Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0D03971g99985185e-70
Sklu_2189.295954022e-52
Scas_347.289823613e-46
YLL018C-A (COX19)98903502e-44
ADL041C99843451e-43
CAGL0D06578g86843343e-42
Scas_706.1878540630.58
KLLA0B03784g34249601.6
YNL247W76721592.1
CAGL0J07744g78821557.6
YGL246C (RAI1)38741548.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D03971g
         (98 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D03971g 334691..334990 similar to sgd|S0007245 Saccharomyce...   204   5e-70
Sklu_2189.2 YLL018C-A, Contig c2189 4754-5041 reverse complement      159   2e-52
Scas_347.2                                                            143   3e-46
YLL018C-A (COX19) [3400] chr12 complement(108675..108971) Protei...   139   2e-44
ADL041C [1700] [Homologous to ScYLL018C-A (COX19) - SH] (617549....   137   1e-43
CAGL0D06578g 625655..625915 no similarity, hypothetical start         133   3e-42
Scas_706.18                                                            29   0.58 
KLLA0B03784g complement(341886..342914) similar to sp|P47173 Sac...    28   1.6  
YNL247W (YNL247W) [4360] chr14 (182874..185177) Cysteinyl-tRNA s...    27   2.1  
CAGL0J07744g complement(752698..755064) highly similar to sp|P53...    26   7.6  
YGL246C (RAI1) [1754] chr7 complement(37617..38780) Protein that...    25   8.8  

>KLLA0D03971g 334691..334990 similar to sgd|S0007245 Saccharomyces
          cerevisiae YLL018ca COX19, start by similarity
          Length = 99

 Score =  204 bits (518), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 98/98 (100%), Positives = 98/98 (100%)

Query: 1  MSANPGNSLKALSPTPPERGSFPLDHDGDCTKQMQEYLSCIKLVKGENAPNCRLLAKEYL 60
          MSANPGNSLKALSPTPPERGSFPLDHDGDCTKQMQEYLSCIKLVKGENAPNCRLLAKEYL
Sbjct: 1  MSANPGNSLKALSPTPPERGSFPLDHDGDCTKQMQEYLSCIKLVKGENAPNCRLLAKEYL 60

Query: 61 KCRMDNKLMDRDDWKHLGLPSDKKEANDVTKETTPTSG 98
          KCRMDNKLMDRDDWKHLGLPSDKKEANDVTKETTPTSG
Sbjct: 61 KCRMDNKLMDRDDWKHLGLPSDKKEANDVTKETTPTSG 98

>Sklu_2189.2 YLL018C-A, Contig c2189 4754-5041 reverse complement
          Length = 95

 Score =  159 bits (402), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 85/95 (89%), Gaps = 3/95 (3%)

Query: 1  MSANPGNSLKALSPTPPERGSFPLDHDGDCTKQMQEYLSCIKLVKGENAPNCRLLAKEYL 60
          MS NPGNSL+ALSPTPPERGSFPLDHDG+C+KQMQ+YL CIKLV+GENAPNCRLLAK YL
Sbjct: 1  MSGNPGNSLRALSPTPPERGSFPLDHDGECSKQMQDYLQCIKLVRGENAPNCRLLAKNYL 60

Query: 61 KCRMDNKLMDRDDWKHLGLPSDKKEA---NDVTKE 92
          KCRMDN+LMDRD+WK+LGLP DKK+    ND  KE
Sbjct: 61 KCRMDNQLMDRDEWKNLGLPDDKKKIVSPNDGKKE 95

>Scas_347.2
          Length = 89

 Score =  143 bits (361), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 73/82 (89%)

Query: 1  MSANPGNSLKALSPTPPERGSFPLDHDGDCTKQMQEYLSCIKLVKGENAPNCRLLAKEYL 60
          MS NPG+SL+ALSPTPPERGSFPLDHD +C +QM  YL C+KLVKG+NAPNCRLLAKEYL
Sbjct: 1  MSGNPGSSLRALSPTPPERGSFPLDHDNECFQQMSAYLECMKLVKGQNAPNCRLLAKEYL 60

Query: 61 KCRMDNKLMDRDDWKHLGLPSD 82
          +CRMD++LMD DDW HLGLP D
Sbjct: 61 QCRMDHQLMDVDDWSHLGLPGD 82

>YLL018C-A (COX19) [3400] chr12 complement(108675..108971) Protein
          that may function in metal transport required for
          cytochrome oxidase assembly, localizes to the
          mitochondrial intermembrane space and to the cytoplasm
          [297 bp, 98 aa]
          Length = 98

 Score =  139 bits (350), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 74/90 (82%)

Query: 1  MSANPGNSLKALSPTPPERGSFPLDHDGDCTKQMQEYLSCIKLVKGENAPNCRLLAKEYL 60
          MS NPG+SL AL PTPPERGSFPLDHDG+CTK MQEYL C++LV+ ENA NCRLLAK+YL
Sbjct: 1  MSGNPGSSLSALRPTPPERGSFPLDHDGECTKYMQEYLKCMQLVQNENAMNCRLLAKDYL 60

Query: 61 KCRMDNKLMDRDDWKHLGLPSDKKEANDVT 90
          +CRMD++LMD D+W HLGLP D    N  T
Sbjct: 61 RCRMDHQLMDYDEWSHLGLPEDAPGNNGKT 90

>ADL041C [1700] [Homologous to ScYLL018C-A (COX19) - SH]
          (617549..617848) [300 bp, 99 aa]
          Length = 99

 Score =  137 bits (345), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 72/84 (85%)

Query: 1  MSANPGNSLKALSPTPPERGSFPLDHDGDCTKQMQEYLSCIKLVKGENAPNCRLLAKEYL 60
          MS NP ++L ALSPTP ERG FPLDH+G+CT  M EYL+C+KLV+GENAPNCRLL + YL
Sbjct: 1  MSGNPVSALHALSPTPSERGLFPLDHEGECTAHMMEYLNCMKLVRGENAPNCRLLVRNYL 60

Query: 61 KCRMDNKLMDRDDWKHLGLPSDKK 84
          KCRMD++LMDRD+W HLGLP DK+
Sbjct: 61 KCRMDHRLMDRDEWAHLGLPDDKR 84

>CAGL0D06578g 625655..625915 no similarity, hypothetical start
          Length = 86

 Score =  133 bits (334), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 73/84 (86%)

Query: 2  SANPGNSLKALSPTPPERGSFPLDHDGDCTKQMQEYLSCIKLVKGENAPNCRLLAKEYLK 61
          S NPG +L+ALSPTPPERGSFPLDHDG+C + MQ+YL C++L   ENA NCRLLAK+YLK
Sbjct: 3  SGNPGGALRALSPTPPERGSFPLDHDGECAEYMQKYLQCMRLAANENAHNCRLLAKDYLK 62

Query: 62 CRMDNKLMDRDDWKHLGLPSDKKE 85
          CRMD++LMD+D+WK+LGLP D K+
Sbjct: 63 CRMDHQLMDKDEWKNLGLPPDDKQ 86

>Scas_706.18
          Length = 785

 Score = 28.9 bits (63), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 20/40 (50%), Gaps = 2/40 (5%)

Query: 57  KEYLKCRMDNKLMDRDD--WKHLGLPSDKKEANDVTKETT 94
           KE  K R ++     D   W   GLP+  KE NDVTK  T
Sbjct: 725 KEKAKVRAEDMFRTEDYSVWDEQGLPTKDKEGNDVTKSMT 764

>KLLA0B03784g complement(341886..342914) similar to sp|P47173
           Saccharomyces cerevisiae YJR142w singleton, start by
           similarity
          Length = 342

 Score = 27.7 bits (60), Expect = 1.6,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 8/49 (16%)

Query: 16  PPERGSFPLDHDGDCTK----QMQEYLSCIKLVKGENAPNCRLLAKEYL 60
           PP+    P+ +DG+  +     +QE +  +K  +GE  PNC L+  E+L
Sbjct: 267 PPD--VIPVPNDGEVEQFGIFGLQEVVDALK--RGEFKPNCALIMVEFL 311

>YNL247W (YNL247W) [4360] chr14 (182874..185177) Cysteinyl-tRNA
           synthetase, member of the class I aminoacyl tRNA
           synthetase family [2304 bp, 767 aa]
          Length = 767

 Score = 27.3 bits (59), Expect = 2.1,   Method: Composition-based stats.
 Identities = 10/21 (47%), Positives = 13/21 (61%)

Query: 74  WKHLGLPSDKKEANDVTKETT 94
           W   GLP+  K+ ND+TK  T
Sbjct: 725 WDEQGLPTKDKDGNDITKSMT 745

>CAGL0J07744g complement(752698..755064) highly similar to sp|P53852
           Saccharomyces cerevisiae YNL247w cysteinyl-tRNA
           synthetase, start by similarity
          Length = 788

 Score = 25.8 bits (55), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 10/21 (47%), Positives = 13/21 (61%)

Query: 74  WKHLGLPSDKKEANDVTKETT 94
           W   GLP+  K+ ND+TK  T
Sbjct: 745 WDEQGLPTKDKDGNDITKSMT 765

>YGL246C (RAI1) [1754] chr7 complement(37617..38780) Protein that
           binds and enhances function of nuclear exonuclease Rat1p
           [1164 bp, 387 aa]
          Length = 387

 Score = 25.4 bits (54), Expect = 8.8,   Method: Composition-based stats.
 Identities = 14/41 (34%), Positives = 21/41 (51%), Gaps = 4/41 (9%)

Query: 36  EYLSCIKLVKGENAPNCRLLAKEYLKCRMDNKLMDRDDWKH 76
           EY+S ++   G    NC+L+    + C  D K   RD+ KH
Sbjct: 202 EYISVVRTGVG----NCKLILGAEVDCIFDFKENGRDNLKH 238

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.312    0.131    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,902,194
Number of extensions: 152784
Number of successful extensions: 229
Number of sequences better than 10.0: 17
Number of HSP's gapped: 229
Number of HSP's successfully gapped: 17
Length of query: 98
Length of database: 16,596,109
Length adjustment: 69
Effective length of query: 29
Effective length of database: 14,207,467
Effective search space: 412016543
Effective search space used: 412016543
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 54 (25.4 bits)