Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0D02442g36836212171e-168
CAGL0G07667g2581275718e-72
YJL079C (PRY1)2991275574e-69
YKR013W (PRY2)3291275543e-68
Kwal_14.24103731275452e-66
Scas_675.272901285261e-64
Sklu_956.13191175054e-61
YJL078C (PRY3)8811275119e-58
Scas_711.372671274614e-55
AAL179W3601274451e-51
CAGL0F05137g2271304053e-47
KLLA0D02420g2121284016e-47
Kwal_14.24092381263905e-45
AAL178W2051223667e-42
KLLA0C01496g4561362591e-24
AFR700W4341382554e-24
Kwal_33.131927991462382e-21
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D02442g
         (362 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D02442g complement(207613..208719) some similarities with s...   473   e-168
CAGL0G07667g 728351..729127 similar to sp|P47032 Saccharomyces c...   224   8e-72
YJL079C (PRY1) [2835] chr10 complement(289791..290690) Protein w...   219   4e-69
YKR013W (PRY2) [3268] chr11 (463602..464591) Protein expressed u...   218   3e-68
Kwal_14.2410                                                          214   2e-66
Scas_675.27                                                           207   1e-64
Sklu_956.1 YJL079C, Contig c956 998-1957                              199   4e-61
YJL078C (PRY3) [2836] chr10 complement(291252..293897) Protein w...   201   9e-58
Scas_711.37                                                           182   4e-55
AAL179W [8] [Homologous to ScYJL079C (PRY1) - SH] complement(255...   176   1e-51
CAGL0F05137g 523941..524624 similar to sp|P47032 Saccharomyces c...   160   3e-47
KLLA0D02420g complement(206544..207182) some similarities with s...   159   6e-47
Kwal_14.2409                                                          154   5e-45
AAL178W [9] [Homologous to ScYJL079C (PRY1) - SH; ScYKR013W (PRY...   145   7e-42
KLLA0C01496g complement(113533..114903) some similarities with s...   104   1e-24
AFR700W [3893] [Homologous to NOHBY] complement(1731981..1733285...   102   4e-24
Kwal_33.13192                                                          96   2e-21

>KLLA0D02442g complement(207613..208719) some similarities with
           sp|P47032 Saccharomyces cerevisiae YJL079c PRY1,
           hypothetical start
          Length = 368

 Score =  473 bits (1217), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 244/362 (67%), Positives = 244/362 (67%)

Query: 1   MPWQCRHTLRRCLAFVYLAFLLYSRIYFLTYIYVLIFFAGFKISWFKASIYITRGLISFC 60
           MPWQCRHTLRRCLAFVYLAFLLYSRIYFLTYIYVLIFFAGFKISWFKASIYITRGLISFC
Sbjct: 1   MPWQCRHTLRRCLAFVYLAFLLYSRIYFLTYIYVLIFFAGFKISWFKASIYITRGLISFC 60

Query: 61  LRLKHQARFIFFKEPVPSFVTMKLSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEGYV 120
           LRLKHQARFIFFKEPVPSFVTMKLSN                              EGYV
Sbjct: 61  LRLKHQARFIFFKEPVPSFVTMKLSNATLLSLAATAIAAPVATVTVHEHVRHTVIVEGYV 120

Query: 121 YIDGTTTSTGYRTVNGQSVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEYVSDED 180
           YIDGTTTSTGYRTVNGQSV                                  EYVSDED
Sbjct: 121 YIDGTTTSTGYRTVNGQSVETAAPATETDTAAFVTQVVAAGAAASPSSQAVAAEYVSDED 180

Query: 181 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMLDEHN 240
                                                                 MLDEHN
Sbjct: 181 TTTTGAPSTTSTAEQTTLTPTPTIEQTATSTPATTTAATSSSSSDSNLSSFASSMLDEHN 240

Query: 241 AKRALHKDTPTLSWSDELASYAQNYADDYDCSGSLTHSGGPYGENLAIGYGTTGAVDAWY 300
           AKRALHKDTPTLSWSDELASYAQNYADDYDCSGSLTHSGGPYGENLAIGYGTTGAVDAWY
Sbjct: 241 AKRALHKDTPTLSWSDELASYAQNYADDYDCSGSLTHSGGPYGENLAIGYGTTGAVDAWY 300

Query: 301 SEIKDYSFSNPDYSSSTGHFTQVVWKSTTKVGCGIKQCGGVWGDYIICSYDPAGNMLGTF 360
           SEIKDYSFSNPDYSSSTGHFTQVVWKSTTKVGCGIKQCGGVWGDYIICSYDPAGNMLGTF
Sbjct: 301 SEIKDYSFSNPDYSSSTGHFTQVVWKSTTKVGCGIKQCGGVWGDYIICSYDPAGNMLGTF 360

Query: 361 AS 362
           AS
Sbjct: 361 AS 362

>CAGL0G07667g 728351..729127 similar to sp|P47032 Saccharomyces
           cerevisiae YJL079c PRY1, hypothetical start
          Length = 258

 Score =  224 bits (571), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 112/127 (88%)

Query: 235 MLDEHNAKRALHKDTPTLSWSDELASYAQNYADDYDCSGSLTHSGGPYGENLAIGYGTTG 294
           ML+EHN KRALH+DT  L+WSDELA YAQNYA++YDCSG+L HSGGPYGENLAIGY   G
Sbjct: 125 MLNEHNIKRALHQDTNPLTWSDELAQYAQNYANNYDCSGNLVHSGGPYGENLAIGYSPVG 184

Query: 295 AVDAWYSEIKDYSFSNPDYSSSTGHFTQVVWKSTTKVGCGIKQCGGVWGDYIICSYDPAG 354
           +VDAWY EIKDY+++NP +S STGHFTQVVWKS+TKVGC +K CGGVWGDY+ICSYDPAG
Sbjct: 185 SVDAWYDEIKDYNYANPGFSESTGHFTQVVWKSSTKVGCAVKSCGGVWGDYVICSYDPAG 244

Query: 355 NMLGTFA 361
           N LG FA
Sbjct: 245 NFLGEFA 251

>YJL079C (PRY1) [2835] chr10 complement(289791..290690) Protein with
           similarity to plant pathenogenesis-related proteins, may
           have a role in mating efficiency [900 bp, 299 aa]
          Length = 299

 Score =  219 bits (557), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 99/127 (77%), Positives = 111/127 (87%)

Query: 235 MLDEHNAKRALHKDTPTLSWSDELASYAQNYADDYDCSGSLTHSGGPYGENLAIGYGTTG 294
           +L EHN KRALHKDTP LSWSD LASYAQ+YAD+YDCSG+LTHSGGPYGENLA+GY    
Sbjct: 166 VLAEHNKKRALHKDTPALSWSDTLASYAQDYADNYDCSGTLTHSGGPYGENLALGYDGPA 225

Query: 295 AVDAWYSEIKDYSFSNPDYSSSTGHFTQVVWKSTTKVGCGIKQCGGVWGDYIICSYDPAG 354
           AVDAWY+EI +Y FSNP +SS+TGHFTQVVWKSTT+VGCGIK CGG WGDY+ICSYDPAG
Sbjct: 226 AVDAWYNEISNYDFSNPGFSSNTGHFTQVVWKSTTQVGCGIKTCGGAWGDYVICSYDPAG 285

Query: 355 NMLGTFA 361
           N  G +A
Sbjct: 286 NYEGEYA 292

>YKR013W (PRY2) [3268] chr11 (463602..464591) Protein expressed
           under starvation conditions [990 bp, 329 aa]
          Length = 329

 Score =  218 bits (554), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 110/127 (86%)

Query: 235 MLDEHNAKRALHKDTPTLSWSDELASYAQNYADDYDCSGSLTHSGGPYGENLAIGYGTTG 294
           M++EHN KRALHKDT +L+WSD LA+YAQNYAD YDCSG+L HSGGPYGENLA+GYGTTG
Sbjct: 196 MVNEHNTKRALHKDTGSLTWSDTLATYAQNYADSYDCSGNLVHSGGPYGENLALGYGTTG 255

Query: 295 AVDAWYSEIKDYSFSNPDYSSSTGHFTQVVWKSTTKVGCGIKQCGGVWGDYIICSYDPAG 354
           +VDAWY+EI  Y +SNP +S S GHFTQVVWK T++VGCG+K CGG WGDYIICSY  AG
Sbjct: 256 SVDAWYNEITSYDYSNPGFSESAGHFTQVVWKGTSEVGCGLKSCGGEWGDYIICSYKAAG 315

Query: 355 NMLGTFA 361
           N++G FA
Sbjct: 316 NVIGEFA 322

>Kwal_14.2410
          Length = 373

 Score =  214 bits (545), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 109/127 (85%)

Query: 235 MLDEHNAKRALHKDTPTLSWSDELASYAQNYADDYDCSGSLTHSGGPYGENLAIGYGTTG 294
           +L  HN KR+LHKDT  LSWSDELASYAQ+YAD YDCSGSL+HSGGPYGENLA+GY TTG
Sbjct: 240 ILKAHNNKRSLHKDTSDLSWSDELASYAQDYADKYDCSGSLSHSGGPYGENLAVGYSTTG 299

Query: 295 AVDAWYSEIKDYSFSNPDYSSSTGHFTQVVWKSTTKVGCGIKQCGGVWGDYIICSYDPAG 354
           +VDAWY EIKDY +SNP+YSSSTGHFTQVVWK ++ +GCGIK CGG  GDY+ICSY  AG
Sbjct: 300 SVDAWYGEIKDYDWSNPNYSSSTGHFTQVVWKGSSALGCGIKSCGGGTGDYVICSYKTAG 359

Query: 355 NMLGTFA 361
           N LG FA
Sbjct: 360 NFLGEFA 366

>Scas_675.27
          Length = 290

 Score =  207 bits (526), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 108/128 (84%), Gaps = 1/128 (0%)

Query: 235 MLDEHNAKRALHKDTPTLSWSDELASYAQNYADDYDCSGSLTHSGGPYGENLAIGYGTTG 294
           +L+EHNAKRALH++TP LSWSD+LASYAQNYAD YDCSG+L HSGGPYGENLA+GY   G
Sbjct: 156 VLNEHNAKRALHQNTPALSWSDDLASYAQNYADAYDCSGNLVHSGGPYGENLALGYDAVG 215

Query: 295 AVDAWYSEIKDYSFSNPDYSSSTGHFTQVVWKSTTKVGCGIKQCGGV-WGDYIICSYDPA 353
           +VDAWY+EI  Y +SNP +S + GHFTQVVWKS+T+VGCGIK C    WG Y+ICSY+PA
Sbjct: 216 SVDAWYNEISSYDYSNPGFSENAGHFTQVVWKSSTQVGCGIKDCSATGWGSYVICSYNPA 275

Query: 354 GNMLGTFA 361
           GN +G FA
Sbjct: 276 GNFIGEFA 283

>Sklu_956.1 YJL079C, Contig c956 998-1957
          Length = 319

 Score =  199 bits (505), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 98/117 (83%)

Query: 235 MLDEHNAKRALHKDTPTLSWSDELASYAQNYADDYDCSGSLTHSGGPYGENLAIGYGTTG 294
           +LDEHN KRALHKDT  L+WS+ LA YAQ YAD YDCSGSLTHSGGPYGENLA+GY  TG
Sbjct: 176 ILDEHNKKRALHKDTSALTWSETLADYAQKYADSYDCSGSLTHSGGPYGENLALGYSATG 235

Query: 295 AVDAWYSEIKDYSFSNPDYSSSTGHFTQVVWKSTTKVGCGIKQCGGVWGDYIICSYD 351
           AVDAWY EI  Y +SNP YSSSTGHFTQVVWKST++VGCGIK C   WG Y+ICSY+
Sbjct: 236 AVDAWYGEISSYDWSNPAYSSSTGHFTQVVWKSTSEVGCGIKSCDNSWGSYVICSYN 292

>YJL078C (PRY3) [2836] chr10 complement(291252..293897) Protein with
           similarity to plant pathogenesis-related proteins, may
           have a role in mating efficiency, shows
           daughter-specific expression [2646 bp, 881 aa]
          Length = 881

 Score =  201 bits (511), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 102/127 (80%)

Query: 235 MLDEHNAKRALHKDTPTLSWSDELASYAQNYADDYDCSGSLTHSGGPYGENLAIGYGTTG 294
           +L+EHN  RALH DT  L+WSD LA+YAQNYAD YDCSG LTHS GPYGENLA+GY  TG
Sbjct: 29  VLNEHNKFRALHVDTAPLTWSDTLATYAQNYADQYDCSGVLTHSDGPYGENLALGYTDTG 88

Query: 295 AVDAWYSEIKDYSFSNPDYSSSTGHFTQVVWKSTTKVGCGIKQCGGVWGDYIICSYDPAG 354
           AVDAWY EI  Y++SNP +S STGHFTQVVWKST ++GCG K CG  W +YI+CSY+P G
Sbjct: 89  AVDAWYGEISKYNYSNPGFSESTGHFTQVVWKSTAEIGCGYKYCGTTWNNYIVCSYNPPG 148

Query: 355 NMLGTFA 361
           N LG FA
Sbjct: 149 NYLGEFA 155

>Scas_711.37
          Length = 267

 Score =  182 bits (461), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 80/127 (62%), Positives = 99/127 (77%), Gaps = 1/127 (0%)

Query: 235 MLDEHNAKRALHKDTPTLSWSDELASYAQNYADD-YDCSGSLTHSGGPYGENLAIGYGTT 293
           +L+EHN KRALH++T  L+WS+ELA YAQ YAD+ Y+C G L HSGGPYGENLA GY   
Sbjct: 132 LLEEHNKKRALHENTGPLTWSEELAQYAQAYADNHYNCDGQLIHSGGPYGENLAAGYTLL 191

Query: 294 GAVDAWYSEIKDYSFSNPDYSSSTGHFTQVVWKSTTKVGCGIKQCGGVWGDYIICSYDPA 353
           G+VDAWY+EI +Y +SNP +S STGHFTQ+VWK T++VGC IK C   WG Y+ICSY+ A
Sbjct: 192 GSVDAWYNEISEYDYSNPGFSESTGHFTQLVWKDTSQVGCAIKSCNNAWGTYLICSYNSA 251

Query: 354 GNMLGTF 360
           GN  G +
Sbjct: 252 GNFDGEY 258

>AAL179W [8] [Homologous to ScYJL079C (PRY1) - SH]
           complement(25509..26591) [1083 bp, 360 aa]
          Length = 360

 Score =  176 bits (445), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 98/127 (77%), Gaps = 1/127 (0%)

Query: 235 MLDEHNAKRALHKDTPTLSWSDELASYAQNYADDYDCSGSLTHSGGPYGENLAIGYGTT- 293
           +L  HN++R LHKDT  L+WS+ELA +A+++A+ YDCSG L HS  PYGENLA+GY T  
Sbjct: 226 ILRAHNSRRQLHKDTKPLTWSEELAKFARDFANQYDCSGRLVHSDSPYGENLAVGYPTPE 285

Query: 294 GAVDAWYSEIKDYSFSNPDYSSSTGHFTQVVWKSTTKVGCGIKQCGGVWGDYIICSYDPA 353
            AV AWY EI DYS+S+P +S STGHF+Q+VWK T  +GC +K+CGG  GDY+ICSYDPA
Sbjct: 286 KAVKAWYDEISDYSYSHPSFSFSTGHFSQLVWKDTKHLGCAVKKCGGSVGDYLICSYDPA 345

Query: 354 GNMLGTF 360
           GN L  F
Sbjct: 346 GNFLRRF 352

>CAGL0F05137g 523941..524624 similar to sp|P47032 Saccharomyces
           cerevisiae YJL079c PRY1, start by similarity
          Length = 227

 Score =  160 bits (405), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 75/130 (57%), Positives = 89/130 (68%), Gaps = 3/130 (2%)

Query: 235 MLDEHNAKRALHKDTPTLSWSDELASYAQNYADDYDCSGSLTHSGG---PYGENLAIGYG 291
           MLD+HN KR LHKDT +L W+D LA  AQ+YAD YDCSG+L H+       GENLA+GY 
Sbjct: 91  MLDQHNKKRELHKDTDSLVWNDNLAILAQSYADRYDCSGNLAHNPEFIEAIGENLAVGYD 150

Query: 292 TTGAVDAWYSEIKDYSFSNPDYSSSTGHFTQVVWKSTTKVGCGIKQCGGVWGDYIICSYD 351
              A+DAWY EI+ Y +SNP +   T HFTQ+VWK T  VGC  K CGG   +YI+C YD
Sbjct: 151 DIDAIDAWYDEIQHYDYSNPVHQGRTAHFTQLVWKDTKNVGCAYKTCGGDLYNYIVCEYD 210

Query: 352 PAGNMLGTFA 361
           PAGN  G FA
Sbjct: 211 PAGNWAGEFA 220

>KLLA0D02420g complement(206544..207182) some similarities with
           sp|P36110 Saccharomyces cerevisiae YKR013w PRY2,
           hypothetical start
          Length = 212

 Score =  159 bits (401), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 69/128 (53%), Positives = 95/128 (74%), Gaps = 1/128 (0%)

Query: 235 MLDEHNAKRALHKDTPTLSWSDELASYAQNYADDYDCSGSLTHSGGPYGENLAIGYGTTG 294
           +LD HN+ R  H+   +L W+ ELAS AQN+A+ Y C+G L HS  PYGENLA+GY TT 
Sbjct: 80  ILDVHNSLRKKHQ-VSSLVWAPELASRAQNFANSYVCNGQLEHSKLPYGENLALGYNTTS 138

Query: 295 AVDAWYSEIKDYSFSNPDYSSSTGHFTQVVWKSTTKVGCGIKQCGGVWGDYIICSYDPAG 354
           AV AWY+E+K Y F+NP ++++TGHFTQ+VWK+T+K+GC   +CG  +G Y +C YDP G
Sbjct: 139 AVLAWYNEVKLYDFNNPQFAANTGHFTQLVWKNTSKLGCAFIRCGQYYGQYTVCEYDPPG 198

Query: 355 NMLGTFAS 362
           N++G F+ 
Sbjct: 199 NVIGKFSE 206

>Kwal_14.2409
          Length = 238

 Score =  154 bits (390), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 68/126 (53%), Positives = 88/126 (69%), Gaps = 1/126 (0%)

Query: 235 MLDEHNAKRALHKDTPTLSWSDELASYAQNYADDYDCSGSLTHSGGPYGENLAIGYGTTG 294
           ML+ HN  R LH D P L WS +L  +AQ YA++Y+C+G+L HSG PYGENLA+G+ TT 
Sbjct: 107 MLETHNRFRDLH-DAPALRWSSDLQDFAQKYANNYNCNGTLIHSGSPYGENLALGFNTTA 165

Query: 295 AVDAWYSEIKDYSFSNPDYSSSTGHFTQVVWKSTTKVGCGIKQCGGVWGDYIICSYDPAG 354
           A  AWY E+K Y++  P +S  TGHFTQ+VWKS+  +GC    CG  +G Y ICSYDP G
Sbjct: 166 AASAWYDEVKFYNYQKPGFSEKTGHFTQLVWKSSIHLGCARIDCGDYYGQYTICSYDPPG 225

Query: 355 NMLGTF 360
           N+ G +
Sbjct: 226 NVAGQY 231

>AAL178W [9] [Homologous to ScYJL079C (PRY1) - SH; ScYKR013W (PRY2)
           - SH] complement(26881..27498) [618 bp, 205 aa]
          Length = 205

 Score =  145 bits (366), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 67/122 (54%), Positives = 83/122 (68%), Gaps = 1/122 (0%)

Query: 235 MLDEHNAKRALHKDTPTLSWSDELASYAQNYADDYDCSGSLTHSGGPYGENLAIGYGTTG 294
           +LD HN  R  H   P L W+  L ++AQ+YA+   C+GSL HSG P+GENLA+GY    
Sbjct: 75  VLDLHNDYRRRHHAVP-LRWNSTLYTHAQHYANRILCNGSLVHSGLPHGENLALGYSPAA 133

Query: 295 AVDAWYSEIKDYSFSNPDYSSSTGHFTQVVWKSTTKVGCGIKQCGGVWGDYIICSYDPAG 354
           AV AWY EI +Y FS P +S +TGHFTQ+VW+STT VGC    CG  +G YIIC YDP G
Sbjct: 134 AVTAWYDEIAEYDFSTPGFSHATGHFTQLVWRSTTSVGCAYVMCGPCYGLYIICQYDPPG 193

Query: 355 NM 356
           N+
Sbjct: 194 NV 195

>KLLA0C01496g complement(113533..114903) some similarities with
           sp|P47032 Saccharomyces cerevisiae YJL079c PRY1,
           hypothetical start
          Length = 456

 Score =  104 bits (259), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 61/136 (44%), Positives = 81/136 (59%), Gaps = 17/136 (12%)

Query: 235 MLDEHNAKRALHKDTPTLSWSDELASYAQNY------ADDYDCSGSLTHSGGPYGENLAI 288
           +L+ HN  RA H+ T  L W++ELA+YA +Y      +D+  C+  L HSGGPYGENLA 
Sbjct: 301 VLNAHNEYRARHQSTNPLVWNEELAAYAYDYTQTLFGSDNDPCNYKLQHSGGPYGENLAA 360

Query: 289 GYGTTGA--VDAWYSEIKDYSFSNPDYSS----STGHFTQVVWKSTTKVGCGIKQC--GG 340
           G  +  A  V  WY EI  Y ++N    S      GHFTQ+VW ++T VGC + +C  G 
Sbjct: 361 GTNSDPAALVGLWYDEINYYDYNNVTGISHNGHDVGHFTQLVWAASTDVGCSVTKCSSGS 420

Query: 341 VWGDYIICSYDPAGNM 356
           V   Y+IC Y PAGN+
Sbjct: 421 V---YLICEYSPAGNV 433

>AFR700W [3893] [Homologous to NOHBY] complement(1731981..1733285)
           [1305 bp, 434 aa]
          Length = 434

 Score =  102 bits (255), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 81/138 (58%), Gaps = 16/138 (11%)

Query: 235 MLDEHNAKRALHKDTPTLSWSDELASYAQNYADDY------DCSGSLTHSGGPYGENLAI 288
           ++  HNAKR LH+DT  L W+++L+ +A +Y  +        C+  L HS GPYGEN+A 
Sbjct: 274 LVKAHNAKRVLHEDTQPLKWNNKLSDFAYSYVSELVGTSEDPCTYVLKHSNGPYGENIAS 333

Query: 289 GYGT-----TGAVDAWYSEIKDYSFSNPD----YSSSTGHFTQVVWKSTTKVGCGIKQCG 339
           G  +     T  V++WY+EI+DY +++ D       + GHFTQ+VW  + +VGC +  C 
Sbjct: 334 GLSSETPNVTEYVNSWYNEIEDYDYNDIDGIYHRGKAVGHFTQLVWAKSQEVGCAVVYCS 393

Query: 340 GV-WGDYIICSYDPAGNM 356
               G YI+C Y P GN+
Sbjct: 394 NNGKGIYILCEYHPVGNI 411

>Kwal_33.13192
          Length = 799

 Score = 96.3 bits (238), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 61/146 (41%), Positives = 75/146 (51%), Gaps = 29/146 (19%)

Query: 235 MLDEHNAKRALHKDTPTLSWSDELASYAQNYADDYD------CSGSLTHSGGPYGENLAI 288
           +L EHN KR+LH +TP L W D L+++A NYA+         CSG L HS     +   I
Sbjct: 635 ILQEHNLKRSLHINTPDLEWDDGLSAWAYNYANSLSGTNRDVCSGFLQHSSTRDNQGENI 694

Query: 289 GYGTTGA----VDAWYSEIKDYSFSNPDYSSST---------GHFTQVVWKSTTKVGCGI 335
            +GTT      VD WY EI DY     DY   T         GHFTQ+VW ST KVGC +
Sbjct: 695 AFGTTSNPNQLVDYWYDEISDY-----DYDDVTGIYHNGKMVGHFTQMVWASTQKVGCAV 749

Query: 336 KQCG-----GVWGDYIICSYDPAGNM 356
            QC      G    Y++C Y  AGN+
Sbjct: 750 VQCDTMAKYGQNSIYLLCEYKDAGNV 775

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.137    0.444 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,463,771
Number of extensions: 299835
Number of successful extensions: 708
Number of sequences better than 10.0: 19
Number of HSP's gapped: 698
Number of HSP's successfully gapped: 20
Length of query: 362
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 259
Effective length of database: 13,030,455
Effective search space: 3374887845
Effective search space used: 3374887845
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 62 (28.5 bits)