR348C (DIC1) [3731] chr12 complement(826976..827872)
           Mitochondrial dicarboxylate transport protein, member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [897 bp, 298 aa]
          Length = 298

 Score = 37.7 bits (86), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 63/157 (40%), Gaps = 17/157 (10%)

Query: 28  VVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQF 87
           V  P +  K+ LQ           +   +  +   EGV GL+ G     +R   Y+ V+F
Sbjct: 30  VTHPLDLAKVRLQAAPMPKP---TLFRMLESILANEGVVGLYSGLSAAVLRQCTYTTVRF 86

Query: 88  VVYEWCKKHIFHVDGTVGKEQLLNWQR-LSAGALCGGMSVLATYPLDLVRTRLSIQTANX 146
             Y+  K+++      + +EQL N    L      G +  LA    D+V  R+   +A  
Sbjct: 87  GAYDLLKENV------IPREQLTNMAYLLPCSMFSGAIGGLAGNFADVVNIRMQNDSALE 140

Query: 147 XXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRG 183
                     I    GV+    K ++ EGG++ L+ G
Sbjct: 141 AAKRRNYKNAID---GVY----KIYRYEGGLKTLFTG 170

 Score = 37.4 bits (85), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 52/111 (46%), Gaps = 10/111 (9%)

Query: 35  VKILLQVQSS-TSAYNHGIINAVGQVYK----EEGVAGLFRGNGLNCVRIFPYSAVQFVV 89
           V I +Q  S+  +A      NA+  VYK    E G+  LF G   N VR    +A Q V 
Sbjct: 129 VNIRMQNDSALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMVRGILMTASQVVT 188

Query: 90  YEWCKKHIF-HVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRL 139
           Y+  K ++   +D    K    N+  L+A  L G ++     P D+++TR+
Sbjct: 189 YDVFKNYLVTKLDFDASK----NYTHLTASLLAGLVATTVCSPADVMKTRI 235

 Score = 28.5 bits (62), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 35/72 (48%), Gaps = 3/72 (4%)

Query: 25  SRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSA 84
           + TV SP + +K  +    + S  +   +  +    ++EG + +FRG   +  R+ P++ 
Sbjct: 221 ATTVCSPADVMKTRIM---NGSGDHQPALKILADAVRKEGPSFMFRGWLPSFTRLGPFTM 277

Query: 85  VQFVVYEWCKKH 96
           + F   E  KKH
Sbjct: 278 LIFFAIEQLKKH 289

>Kwal_27.12599
          Length = 304

 Score = 37.4 bits (85), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 54/117 (46%), Gaps = 9/117 (7%)

Query: 31  PFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVY 90
           PF+  K+ LQ  ++ +      +  V ++ K EG+ G ++G     V +    + QF V 
Sbjct: 44  PFDTTKVRLQTSTTPTT----AVEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVN 99

Query: 91  EWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGM--SVLATYPLDLVRTRLSIQTAN 145
           E  K+  F    +    + L   +       GG+  S LA+ P++ VR RL  QTA+
Sbjct: 100 EAMKR--FFRGSSADPHKTLTLPQYYICGFVGGVANSFLAS-PIEHVRIRLQTQTAS 153

 Score = 36.2 bits (82), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 53/120 (44%), Gaps = 9/120 (7%)

Query: 28  VVSPFERVKILLQVQ--SSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAV 85
           + SP E V+I LQ Q  S T A   G ++ + ++        L RG     +R     A 
Sbjct: 136 LASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRAN---GALMRGLSPTILREAQGCAT 192

Query: 86  QFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTAN 145
            F+ YE    +   +   + +  +  W+    GA+ G    L  YPLD++++ +  QT N
Sbjct: 193 YFLTYEALVAN--QIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLM--QTDN 248

>CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomyces
           cerevisiae YJR077c MIR1, hypothetical start
          Length = 307

 Score = 37.4 bits (85), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 48/112 (42%), Gaps = 2/112 (1%)

Query: 31  PFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVY 90
           P + VK  +Q++ +   YN G++ +  ++  EEG   L  G G   +      A +F  Y
Sbjct: 33  PIDVVKTRIQLEPT--VYNKGMVGSFRKIIAEEGAGALLTGFGPTLLGYSIQGAFKFGGY 90

Query: 91  EWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQ 142
           E  KK      G     +  N   + + A    ++ +A  PL+  R RL  Q
Sbjct: 91  EVFKKFFIDTLGYDTAARYKNSVYIGSAAAAEFLADIALCPLEATRIRLVSQ 142

 Score = 37.0 bits (84), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/113 (23%), Positives = 52/113 (46%), Gaps = 7/113 (6%)

Query: 31  PFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVY 90
           P E  +I L  Q +   + +G++    ++ KEEGV   + G      +  PY+  +F+V+
Sbjct: 131 PLEATRIRLVSQPT---FANGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIAKFLVF 187

Query: 91  EWCKKHIFHV---DGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLS 140
           E   +  F +     T+ +  L     LS G   G  + + + P D + ++++
Sbjct: 188 ERASELYFSLAPPKDTLSQTSLTAINLLS-GLTAGLAAAIVSQPADTLLSKVN 239

>YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate
           transporter of the mitochondrial carrier (MCF) family
           [936 bp, 311 aa]
          Length = 311

 Score = 37.4 bits (85), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 48/112 (42%), Gaps = 2/112 (1%)

Query: 31  PFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVY 90
           P + VK  +Q++ +   YN G++ +  Q+   EG   L  G G   +      A +F  Y
Sbjct: 37  PIDVVKTRIQLEPTV--YNKGMVGSFKQIIAGEGAGALLTGFGPTLLGYSIQGAFKFGGY 94

Query: 91  EWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQ 142
           E  KK      G     +  N   + + A+   ++ +A  PL+  R RL  Q
Sbjct: 95  EVFKKFFIDNLGYDTASRYKNSVYMGSAAMAEFLADIALCPLEATRIRLVSQ 146

 Score = 36.2 bits (82), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 25/114 (21%), Positives = 52/114 (45%), Gaps = 9/114 (7%)

Query: 31  PFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVY 90
           P E  +I L  Q     + +G++    ++ KEEG+   + G      +  PY+  +F+V+
Sbjct: 135 PLEATRIRLVSQPQ---FANGLVGGFSRILKEEGIGSFYSGFTPILFKQIPYNIAKFLVF 191

Query: 91  EWCKKHIFHVDGTVGKEQLLNWQ----RLSAGALCGGMSVLATYPLDLVRTRLS 140
           E   +  +   G   KE+L +       L +G   G  + + + P D + ++++
Sbjct: 192 ERASEFYYGFAGP--KEKLSSTSTTLLNLLSGLTAGLAAAIVSQPADTLLSKVN 243

>Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement
          Length = 344

 Score = 37.0 bits (84), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/136 (22%), Positives = 58/136 (42%), Gaps = 13/136 (9%)

Query: 50  HGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKE-Q 108
           +   +A+ ++YK+EG+ GL++G   + +  F  +   F  Y + +K  F V     K  +
Sbjct: 76  NSTFDAIYKIYKQEGIRGLYQGLTTSVMAGFFQTFSYFFWYSFVRKCYFRVKLINRKNTK 135

Query: 109 LLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLV 168
               + L  G +    S + T P+ L+  R   Q              +AK         
Sbjct: 136 FTTIEELLLGIVAAATSQIFTNPISLISAR---QQTRQGIDGDNDFLTVAK--------- 183

Query: 169 KTFKEEGGIRGLYRGI 184
           + +KE+  I+G ++G+
Sbjct: 184 EIYKEQRSIKGFWKGL 199

>YPR128C (ANT1) [5547] chr16 complement(791212..792198)
           Peroxisome-localized protein involved in adenine
           nucleotide transport, medium-chain fatty acid
           metabolism, and peroxisome proliferation, has similarity
           to ADP/ATP carrier proteins [987 bp, 328 aa]
          Length = 328

 Score = 37.0 bits (84), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 58/132 (43%), Gaps = 23/132 (17%)

Query: 29  VSPFERVKILLQVQ---SSTSAYNHG----------IINAVGQVYKEEGVAGLFRGNGLN 75
           V P +  K ++Q Q   SS+   N G          +++ +  ++KE+G+ GL++G  + 
Sbjct: 21  VYPLDLSKTIIQSQVSPSSSEDSNEGKVLPNRRYKNVVDCMINIFKEKGILGLYQGMTVT 80

Query: 76  CVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLN---------WQRLSAGALCGGMSV 126
            V  F  + V F  Y + +K  +     +G + L N          + L  G     +S 
Sbjct: 81  TVATFVQNFVYFFWYTFIRKS-YMKHKLLGLQSLKNRDGPITPSTIEELVLGVAAASISQ 139

Query: 127 LATYPLDLVRTR 138
           L T P+ +V TR
Sbjct: 140 LFTSPMAVVATR 151

 Score = 33.9 bits (76), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 38/78 (48%), Gaps = 3/78 (3%)

Query: 109 LLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIA--KPPGVWEL 166
           +L  +    GA+   M+ +A YPLDL +T +  Q +            +   +   V + 
Sbjct: 1   MLTLESALTGAVASAMANIAVYPLDLSKTIIQSQVSPSSSEDSNEGKVLPNRRYKNVVDC 60

Query: 167 LVKTFKEEGGIRGLYRGI 184
           ++  FKE+ GI GLY+G+
Sbjct: 61  MINIFKEK-GILGLYQGM 77

>KLLA0B14454g complement(1268709..1269626) highly similar to
           sp|P23641 Saccharomyces cerevisiae YJR077c MIR1
           phosphate transport protein, mitochondrial (MCF), start
           by similarity
          Length = 305

 Score = 37.0 bits (84), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 29/121 (23%), Positives = 57/121 (47%), Gaps = 8/121 (6%)

Query: 25  SRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSA 84
           + + + P + VK  +Q++ +   YN G++++  Q+   EG   L  G G   +      +
Sbjct: 27  THSSMVPIDVVKTRIQLEPTV--YNKGMVSSFKQIISSEGAGALLTGFGPTLLGYSLQGS 84

Query: 85  VQFVVYEWCKKHIFHVDGTVGKEQLLNWQR---LSAGALCGGMSVLATYPLDLVRTRLSI 141
            +F  YE  KK    +D  +G +  +N++    + + A+    + +A  PL+  R RL  
Sbjct: 85  FKFGGYELFKK--LAID-NMGYDNAVNYKNTIYIGSAAIAEFFADIALCPLEATRIRLVS 141

Query: 142 Q 142
           Q
Sbjct: 142 Q 142

 Score = 34.7 bits (78), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 32/72 (44%), Gaps = 3/72 (4%)

Query: 31  PFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVY 90
           P E  +I L  Q +   + +G+     ++ KEEGV   + G      +  PY+  +F V+
Sbjct: 131 PLEATRIRLVSQPT---FANGLFGGFSRILKEEGVGSFYNGFTPILFKQIPYNIAKFFVF 187

Query: 91  EWCKKHIFHVDG 102
           E      F + G
Sbjct: 188 EHAANAYFGLAG 199

>KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces
           cerevisiae YPL134c ODC1, start by similarity
          Length = 297

 Score = 36.6 bits (83), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 38/162 (23%), Positives = 67/162 (41%), Gaps = 26/162 (16%)

Query: 28  VVSPFERVKILLQVQSS--TSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAV 85
           V+ P + VK ++Q+Q S  +     G+ + + Q+  +EG + L++G     +   P  A 
Sbjct: 26  VMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGISSPILMEAPKRAT 85

Query: 86  QFVV---YEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQ 142
           +F     ++   K +F      G E+L     + +GA  G        P +LV+ RL   
Sbjct: 86  KFACNDEFQKIYKDLF------GAEKLTQPLSILSGASAGICESFVVVPFELVKIRLQDV 139

Query: 143 TANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
           ++               P  V    VK   E+ GI  +Y G+
Sbjct: 140 SSK-----------FTSPIAV----VKNIVEKEGILAMYNGL 166

 Score = 33.1 bits (74), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 35/71 (49%), Gaps = 10/71 (14%)

Query: 114 RLSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKE 173
           +  AGA+ G   +L  YPLD+V+T + +Q +                 GV++ L +   +
Sbjct: 12  QFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYK---------GVFDCLKQIAAK 62

Query: 174 EGGIRGLYRGI 184
           EG  R LY+GI
Sbjct: 63  EGPSR-LYKGI 72

 Score = 28.1 bits (61), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 33/70 (47%), Gaps = 5/70 (7%)

Query: 25  SRTVVSPFERVKILLQ----VQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIF 80
           S  + +PF+ VK  +Q    +      YN     A+  +YKEEG   L++G     +R+ 
Sbjct: 215 SSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSW-PALATIYKEEGFKALYKGFVPKVLRLG 273

Query: 81  PYSAVQFVVY 90
           P   +  VV+
Sbjct: 274 PGGGILLVVF 283

>Sklu_2115.4 YDL119C, Contig c2115 2906-3805
          Length = 299

 Score = 36.6 bits (83), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/115 (19%), Positives = 53/115 (46%), Gaps = 10/115 (8%)

Query: 38  LLQVQSSTSAYNHGII-NAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKH 96
           +++V+  ++ Y++  +  A   +Y  EG+ G F G G   +R  PY+ +  ++YE  K  
Sbjct: 128 IIKVRYESTMYSYKSLGEATRHIYSTEGIRGFFNGCGATVMRDAPYAGLYVLLYEKAKLL 187

Query: 97  IFHV--DGTVGKEQLLNWQRLSAGA-------LCGGMSVLATYPLDLVRTRLSIQ 142
           +  +    T+  ++   +   ++         +   ++   T P D ++TR+ + 
Sbjct: 188 VPMMLPSSTISYDEAGMFTTYTSTVVNSISAFMSASLATTITSPFDTIKTRMQLD 242

>Kwal_47.19228
          Length = 281

 Score = 36.2 bits (82), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 39/88 (44%), Gaps = 6/88 (6%)

Query: 52  IINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLN 111
            +  V ++Y+  G+ G  +G     +R    SAV+F  Y   K+ I         + L  
Sbjct: 131 FLTTVQEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSLKQMI------SPNKPLNE 184

Query: 112 WQRLSAGALCGGMSVLATYPLDLVRTRL 139
           +   + G +     V  T P+D+++TR+
Sbjct: 185 YYAFALGFISSCAVVAVTQPIDVIKTRM 212

 Score = 28.1 bits (61), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 17/75 (22%), Positives = 36/75 (48%), Gaps = 1/75 (1%)

Query: 28  VVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQF 87
           V  P + +K  +Q + + S Y + + N   +++ EEG    ++G     +++     V F
Sbjct: 201 VTQPIDVIKTRMQSKYTWSNYKNSL-NCAYRIFVEEGFTKFWKGWAPRLMKVGLSGGVSF 259

Query: 88  VVYEWCKKHIFHVDG 102
            VY++    +  V+G
Sbjct: 260 GVYQYVDNLMKAVNG 274

>Sklu_2194.3 YMR241W, Contig c2194 5245-6183
          Length = 312

 Score = 35.8 bits (81), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 33/157 (21%), Positives = 69/157 (43%), Gaps = 18/157 (11%)

Query: 32  FERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYE 91
            + V+I  +  +   A       A  ++YK++G+ G+ +G     +R       +F    
Sbjct: 133 MKTVEITKKKSAGAGAIPQSSWGAFKEIYKKDGIKGINKGVNAVAIRQMTNWGSRFGFSR 192

Query: 92  WCKKHIFHVDG-TVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXX 150
             ++ I +  G T   ++L   ++++A A+ GG+S     P++++R  +  +        
Sbjct: 193 LVEEGIRNATGKTNPDDKLTALEKIAASAIGGGLSAW-NQPIEVIRVEMQSK-------- 243

Query: 151 XXXXXDIAKPPGVWELLVKTFK---EEGGIRGLYRGI 184
                D  +P  +   +   FK   +  GI+GLYRG+
Sbjct: 244 ---KEDPNRPKNL--TVSSAFKYIYQSSGIKGLYRGV 275

>CAGL0J09790g complement(957759..958661) highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1, start by
           similarity
          Length = 300

 Score = 35.8 bits (81), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 54/127 (42%), Gaps = 17/127 (13%)

Query: 58  QVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSA 117
           ++ K+EG+  L+RG G    R  P S   F    + K++I    G     Q    Q   +
Sbjct: 160 KILKDEGIFNLYRGWGWTAARNAPGSFALFGGNAFAKEYIL---GLQDYSQATWSQNFIS 216

Query: 118 GALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGI 177
             +    S++ + PLD+++TR  IQ  N              P   ++++  T K E G 
Sbjct: 217 SIVGASASLIVSAPLDVIKTR--IQNRN-----------FDNPESGFKIVKNTLKNE-GF 262

Query: 178 RGLYRGI 184
              ++G+
Sbjct: 263 TAFFKGL 269

>CAGL0L05742g complement(630844..631761) similar to sp|P10566
           Saccharomyces cerevisiae YJL133w MRS3 or sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4, start by
           similarity
          Length = 305

 Score = 35.4 bits (80), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 31/161 (19%), Positives = 67/161 (41%), Gaps = 25/161 (15%)

Query: 28  VVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQF 87
           +++PF+ +K  +Q+ ++ S ++        ++Y +EG    +           P++A  F
Sbjct: 138 LMNPFDVIKQRIQLNTNISVWD-----TAKRIYSKEGFQAFYSSYPTTLAINIPFAAFNF 192

Query: 88  VVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLA----TYPLDLVRTRLSIQT 143
            +Y+   ++ F+  G                 LCGG+S  A    T PLD ++T L ++ 
Sbjct: 193 GIYDTATRY-FNPSGVYNP---------FIHCLCGGISGAACAGLTTPLDCIKTALQVRG 242

Query: 144 ANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
           +           ++ K    ++   +   +  G RG + G+
Sbjct: 243 SE------KVSMEVFKQADTFKKATRAIYQVYGWRGFWSGV 277

 Score = 27.3 bits (59), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 18/78 (23%), Positives = 32/78 (41%), Gaps = 6/78 (7%)

Query: 28  VVSPFERVKILLQVQSSTSAY------NHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFP 81
           + +P + +K  LQV+ S                A   +Y+  G  G + G     +   P
Sbjct: 227 LTTPLDCIKTALQVRGSEKVSMEVFKQADTFKKATRAIYQVYGWRGFWSGVKPRILANMP 286

Query: 82  YSAVQFVVYEWCKKHIFH 99
            +A+ +  YE+ K  +FH
Sbjct: 287 ATAISWTAYEFAKHFLFH 304

>Scas_705.9
          Length = 323

 Score = 35.4 bits (80), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 37/75 (49%), Gaps = 2/75 (2%)

Query: 111 NWQRLSAGALCGGMSVLATYPLDLVRTRLSIQT-ANXXXXXXXXXXDIAKPPGVWELLVK 169
           N +    GA+   M+ +  YPLD+ +T +  +T A            I +   V   L++
Sbjct: 3   NLESAITGAIASTMANVIVYPLDVAKTVIQSETKAKETDELSEKDKRILRQENVIRCLIR 62

Query: 170 TFKEEGGIRGLYRGI 184
            F++  G+RGLY+G+
Sbjct: 63  IFRKR-GLRGLYQGM 76

 Score = 27.3 bits (59), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 34/79 (43%), Gaps = 11/79 (13%)

Query: 3   LKQLAKQESSIA--------FIXXXXXXXXSRTVVSPFERVKILLQVQSSTSAYNHGIIN 54
           LKQ++  E S +        FI        S  +  P    K+ LQ   S S + H    
Sbjct: 206 LKQVSNSEKSYSGQLTVNQNFILGALAKIISTIITQPLIVAKVSLQ--RSNSKFKH-FEE 262

Query: 55  AVGQVYKEEGVAGLFRGNG 73
            +  +YKEEGV  L++G G
Sbjct: 263 VLRYLYKEEGVLALWKGVG 281

>YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in
           transport of FAD from cytosol into the mitochondrial
           matrix, member of mitochondrial carrier (MCF) family of
           membrane transporters [936 bp, 311 aa]
          Length = 311

 Score = 34.3 bits (77), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 34/73 (46%), Gaps = 1/73 (1%)

Query: 25  SRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSA 84
           S T+V PF+ +K  LQ     +     +   +  +   +G  GL++G   N VR  P + 
Sbjct: 240 SVTLVYPFQLLKSNLQ-SFRANEQKFRLFPLIKLIIANDGFVGLYKGLSANLVRAIPSTC 298

Query: 85  VQFVVYEWCKKHI 97
           + F VYE  K  +
Sbjct: 299 ITFCVYENLKHRL 311

 Score = 33.9 bits (76), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 60/128 (46%), Gaps = 16/128 (12%)

Query: 28  VVSPFERVKILLQVQSSTSAYNH-GIINAVGQVYKEEGVAG------LFRGNGLNCVRIF 80
           VV P + +K+ LQ+ ++++   H G    + ++ +    +G      L+RG  +N     
Sbjct: 26  VVHPLDLLKVRLQLSATSAQKAHYGPFMVIKEIIRSSANSGRSVTNELYRGLSINLFGNA 85

Query: 81  PYSAVQFVVYEWCKKHIFHVDGTVGKEQLL---NWQR------LSAGALCGGMSVLATYP 131
               V F +Y   K+ I+      G+ QL    N  +      LSAGA  G M+ + T P
Sbjct: 86  IAWGVYFGLYGVTKELIYKSVAKPGETQLKGVGNDHKMNSLIYLSAGASSGLMTAILTNP 145

Query: 132 LDLVRTRL 139
           + +++TR+
Sbjct: 146 IWVIKTRI 153

>KLLA0D04312g 367160..367471 highly similar to sgd|S0006215
           Saccharomyces cerevisiae YPR011c, hypothetical start
          Length = 103

 Score = 32.7 bits (73), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 40/77 (51%), Gaps = 4/77 (5%)

Query: 25  SRTVVSPFE----RVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIF 80
           ++T+V PF+    R ++L    +        + +A+  + K EG  G ++G   N  ++ 
Sbjct: 24  AQTLVYPFDLLRRRFQVLAMGGNELGFRYKSVSDALITIGKTEGPKGYYKGLTANLFKVI 83

Query: 81  PYSAVQFVVYEWCKKHI 97
           P +AV ++VYE  ++ +
Sbjct: 84  PSTAVSWLVYEVIREAM 100

 Score = 32.3 bits (72), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 21/38 (55%)

Query: 104 VGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSI 141
           V    L N  +L+ GA+ GG++    YP DL+R R  +
Sbjct: 3   VTDPNLANLYKLAMGAISGGVAQTLVYPFDLLRRRFQV 40

>ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH]
           complement(355977..356906) [930 bp, 309 aa]
          Length = 309

 Score = 34.3 bits (77), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 54/126 (42%), Gaps = 22/126 (17%)

Query: 59  VYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIF-HVDGTVGKEQLLNWQRLSA 117
           ++K+ GV GL++G     +R    SAVQ  VY   K+ +  HV   +    L +   LS+
Sbjct: 167 LFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALSRHVPDGMALYTLASA--LSS 224

Query: 118 GALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGI 177
            A+C     +A  P D+  TR+                      G  + L KT ++E G 
Sbjct: 225 VAVC-----IAMNPFDVAMTRMYHHRGGLYR-------------GPLDCLCKTVRQE-GF 265

Query: 178 RGLYRG 183
             LY+G
Sbjct: 266 SALYKG 271

 Score = 29.6 bits (65), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 6/54 (11%)

Query: 27 TVVSPFERVKILLQVQ----SSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNC 76
          T  +P E VK  LQ+Q    +  S    G   AV  +Y+ EG+ GL    GL C
Sbjct: 27 TFTNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGL--QQGLAC 78

>YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the
           mitochondrial carrier family (MCF) family of membrane
           transporters [858 bp, 285 aa]
          Length = 285

 Score = 33.9 bits (76), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 46/108 (42%), Gaps = 18/108 (16%)

Query: 42  QSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVD 101
           +S+  A    ++ AV  +Y+  G A   +G      R    +++QF  Y   K+      
Sbjct: 133 KSTPVARIEKLLPAVKHMYQTRGPAAFVQGTTATIFRQIANTSIQFTAYTAFKR------ 186

Query: 102 GTVGKEQLLNWQRLSAGALCGGMS-----VLATYPLDLVRTRLSIQTA 144
                  LL  +   A ++  G++     V  T P+D+V+TR+  Q A
Sbjct: 187 -------LLQARNDKASSVITGLATSFTLVAMTQPIDVVKTRMMSQNA 227

 Score = 28.5 bits (62), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 14/64 (21%), Positives = 35/64 (54%), Gaps = 1/64 (1%)

Query: 28  VVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQF 87
           +  P + VK  +  Q++ + Y +  +N + +++ +EG+A  ++G+    +++     + F
Sbjct: 211 MTQPIDVVKTRMMSQNAKTEYKN-TLNCMYRIFVQEGMATFWKGSIFRFMKVGISGGLTF 269

Query: 88  VVYE 91
            VYE
Sbjct: 270 TVYE 273

>Scas_702.10
          Length = 302

 Score = 33.1 bits (74), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 41/90 (45%), Gaps = 7/90 (7%)

Query: 54  NAVGQVYK----EEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQL 109
           NA+  VYK    E G+  L  G   N VR    +A Q V Y+  K ++        K+  
Sbjct: 145 NAIDGVYKIYMHEGGIKTLLTGWKPNMVRGVLMTASQVVTYDVFKNYLVTKLSFDPKK-- 202

Query: 110 LNWQRLSAGALCGGMSVLATYPLDLVRTRL 139
            N   LSA  L G ++     P D+++TR+
Sbjct: 203 -NSTHLSASLLAGLVATTICSPADVIKTRI 231

>KLLA0F17864g complement(1634241..1635164) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 307

 Score = 33.1 bits (74), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 48/113 (42%), Gaps = 9/113 (7%)

Query: 28  VVSPFERVKILLQVQSST--SAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAV 85
           + +P E V+I LQ+Q     +A     ++   ++ K+     L RG     +R      +
Sbjct: 139 LATPIEHVRIRLQLQKEALANAEYKSTLDCTEKLLKQ---GSLMRGFTATLMRTSHGFGI 195

Query: 86  QFVVYE-WCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRT 137
            F+ YE      + H      +E +  W+    GAL G      TYP D+V++
Sbjct: 196 YFLTYETLIASQLAH---GFRREDISAWKACMFGALSGAFFWAMTYPFDVVKS 245

 Score = 32.0 bits (71), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 15/62 (24%), Positives = 28/62 (45%), Gaps = 1/62 (1%)

Query: 31  PFERVKILLQVQSSTS-AYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVV 89
           PF+ VK ++Q     + AY   ++     +Y+E G+    +G     +R  P +   F  
Sbjct: 239 PFDVVKSVMQADKLVNPAYGTNVVQVAKNIYRERGLRAFTKGFMPTMLRSLPVNGATFAA 298

Query: 90  YE 91
           +E
Sbjct: 299 FE 300

>Sklu_2075.3 , Contig c2075 6414-7451 reverse complement
          Length = 345

 Score = 33.1 bits (74), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 62/165 (37%), Gaps = 32/165 (19%)

Query: 28  VVSPFERVKILLQVQ--SSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAV 85
           + +P E  K  LQVQ  + T+ Y  G ++ + +VY   GV GL++  GL    IF  + V
Sbjct: 175 IAAPVELAKAKLQVQYDAKTTKYT-GPVDVIKKVYSSNGVRGLYK--GLTSTLIFRTNFV 231

Query: 86  QF-----VVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLAT-YPLDLVRTRL 139
            +     ++  W K+H    D  +            +G          T YP D+++   
Sbjct: 232 FWWGSYELLTRWFKEHTNMSDTAIN---------FWSGGFSASFGFWTTAYPSDVIK--- 279

Query: 140 SIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
            +   N                  W+L  K      G RG ++G 
Sbjct: 280 QVVLCNDKYDGTFRS---------WKLAAKDIWRTRGYRGFFKGF 315

 Score = 32.3 bits (72), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 36/190 (18%), Positives = 80/190 (42%), Gaps = 24/190 (12%)

Query: 2   DLKQLAKQESS---IAFIXXXXXXXXSRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQ 58
           D++Q    E+    + F+           V  PF+ +K+ LQ    ++ +  G ++ V +
Sbjct: 48  DIQQPPPSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFK-GPLDCVYK 106

Query: 59  VYKEEGVAGLFRGNGLNCVRIFPYSAVQF-VVYEW---CKKHIFHVDGTVGKEQLLNWQR 114
            + ++G+ G + G     V      +V    ++ +    KK++++      +E+L     
Sbjct: 107 TFTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYY-----NEEKLPLSGC 161

Query: 115 LSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEE 174
           + +G + G        P++L + +L +Q                K  G  +++ K +   
Sbjct: 162 IISGVMAGWSVSFIAAPVELAKAKLQVQ----------YDAKTTKYTGPVDVIKKVY-SS 210

Query: 175 GGIRGLYRGI 184
            G+RGLY+G+
Sbjct: 211 NGVRGLYKGL 220

>Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement
          Length = 302

 Score = 33.1 bits (74), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 22/117 (18%), Positives = 58/117 (49%), Gaps = 7/117 (5%)

Query: 28  VVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQF 87
           ++ P+E +K+  + Q++   +    +    ++   EG++GL++G      R  PY+  +F
Sbjct: 129 LLCPWEAIKV--KQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKF 186

Query: 88  VVYEWCKKHIFHVDGTVGKEQLLNWQRLS----AGALCGGMSVLATYPLDLVRTRLS 140
             +E   + I+       K+++   Q++      G L G +  + ++P D++ ++++
Sbjct: 187 TSFERIVEMIY-AKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVN 242

>Kwal_34.15907
          Length = 312

 Score = 33.1 bits (74), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 67/148 (45%), Gaps = 28/148 (18%)

Query: 42  QSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVD 101
           QSS SA+         ++Y +EG+ G+ +G     +R       +F +    ++ I    
Sbjct: 151 QSSWSAFK--------EIYSKEGIKGINKGVNAVAIRQMTNWGSRFGLSRLVEQGIRDFT 202

Query: 102 G-TVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKP 160
           G T   ++L   +++ A AL GG+S     P++++R  +  +             D  +P
Sbjct: 203 GKTNPDDKLTALEKIFASALGGGLSAW-NQPIEVIRVEMQSKK-----------EDPNRP 250

Query: 161 PGVWELLVKT-FK---EEGGIRGLYRGI 184
               +L V + FK   +  GI+GLYRG+
Sbjct: 251 K---KLTVGSAFKYIYQSSGIKGLYRGV 275

>Kwal_23.5757
          Length = 307

 Score = 33.1 bits (74), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 24/113 (21%), Positives = 52/113 (46%), Gaps = 4/113 (3%)

Query: 31  PFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVY 90
           P+E +K+  Q  +    +   + +A  ++   EG A L++G      R  PY+  +F  +
Sbjct: 136 PWEAIKVRQQT-AVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSF 194

Query: 91  EWCKKHIFHVDGTVGKEQLLNWQ---RLSAGALCGGMSVLATYPLDLVRTRLS 140
           E   + I+    T  +E     Q     + G L G +  + ++P D++ ++++
Sbjct: 195 ERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVN 247

>Scas_687.15*
          Length = 328

 Score = 32.7 bits (73), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 47/107 (43%), Gaps = 10/107 (9%)

Query: 40  QVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFH 99
           QV S   + N  I + V ++Y   G+ G  +G      R    S V+F  Y   K+ I  
Sbjct: 170 QVYSKYPSSN--IFSVVKEIYLTRGLRGFAQGAMPTVFRQVSNSTVRFTAYTTLKQLI-- 225

Query: 100 VDGTVGKEQLLNWQRLSAGALCGGMSVLA-TYPLDLVRTRLSIQTAN 145
                   Q LN        L    +V+A T P+D+V+TR+  +TA+
Sbjct: 226 -----SPTQPLNEVYAFGIGLFSSCAVVALTQPIDVVKTRMQSKTAH 267

>YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses loss of Abf2p
           [903 bp, 300 aa]
          Length = 300

 Score = 32.7 bits (73), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 64/157 (40%), Gaps = 22/157 (14%)

Query: 28  VVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQF 87
           V+ P + +KI  Q     S    G I    ++ ++EG+  L+RG G    R  P S   F
Sbjct: 135 VLLPLDVLKIKRQTNPE-SFKGRGFI----KILRDEGLFNLYRGWGWTAARNAPGSFALF 189

Query: 88  VVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTANXX 147
               + K++I    G     Q    Q   +  +    S++ + PLD+++TR  IQ  N  
Sbjct: 190 GGNAFAKEYIL---GLKDYSQATWSQNFISSIVGACSSLIVSAPLDVIKTR--IQNRN-- 242

Query: 148 XXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
                       P     ++  T K E G+   ++G+
Sbjct: 243 ---------FDNPESGLRIVKNTLKNE-GVTAFFKGL 269

>YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 32.7 bits (73), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 57/116 (49%), Gaps = 12/116 (10%)

Query: 38  LLQVQSSTSAYNHGIIN-AVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKH 96
           +++V+  ++ YN+  +  A+  +Y +EG+ G FRG G  C+R  PY+ +  ++YE  K+ 
Sbjct: 140 VIKVRYESTLYNYSSLKEAITHIYTKEGLFGFFRGFGATCLRDAPYAGLYVLLYEKSKQL 199

Query: 97  I----------FHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQ 142
           +          ++ +G             SA  L   ++   T P D ++TR+ ++
Sbjct: 200 LPMVLPSRFIHYNPEGGFTTYTSTTVNTTSA-VLSASLATTVTAPFDTIKTRMQLE 254

>KLLA0F13464g 1246646..1247548 highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1 member of the
           mitochondrial carrier family (MCF), start by similarity
          Length = 300

 Score = 32.3 bits (72), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 54/127 (42%), Gaps = 18/127 (14%)

Query: 58  QVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSA 117
           ++ K+EG  GL+RG G    R  P S   F    + K++I    G     Q    Q   +
Sbjct: 160 KIIKDEGF-GLYRGWGWTAARNAPGSFALFGGNAFAKEYIL---GLKDYGQATWSQNFVS 215

Query: 118 GALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGI 177
             +    S++ + PLD+++TR  IQ  N              P   ++++  T K E G 
Sbjct: 216 SIVGASASLIVSAPLDVIKTR--IQNRN-----------FDNPESGFKIIKNTLKNE-GF 261

Query: 178 RGLYRGI 184
              ++G+
Sbjct: 262 TAFFKGL 268

>Scas_328.1
          Length = 227

 Score = 32.3 bits (72), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 26/54 (48%)

Query: 25  SRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVR 78
           + T   P + V+  + + S  +    G I+   Q+  +EGV  LF+G G N  R
Sbjct: 150 ASTTSYPLDTVRRRMMMTSGQAVKYKGAIDCFQQIVSQEGVYSLFKGCGANIFR 203

 Score = 32.0 bits (71), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 46/108 (42%), Gaps = 11/108 (10%)

Query: 41  VQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIF-- 98
           ++S      +GI++   +    +GV GL+RG   + V I  Y  + F +Y+  K  +   
Sbjct: 71  IKSGAPRKFNGILDVYKKTLFTDGVLGLYRGFLPSVVGIMVYRGLYFGLYDSLKPVLLTG 130

Query: 99  HVDGTVGKEQLLNWQ-RLSAGALCGGMSVLATYPLDLVRTRLSIQTAN 145
             +       LL W   +SA           +YPLD VR R+ + +  
Sbjct: 131 SFENAFLPSFLLGWAVTISAST--------TSYPLDTVRRRMMMTSGQ 170

>Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement
          Length = 420

 Score = 32.3 bits (72), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 49/116 (42%), Gaps = 11/116 (9%)

Query: 29  VSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFV 88
           +SP ER+  L   +  TS +     + V ++Y   G+ G  +G      R    SAV+F 
Sbjct: 252 ISPRERL-FLHYEEHPTSRF----FSTVKEIYLTRGLRGFVQGTAPTIFRQMGNSAVRFT 306

Query: 89  VYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTA 144
            Y   K+ I         + L  +     G +     V  T P+D+++TR+  + A
Sbjct: 307 TYTSLKQLI------SPNKPLNEYYAFVLGFISSCAVVAVTQPIDVIKTRMQSKYA 356

>Kwal_33.15446
          Length = 305

 Score = 32.3 bits (72), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 35/176 (19%), Positives = 73/176 (41%), Gaps = 21/176 (11%)

Query: 13  IAFIXXXXXXXXSRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGN 72
           + F+           V  PF+ +K+ LQ    T  +  G ++ V Q  +++G+ G + G 
Sbjct: 20  MGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFK-GPLDCVYQTMRQQGIRGFYLGF 78

Query: 73  GLNCVRIFPYSAVQF-VVYEW---CKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLA 128
               V      +V    ++ +    KK+++  +     E+L     + +G L G      
Sbjct: 79  TPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHE-----EKLPLSGCILSGVLAGWSVSFI 133

Query: 129 TYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
             P++L + +L +Q                +  G  +++ K +  +G IRG+Y+G+
Sbjct: 134 AAPVELAKAKLQVQ----------YDAQTTRYRGPLDVIKKVYAADG-IRGMYKGL 178

 Score = 28.5 bits (62), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 11/38 (28%), Positives = 20/38 (52%)

Query: 54  NAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYE 91
           NA   +++  G+ G F+G   + +R FP +A     +E
Sbjct: 255 NAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFE 292

>KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces
           cerevisiae YMR241w YHM2 yeast suppressor gene of HM
           (mitochondrial histone) mutant (ABF2) singleton, start
           by similarity
          Length = 308

 Score = 32.3 bits (72), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 31/135 (22%), Positives = 62/135 (45%), Gaps = 20/135 (14%)

Query: 55  AVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDG-TVGKEQLLNWQ 113
           A  ++Y +EG+ G+ +G     +R       +F      ++ +    G T   ++L   +
Sbjct: 152 AFKEIYNKEGIRGINKGVNAVAIRQMTNWGSRFGFSRLVEEGLRKFTGKTNPDDKLTALE 211

Query: 114 RLSAGALCGGMSVLATYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLV-KTFK 172
           ++ A A+ GG+S     P++++R  +  +T            D  +P    +L V K F+
Sbjct: 212 KIFASAIGGGLSAW-NQPIEVIRVEMQSKT-----------NDPNRPK---DLTVGKAFR 256

Query: 173 ---EEGGIRGLYRGI 184
              +  G++GLYRG+
Sbjct: 257 YIYQSNGVKGLYRGV 271

>Kwal_27.11626
          Length = 299

 Score = 32.0 bits (71), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 37/158 (23%), Positives = 65/158 (41%), Gaps = 25/158 (15%)

Query: 28  VVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQF 87
           V+ P + +KI  Q     S    G I    ++ K+EG  GL+RG G    R  P S   F
Sbjct: 134 VLLPLDVLKIKRQTNPE-SFKGRGFI----KILKDEGF-GLYRGWGWTAARNAPGSFALF 187

Query: 88  VVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGG-MSVLATYPLDLVRTRLSIQTANX 146
               + K++I  +           W +    ++ G   S++ + PLD+++TR+  +    
Sbjct: 188 GGNAFAKEYILGLK----DYSSATWSQNFVSSIVGASASLIVSAPLDVIKTRIQNR---- 239

Query: 147 XXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
                        P   + ++  T K E GI   ++G+
Sbjct: 240 ---------HFDNPESGFRIVQNTLKNE-GITAFFKGL 267

>AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH]
           complement(1114974..1115870) [897 bp, 298 aa]
          Length = 298

 Score = 31.6 bits (70), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 42/88 (47%), Gaps = 6/88 (6%)

Query: 58  QVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSA 117
           ++ ++EG+ GL+RG G    R  P S   F    + K++I    G     Q    Q   +
Sbjct: 159 RILRDEGM-GLYRGWGWTAARNAPGSFALFGGNAFAKEYIL---GLKDYSQATWGQNFVS 214

Query: 118 GALCGGMSVLATYPLDLVRTRLSIQTAN 145
                  S++ + PLD+++TR  IQ+ N
Sbjct: 215 SIFGASASLIVSAPLDVIKTR--IQSRN 240

>Scas_613.24
          Length = 177

 Score = 30.8 bits (68), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 26/37 (70%), Gaps = 1/37 (2%)

Query: 38  LLQVQSSTSAYNHGIIN-AVGQVYKEEGVAGLFRGNG 73
           +L+V+  ++ Y++  +N A+  +YK EG++G F+G G
Sbjct: 129 ILKVRYESTYYSYKSMNEAIKDIYKMEGISGFFKGFG 165

>KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaYMC2
           Candida albicans Carnitine/acylcarnitine translocase (by
           homology), start by similarity
          Length = 307

 Score = 31.2 bits (69), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 38/162 (23%), Positives = 60/162 (37%), Gaps = 26/162 (16%)

Query: 28  VVSPFERVKILLQVQ-SSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQ 86
           +  P E  K  LQVQ   T+    G ++ + ++Y  +G+ GL++  GL    IF      
Sbjct: 138 IAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYK--GLISTLIF----RT 191

Query: 87  FVVYEWCKKHI---FHVDGTVGKEQLLNWQRLSAGALCGGMSVLAT-YPLDLVRTRLSIQ 142
             VY W    +   +  + T   E  +N+    AG          T YP D+V+    + 
Sbjct: 192 HFVYWWGSYELLTRWFRENTKMSEAAINFW---AGGFSASFGFWTTAYPSDVVK---QVV 245

Query: 143 TANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
             N                  W   VK   +  GI G ++G 
Sbjct: 246 LCNDKYDGSFKS---------WRTAVKDIYQSKGINGFFKGF 278

 Score = 31.2 bits (69), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 33/172 (19%), Positives = 68/172 (39%), Gaps = 13/172 (7%)

Query: 13  IAFIXXXXXXXXSRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGN 72
           + F+           V  PF+ +K+ LQ   + + +  G ++ V + ++ +G+ G + G 
Sbjct: 25  MGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFK-GPLDCVYKTFRNQGIRGFYLGF 83

Query: 73  GLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPL 132
               V      +V         + + H       E+L     + +G L G        P+
Sbjct: 84  TPPLVGWILMDSVMLGCLH-NYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPI 142

Query: 133 DLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184
           +L + +L +Q                +  G  +++ K +  +G IRGLY+G+
Sbjct: 143 ELAKAKLQVQYDKTT----------TRYKGPLDVIKKIYSAQG-IRGLYKGL 183

>KLLA0A00979g complement(92561..93592) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), start by similarity
          Length = 343

 Score = 30.8 bits (68), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 35/89 (39%), Gaps = 6/89 (6%)

Query: 51  GIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLL 110
            I   V ++ +  G    F+G+     R    SAV+F  Y   K+ I         + L 
Sbjct: 192 NIFTTVREMVQTRGFTTFFQGSMPTIFRQVGNSAVRFTTYTTLKQMI------SPNKPLS 245

Query: 111 NWQRLSAGALCGGMSVLATYPLDLVRTRL 139
            +     G       V  T P+D+V+TR+
Sbjct: 246 EYYAFGIGVFSSCAVVALTQPIDVVKTRM 274

>CAGL0C02013g complement(209930..210919) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1, hypothetical
           start
          Length = 329

 Score = 30.0 bits (66), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 21/90 (23%), Positives = 40/90 (44%), Gaps = 8/90 (8%)

Query: 51  GIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLL 110
            ++    ++Y++ G+   F+G     +R    S V+F  +   K+          KE   
Sbjct: 180 NVLTTAAELYRQHGLRAYFKGTMPTLMRQVGNSVVRFTTFTMLKQF-------APKEYQN 232

Query: 111 NWQRLSAGALCGGMSVL-ATYPLDLVRTRL 139
           N    +   L    +V+ AT PLD+++TR+
Sbjct: 233 NEYFATLLGLISSCAVVGATQPLDVIKTRM 262

 Score = 29.6 bits (65), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 35/67 (52%), Gaps = 1/67 (1%)

Query: 31  PFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVY 90
           P + +K  +Q + S   Y + I N   +++ EEG A L++G     +++    +V F +Y
Sbjct: 254 PLDVIKTRMQAKDSVLLYRNSI-NCAYRIFVEEGFAMLWKGWLPRLMKVGLSGSVSFGIY 312

Query: 91  EWCKKHI 97
           ++ +  I
Sbjct: 313 QYTENMI 319

>CAGL0K06545g complement(641129..642667) similar to tr|Q03327
           Saccharomyces cerevisiae YDR470c, hypothetical start
          Length = 512

 Score = 30.0 bits (66), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/108 (21%), Positives = 46/108 (42%), Gaps = 12/108 (11%)

Query: 39  LQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCK---K 95
           L  + S +  +   ++ +  +  EEG+ GL++ N  N    F Y  +   +  W      
Sbjct: 223 LTPERSINPESKHTLDIMNSILDEEGIKGLWKANNTN----FIYQILSSTLEAWYTGLIS 278

Query: 96  HIFHVDGTVGKEQLLNWQRLSAGAL----CGGMSVLATYPLDLVRTRL 139
            + H+      + L+++    +  L     G ++ L   P+DL+RTR 
Sbjct: 279 PLLHIPDPYFID-LIHFPDTQSAVLLTLSVGVLTALTLIPIDLIRTRF 325

>CAGL0B03883g 383602..384522 weakly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, hypothetical
           start
          Length = 306

 Score = 28.5 bits (62), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 40/183 (21%), Positives = 73/183 (39%), Gaps = 23/183 (12%)

Query: 13  IAFIXXXXXXXXSRTVVSPFERVKILLQ---VQSSTSAYNHGIINAVGQVYKEEGVAGLF 69
           + F+          TV  PF+ VK+ LQ   V S       G ++ V +  K +G+ GL+
Sbjct: 11  MGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLY 70

Query: 70  RGNGLNCV-RIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLA 128
            G        I   SA+   ++ +  + + H       ++L     + +G + G      
Sbjct: 71  LGFTPPLFGWIMMDSALLGSLHNY--RMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFI 128

Query: 129 TYPLDLVRTRLSIQTANXXXXXXXXXXDIAKPPGVWELLVKTFKEE-------GGIRGLY 181
             P++L + +L +Q                K  G  +++ K FK+        GG+R LY
Sbjct: 129 AAPVELAKAKLQVQ----------YDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLY 178

Query: 182 RGI 184
           +G+
Sbjct: 179 KGL 181

 Score = 26.9 bits (58), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 21/38 (55%)

Query: 54  NAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYE 91
            AV  +Y++ G+ G F+G   + +R FP +A     +E
Sbjct: 258 TAVSDIYRQRGIHGFFKGFLPSFLRSFPANAAALAAFE 295

>YKR051W (YKR051W) [3302] chr11 (530588..531844) Member of the
           domain of unknown function (DUF300) containing family,
           has moderate similarity to uncharacterized S. pombe
           Spac30d11.06cp [1257 bp, 418 aa]
          Length = 418

 Score = 28.5 bits (62), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 38/93 (40%), Gaps = 16/93 (17%)

Query: 61  KEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCK------------KHIFHVDGTVGKEQ 108
            ++  +G    NGL C+ + P++ +  V + W K            K I+ +   +G   
Sbjct: 236 NQDRTSGYVYKNGLLCIEMVPFAILHAVAFPWNKYTAFSIPYGARMKFIYALKDFLGCGD 295

Query: 109 LLNW---QRLSAGALCGGMSVLATYPLDLVRTR 138
           L+ W   Q L AG L           +DL+ TR
Sbjct: 296 LI-WDFKQTLFAGPLYYNYRNFDPEAMDLLSTR 327

>Sklu_2127.4 , Contig c2127 6322-7293
          Length = 323

 Score = 28.1 bits (61), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 12/45 (26%), Positives = 26/45 (57%)

Query: 47  AYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYE 91
           A +  +++ + ++ K++GV+GL+RG G+   +    +A  F   E
Sbjct: 253 ASSKSMLSLITEIVKKDGVSGLYRGVGIKLAQSILTAAFLFFFKE 297

>Scas_379.3
          Length = 432

 Score = 27.7 bits (60), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 34/63 (53%), Gaps = 2/63 (3%)

Query: 30  SPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVV 89
           S F  VK+++ V    S    G+ N +G + K+E    L++ NG+ C+ +F ++ +  V 
Sbjct: 74  SKFLCVKLIIFVSYWQSMIIQGL-NILGVLGKDEMTGYLYQ-NGILCLEMFGFAILHLVA 131

Query: 90  YEW 92
           + W
Sbjct: 132 FPW 134

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.138    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,837,195
Number of extensions: 162256
Number of successful extensions: 1167
Number of sequences better than 10.0: 209
Number of HSP's gapped: 943
Number of HSP's successfully gapped: 514
Length of query: 185
Length of database: 16,596,109
Length adjustment: 95
Effective length of query: 90
Effective length of database: 13,307,399
Effective search space: 1197665910
Effective search space used: 1197665910
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 58 (26.9 bits)