Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0D02420g21220910301e-144
AAL178W2051564623e-58
Kwal_14.24092381344532e-56
YKR013W (PRY2)3291364238e-51
KLLA0D02442g3681344214e-50
Kwal_14.24103731374111e-48
CAGL0G07667g2581354012e-48
Scas_675.272901363921e-46
YJL078C (PRY3)8811454114e-46
YJL079C (PRY1)2991303885e-46
AAL179W3601353919e-46
Scas_711.372671373726e-44
Sklu_956.13191223671e-42
CAGL0F05137g2271533383e-39
KLLA0C01496g4561422603e-26
AFR700W4341492102e-19
Kwal_33.131927991661999e-18
Scas_297.180066661.4
ABR073C102640624.8
YGL018C (JAC1)18425589.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D02420g
         (209 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D02420g complement(206544..207182) some similarities with s...   401   e-144
AAL178W [9] [Homologous to ScYJL079C (PRY1) - SH; ScYKR013W (PRY...   182   3e-58
Kwal_14.2409                                                          179   2e-56
YKR013W (PRY2) [3268] chr11 (463602..464591) Protein expressed u...   167   8e-51
KLLA0D02442g complement(207613..208719) some similarities with s...   166   4e-50
Kwal_14.2410                                                          162   1e-48
CAGL0G07667g 728351..729127 similar to sp|P47032 Saccharomyces c...   159   2e-48
Scas_675.27                                                           155   1e-46
YJL078C (PRY3) [2836] chr10 complement(291252..293897) Protein w...   162   4e-46
YJL079C (PRY1) [2835] chr10 complement(289791..290690) Protein w...   154   5e-46
AAL179W [8] [Homologous to ScYJL079C (PRY1) - SH] complement(255...   155   9e-46
Scas_711.37                                                           147   6e-44
Sklu_956.1 YJL079C, Contig c956 998-1957                              145   1e-42
CAGL0F05137g 523941..524624 similar to sp|P47032 Saccharomyces c...   134   3e-39
KLLA0C01496g complement(113533..114903) some similarities with s...   104   3e-26
AFR700W [3893] [Homologous to NOHBY] complement(1731981..1733285...    86   2e-19
Kwal_33.13192                                                          81   9e-18
Scas_297.1                                                             30   1.4  
ABR073C [664] [Homologous to ScYKL057C (NUP120) - SH] (521796..5...    28   4.8  
YGL018C (JAC1) [1955] chr7 complement(459113..459667) J-type cha...    27   9.7  

>KLLA0D02420g complement(206544..207182) some similarities with
           sp|P36110 Saccharomyces cerevisiae YKR013w PRY2,
           hypothetical start
          Length = 212

 Score =  401 bits (1030), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 194/209 (92%), Positives = 194/209 (92%)

Query: 1   MNQVYWLILVVLIHAKILCHAQGITVTKYNTVRIIRXXXXXXXXXXXXXXXIVYRTASGT 60
           MNQVYWLILVVLIHAKILCHAQGITVTKYNTVRIIR               IVYRTASGT
Sbjct: 1   MNQVYWLILVVLIHAKILCHAQGITVTKYNTVRIIRTKTVSTTTHFTTSRTIVYRTASGT 60

Query: 61  FTEQVSTKPTATDPDFKTEILDVHNSLRKKHQVSSLVWAPELASRAQNFANSYVCNGQLE 120
           FTEQVSTKPTATDPDFKTEILDVHNSLRKKHQVSSLVWAPELASRAQNFANSYVCNGQLE
Sbjct: 61  FTEQVSTKPTATDPDFKTEILDVHNSLRKKHQVSSLVWAPELASRAQNFANSYVCNGQLE 120

Query: 121 HSKLPYGENLALGYNTTSAVLAWYNEVKLYDFNNPQFAANTGHFTQLVWKNTSKLGCAFI 180
           HSKLPYGENLALGYNTTSAVLAWYNEVKLYDFNNPQFAANTGHFTQLVWKNTSKLGCAFI
Sbjct: 121 HSKLPYGENLALGYNTTSAVLAWYNEVKLYDFNNPQFAANTGHFTQLVWKNTSKLGCAFI 180

Query: 181 RCGQYYGQYTVCEYDPPGNVIGKFSENVL 209
           RCGQYYGQYTVCEYDPPGNVIGKFSENVL
Sbjct: 181 RCGQYYGQYTVCEYDPPGNVIGKFSENVL 209

>AAL178W [9] [Homologous to ScYJL079C (PRY1) - SH; ScYKR013W (PRY2)
           - SH] complement(26881..27498) [618 bp, 205 aa]
          Length = 205

 Score =  182 bits (462), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 108/156 (69%)

Query: 54  YRTASGTFTEQVSTKPTATDPDFKTEILDVHNSLRKKHQVSSLVWAPELASRAQNFANSY 113
           YRT +   TE   ++PTA +  F + +LD+HN  R++H    L W   L + AQ++AN  
Sbjct: 49  YRTQTTPLTETPLSRPTAVNNTFASAVLDLHNDYRRRHHAVPLRWNSTLYTHAQHYANRI 108

Query: 114 VCNGQLEHSKLPYGENLALGYNTTSAVLAWYNEVKLYDFNNPQFAANTGHFTQLVWKNTS 173
           +CNG L HS LP+GENLALGY+  +AV AWY+E+  YDF+ P F+  TGHFTQLVW++T+
Sbjct: 109 LCNGSLVHSGLPHGENLALGYSPAAAVTAWYDEIAEYDFSTPGFSHATGHFTQLVWRSTT 168

Query: 174 KLGCAFIRCGQYYGQYTVCEYDPPGNVIGKFSENVL 209
            +GCA++ CG  YG Y +C+YDPPGNV  ++  NVL
Sbjct: 169 SVGCAYVMCGPCYGLYIICQYDPPGNVADQYVANVL 204

>Kwal_14.2409
          Length = 238

 Score =  179 bits (453), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 99/134 (73%)

Query: 76  FKTEILDVHNSLRKKHQVSSLVWAPELASRAQNFANSYVCNGQLEHSKLPYGENLALGYN 135
           F++++L+ HN  R  H   +L W+ +L   AQ +AN+Y CNG L HS  PYGENLALG+N
Sbjct: 103 FQSQMLETHNRFRDLHDAPALRWSSDLQDFAQKYANNYNCNGTLIHSGSPYGENLALGFN 162

Query: 136 TTSAVLAWYNEVKLYDFNNPQFAANTGHFTQLVWKNTSKLGCAFIRCGQYYGQYTVCEYD 195
           TT+A  AWY+EVK Y++  P F+  TGHFTQLVWK++  LGCA I CG YYGQYT+C YD
Sbjct: 163 TTAAASAWYDEVKFYNYQKPGFSEKTGHFTQLVWKSSIHLGCARIDCGDYYGQYTICSYD 222

Query: 196 PPGNVIGKFSENVL 209
           PPGNV G++ +NVL
Sbjct: 223 PPGNVAGQYQDNVL 236

>YKR013W (PRY2) [3268] chr11 (463602..464591) Protein expressed
           under starvation conditions [990 bp, 329 aa]
          Length = 329

 Score =  167 bits (423), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 72/136 (52%), Positives = 97/136 (71%), Gaps = 1/136 (0%)

Query: 75  DFKTEILDVHNSLRKKHQ-VSSLVWAPELASRAQNFANSYVCNGQLEHSKLPYGENLALG 133
           DF T +++ HN+ R  H+   SL W+  LA+ AQN+A+SY C+G L HS  PYGENLALG
Sbjct: 191 DFSTSMVNEHNTKRALHKDTGSLTWSDTLATYAQNYADSYDCSGNLVHSGGPYGENLALG 250

Query: 134 YNTTSAVLAWYNEVKLYDFNNPQFAANTGHFTQLVWKNTSKLGCAFIRCGQYYGQYTVCE 193
           Y TT +V AWYNE+  YD++NP F+ + GHFTQ+VWK TS++GC    CG  +G Y +C 
Sbjct: 251 YGTTGSVDAWYNEITSYDYSNPGFSESAGHFTQVVWKGTSEVGCGLKSCGGEWGDYIICS 310

Query: 194 YDPPGNVIGKFSENVL 209
           Y   GNVIG+F++NV+
Sbjct: 311 YKAAGNVIGEFADNVM 326

>KLLA0D02442g complement(207613..208719) some similarities with
           sp|P47032 Saccharomyces cerevisiae YJL079c PRY1,
           hypothetical start
          Length = 368

 Score =  166 bits (421), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 72/134 (53%), Positives = 99/134 (73%), Gaps = 1/134 (0%)

Query: 76  FKTEILDVHNSLRKKHQ-VSSLVWAPELASRAQNFANSYVCNGQLEHSKLPYGENLALGY 134
           F + +LD HN+ R  H+   +L W+ ELAS AQN+A+ Y C+G L HS  PYGENLA+GY
Sbjct: 231 FASSMLDEHNAKRALHKDTPTLSWSDELASYAQNYADDYDCSGSLTHSGGPYGENLAIGY 290

Query: 135 NTTSAVLAWYNEVKLYDFNNPQFAANTGHFTQLVWKNTSKLGCAFIRCGQYYGQYTVCEY 194
            TT AV AWY+E+K Y F+NP ++++TGHFTQ+VWK+T+K+GC   +CG  +G Y +C Y
Sbjct: 291 GTTGAVDAWYSEIKDYSFSNPDYSSSTGHFTQVVWKSTTKVGCGIKQCGGVWGDYIICSY 350

Query: 195 DPPGNVIGKFSENV 208
           DP GN++G F+ NV
Sbjct: 351 DPAGNMLGTFASNV 364

>Kwal_14.2410
          Length = 373

 Score =  162 bits (411), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 71/137 (51%), Positives = 96/137 (70%), Gaps = 1/137 (0%)

Query: 73  DPDFKTEILDVHNSLRKKHQ-VSSLVWAPELASRAQNFANSYVCNGQLEHSKLPYGENLA 131
           + DF + IL  HN+ R  H+  S L W+ ELAS AQ++A+ Y C+G L HS  PYGENLA
Sbjct: 233 NSDFASTILKAHNNKRSLHKDTSDLSWSDELASYAQDYADKYDCSGSLSHSGGPYGENLA 292

Query: 132 LGYNTTSAVLAWYNEVKLYDFNNPQFAANTGHFTQLVWKNTSKLGCAFIRCGQYYGQYTV 191
           +GY+TT +V AWY E+K YD++NP ++++TGHFTQ+VWK +S LGC    CG   G Y +
Sbjct: 293 VGYSTTGSVDAWYGEIKDYDWSNPNYSSSTGHFTQVVWKGSSALGCGIKSCGGGTGDYVI 352

Query: 192 CEYDPPGNVIGKFSENV 208
           C Y   GN +G+F+ENV
Sbjct: 353 CSYKTAGNFLGEFAENV 369

>CAGL0G07667g 728351..729127 similar to sp|P47032 Saccharomyces
           cerevisiae YJL079c PRY1, hypothetical start
          Length = 258

 Score =  159 bits (401), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 70/135 (51%), Positives = 97/135 (71%), Gaps = 1/135 (0%)

Query: 75  DFKTEILDVHNSLRKKHQ-VSSLVWAPELASRAQNFANSYVCNGQLEHSKLPYGENLALG 133
           DF   +L+ HN  R  HQ  + L W+ ELA  AQN+AN+Y C+G L HS  PYGENLA+G
Sbjct: 120 DFAKSMLNEHNIKRALHQDTNPLTWSDELAQYAQNYANNYDCSGNLVHSGGPYGENLAIG 179

Query: 134 YNTTSAVLAWYNEVKLYDFNNPQFAANTGHFTQLVWKNTSKLGCAFIRCGQYYGQYTVCE 193
           Y+   +V AWY+E+K Y++ NP F+ +TGHFTQ+VWK+++K+GCA   CG  +G Y +C 
Sbjct: 180 YSPVGSVDAWYDEIKDYNYANPGFSESTGHFTQVVWKSSTKVGCAVKSCGGVWGDYVICS 239

Query: 194 YDPPGNVIGKFSENV 208
           YDP GN +G+F++NV
Sbjct: 240 YDPAGNFLGEFAQNV 254

>Scas_675.27
          Length = 290

 Score =  155 bits (392), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 97/136 (71%), Gaps = 2/136 (1%)

Query: 75  DFKTEILDVHNSLRKKHQ-VSSLVWAPELASRAQNFANSYVCNGQLEHSKLPYGENLALG 133
           +F + +L+ HN+ R  HQ   +L W+ +LAS AQN+A++Y C+G L HS  PYGENLALG
Sbjct: 151 EFASSVLNEHNAKRALHQNTPALSWSDDLASYAQNYADAYDCSGNLVHSGGPYGENLALG 210

Query: 134 YNTTSAVLAWYNEVKLYDFNNPQFAANTGHFTQLVWKNTSKLGCAFIRCGQY-YGQYTVC 192
           Y+   +V AWYNE+  YD++NP F+ N GHFTQ+VWK+++++GC    C    +G Y +C
Sbjct: 211 YDAVGSVDAWYNEISSYDYSNPGFSENAGHFTQVVWKSSTQVGCGIKDCSATGWGSYVIC 270

Query: 193 EYDPPGNVIGKFSENV 208
            Y+P GN IG+F+ENV
Sbjct: 271 SYNPAGNFIGEFAENV 286

>YJL078C (PRY3) [2836] chr10 complement(291252..293897) Protein with
           similarity to plant pathogenesis-related proteins, may
           have a role in mating efficiency, shows
           daughter-specific expression [2646 bp, 881 aa]
          Length = 881

 Score =  162 bits (411), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 71/145 (48%), Positives = 101/145 (69%), Gaps = 1/145 (0%)

Query: 65  VSTKPTATDPDFKTEILDVHNSLRKKH-QVSSLVWAPELASRAQNFANSYVCNGQLEHSK 123
           V+ K   T P+F++++L+ HN  R  H   + L W+  LA+ AQN+A+ Y C+G L HS 
Sbjct: 14  VAVKAQTTFPNFESDVLNEHNKFRALHVDTAPLTWSDTLATYAQNYADQYDCSGVLTHSD 73

Query: 124 LPYGENLALGYNTTSAVLAWYNEVKLYDFNNPQFAANTGHFTQLVWKNTSKLGCAFIRCG 183
            PYGENLALGY  T AV AWY E+  Y+++NP F+ +TGHFTQ+VWK+T+++GC +  CG
Sbjct: 74  GPYGENLALGYTDTGAVDAWYGEISKYNYSNPGFSESTGHFTQVVWKSTAEIGCGYKYCG 133

Query: 184 QYYGQYTVCEYDPPGNVIGKFSENV 208
             +  Y VC Y+PPGN +G+F+E V
Sbjct: 134 TTWNNYIVCSYNPPGNYLGEFAEEV 158

>YJL079C (PRY1) [2835] chr10 complement(289791..290690) Protein with
           similarity to plant pathenogenesis-related proteins, may
           have a role in mating efficiency [900 bp, 299 aa]
          Length = 299

 Score =  154 bits (388), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 94/130 (72%), Gaps = 1/130 (0%)

Query: 80  ILDVHNSLRKKHQ-VSSLVWAPELASRAQNFANSYVCNGQLEHSKLPYGENLALGYNTTS 138
           +L  HN  R  H+   +L W+  LAS AQ++A++Y C+G L HS  PYGENLALGY+  +
Sbjct: 166 VLAEHNKKRALHKDTPALSWSDTLASYAQDYADNYDCSGTLTHSGGPYGENLALGYDGPA 225

Query: 139 AVLAWYNEVKLYDFNNPQFAANTGHFTQLVWKNTSKLGCAFIRCGQYYGQYTVCEYDPPG 198
           AV AWYNE+  YDF+NP F++NTGHFTQ+VWK+T+++GC    CG  +G Y +C YDP G
Sbjct: 226 AVDAWYNEISNYDFSNPGFSSNTGHFTQVVWKSTTQVGCGIKTCGGAWGDYVICSYDPAG 285

Query: 199 NVIGKFSENV 208
           N  G++++NV
Sbjct: 286 NYEGEYADNV 295

>AAL179W [8] [Homologous to ScYJL079C (PRY1) - SH]
           complement(25509..26591) [1083 bp, 360 aa]
          Length = 360

 Score =  155 bits (391), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 71/135 (52%), Positives = 93/135 (68%), Gaps = 2/135 (1%)

Query: 76  FKTEILDVHNSLRKKHQ-VSSLVWAPELASRAQNFANSYVCNGQLEHSKLPYGENLALGY 134
           F+ EIL  HNS R+ H+    L W+ ELA  A++FAN Y C+G+L HS  PYGENLA+GY
Sbjct: 222 FEEEILRAHNSRRQLHKDTKPLTWSEELAKFARDFANQYDCSGRLVHSDSPYGENLAVGY 281

Query: 135 NTTS-AVLAWYNEVKLYDFNNPQFAANTGHFTQLVWKNTSKLGCAFIRCGQYYGQYTVCE 193
            T   AV AWY+E+  Y +++P F+ +TGHF+QLVWK+T  LGCA  +CG   G Y +C 
Sbjct: 282 PTPEKAVKAWYDEISDYSYSHPSFSFSTGHFSQLVWKDTKHLGCAVKKCGGSVGDYLICS 341

Query: 194 YDPPGNVIGKFSENV 208
           YDP GN + +F ENV
Sbjct: 342 YDPAGNFLRRFGENV 356

>Scas_711.37
          Length = 267

 Score =  147 bits (372), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 91/137 (66%), Gaps = 2/137 (1%)

Query: 75  DFKTEILDVHNSLRKKHQ-VSSLVWAPELASRAQNFA-NSYVCNGQLEHSKLPYGENLAL 132
           DF++ +L+ HN  R  H+    L W+ ELA  AQ +A N Y C+GQL HS  PYGENLA 
Sbjct: 127 DFQSSLLEEHNKKRALHENTGPLTWSEELAQYAQAYADNHYNCDGQLIHSGGPYGENLAA 186

Query: 133 GYNTTSAVLAWYNEVKLYDFNNPQFAANTGHFTQLVWKNTSKLGCAFIRCGQYYGQYTVC 192
           GY    +V AWYNE+  YD++NP F+ +TGHFTQLVWK+TS++GCA   C   +G Y +C
Sbjct: 187 GYTLLGSVDAWYNEISEYDYSNPGFSESTGHFTQLVWKDTSQVGCAIKSCNNAWGTYLIC 246

Query: 193 EYDPPGNVIGKFSENVL 209
            Y+  GN  G++  NVL
Sbjct: 247 SYNSAGNFDGEYEANVL 263

>Sklu_956.1 YJL079C, Contig c956 998-1957
          Length = 319

 Score =  145 bits (367), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 63/122 (51%), Positives = 85/122 (69%), Gaps = 1/122 (0%)

Query: 75  DFKTEILDVHNSLRKKHQ-VSSLVWAPELASRAQNFANSYVCNGQLEHSKLPYGENLALG 133
           DF + ILD HN  R  H+  S+L W+  LA  AQ +A+SY C+G L HS  PYGENLALG
Sbjct: 171 DFASSILDEHNKKRALHKDTSALTWSETLADYAQKYADSYDCSGSLTHSGGPYGENLALG 230

Query: 134 YNTTSAVLAWYNEVKLYDFNNPQFAANTGHFTQLVWKNTSKLGCAFIRCGQYYGQYTVCE 193
           Y+ T AV AWY E+  YD++NP ++++TGHFTQ+VWK+TS++GC    C   +G Y +C 
Sbjct: 231 YSATGAVDAWYGEISSYDWSNPAYSSSTGHFTQVVWKSTSEVGCGIKSCDNSWGSYVICS 290

Query: 194 YD 195
           Y+
Sbjct: 291 YN 292

>CAGL0F05137g 523941..524624 similar to sp|P47032 Saccharomyces
           cerevisiae YJL079c PRY1, start by similarity
          Length = 227

 Score =  134 bits (338), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 96/153 (62%), Gaps = 4/153 (2%)

Query: 60  TFTEQVSTKPTATDPDFKTEILDVHNSLRKKHQ-VSSLVWAPELASRAQNFANSYVCNGQ 118
           T  ++ + K  +   +++ ++LD HN  R+ H+   SLVW   LA  AQ++A+ Y C+G 
Sbjct: 71  TDLDKRAQKKRSNLSEWQQKMLDQHNKKRELHKDTDSLVWNDNLAILAQSYADRYDCSGN 130

Query: 119 LEHSKL---PYGENLALGYNTTSAVLAWYNEVKLYDFNNPQFAANTGHFTQLVWKNTSKL 175
           L H+       GENLA+GY+   A+ AWY+E++ YD++NP     T HFTQLVWK+T  +
Sbjct: 131 LAHNPEFIEAIGENLAVGYDDIDAIDAWYDEIQHYDYSNPVHQGRTAHFTQLVWKDTKNV 190

Query: 176 GCAFIRCGQYYGQYTVCEYDPPGNVIGKFSENV 208
           GCA+  CG     Y VCEYDP GN  G+F++NV
Sbjct: 191 GCAYKTCGGDLYNYIVCEYDPAGNWAGEFADNV 223

>KLLA0C01496g complement(113533..114903) some similarities with
           sp|P47032 Saccharomyces cerevisiae YJL079c PRY1,
           hypothetical start
          Length = 456

 Score =  104 bits (260), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 83/142 (58%), Gaps = 15/142 (10%)

Query: 72  TDPDFKTEILDVHNSLRKKHQVSS-LVWAPELASRAQNF------ANSYVCNGQLEHSKL 124
           +D D +  +L+ HN  R +HQ ++ LVW  ELA+ A ++      +++  CN +L+HS  
Sbjct: 294 SDAD-RESVLNAHNEYRARHQSTNPLVWNEELAAYAYDYTQTLFGSDNDPCNYKLQHSGG 352

Query: 125 PYGENLALGYNTTSAVLA--WYNEVKLYDFNN----PQFAANTGHFTQLVWKNTSKLGCA 178
           PYGENLA G N+  A L   WY+E+  YD+NN         + GHFTQLVW  ++ +GC+
Sbjct: 353 PYGENLAAGTNSDPAALVGLWYDEINYYDYNNVTGISHNGHDVGHFTQLVWAASTDVGCS 412

Query: 179 FIRCGQYYGQYTVCEYDPPGNV 200
             +C      Y +CEY P GNV
Sbjct: 413 VTKCSS-GSVYLICEYSPAGNV 433

>AFR700W [3893] [Homologous to NOHBY] complement(1731981..1733285)
           [1305 bp, 434 aa]
          Length = 434

 Score = 85.5 bits (210), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 55/149 (36%), Positives = 77/149 (51%), Gaps = 25/149 (16%)

Query: 73  DPDFKTEILDVHNSLRKKHQ-VSSLVWAPELASRAQNFANSYV----------CNGQLEH 121
           D +  +E++  HN+ R  H+    L W  +L+    +FA SYV          C   L+H
Sbjct: 267 DHNVASELVKAHNAKRVLHEDTQPLKWNNKLS----DFAYSYVSELVGTSEDPCTYVLKH 322

Query: 122 SKLPYGENLALGY-----NTTSAVLAWYNEVKLYDFNNPQ----FAANTGHFTQLVWKNT 172
           S  PYGEN+A G      N T  V +WYNE++ YD+N+           GHFTQLVW  +
Sbjct: 323 SNGPYGENIASGLSSETPNVTEYVNSWYNEIEDYDYNDIDGIYHRGKAVGHFTQLVWAKS 382

Query: 173 SKLGCAFIRCGQY-YGQYTVCEYDPPGNV 200
            ++GCA + C     G Y +CEY P GN+
Sbjct: 383 QEVGCAVVYCSNNGKGIYILCEYHPVGNI 411

>Kwal_33.13192
          Length = 799

 Score = 81.3 bits (199), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 61/166 (36%), Positives = 81/166 (48%), Gaps = 29/166 (17%)

Query: 73  DPDFKTEILDVHNSLRKKH-QVSSLVWAPELASRAQNFANSY------VCNGQLEHS--K 123
           D    + IL  HN  R  H     L W   L++ A N+ANS       VC+G L+HS  +
Sbjct: 628 DAATASAILQEHNLKRSLHINTPDLEWDDGLSAWAYNYANSLSGTNRDVCSGFLQHSSTR 687

Query: 124 LPYGENLALG--YNTTSAVLAWYNEVKLYDFNNP----QFAANTGHFTQLVWKNTSKLGC 177
              GEN+A G   N    V  WY+E+  YD+++           GHFTQ+VW +T K+GC
Sbjct: 688 DNQGENIAFGTTSNPNQLVDYWYDEISDYDYDDVTGIYHNGKMVGHFTQMVWASTQKVGC 747

Query: 178 AFIRCGQY--YGQ---YTVCEYDPPGNV---------IGKFSENVL 209
           A ++C     YGQ   Y +CEY   GNV         +  F ENVL
Sbjct: 748 AVVQCDTMAKYGQNSIYLLCEYKDAGNVYNGTPGQDEMSFFKENVL 793

>Scas_297.1
          Length = 800

 Score = 30.0 bits (66), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 30/66 (45%), Gaps = 13/66 (19%)

Query: 148 KLYDFNN-PQFAANTGHFTQLVWKN---------TSKLGCAFIRCGQYYGQYTVCEYDPP 197
           KLY  N  P+    T  F QL+W+          T+    +F+  G Y   YT  EYDP 
Sbjct: 495 KLYSDNRIPERVPKT--FLQLIWEAFNDKTMLLLTAAAVVSFV-LGLYEALYTPPEYDPE 551

Query: 198 GNVIGK 203
           GN I K
Sbjct: 552 GNPIKK 557

>ABR073C [664] [Homologous to ScYKL057C (NUP120) - SH]
           (521796..524876) [3081 bp, 1026 aa]
          Length = 1026

 Score = 28.5 bits (62), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 3/40 (7%)

Query: 154 NPQFAANTGHFTQLVWKNTSK---LGCAFIRCGQYYGQYT 190
           NP F  +T H    V +NT     LG ++ RCG+Y   Y+
Sbjct: 731 NPSFFLDTIHTQLYVRENTVHQFMLGLSYYRCGRYEEAYS 770

>YGL018C (JAC1) [1955] chr7 complement(459113..459667) J-type
           chaperone protein, may be involved in assembly of
           mitochondrial iron-sulfur proteins [555 bp, 184 aa]
          Length = 184

 Score = 26.9 bits (58), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 10/25 (40%), Positives = 16/25 (64%)

Query: 63  EQVSTKPTATDPDFKTEILDVHNSL 87
           EQ S + T +DP    ++LD+H+ L
Sbjct: 91  EQTSNEVTTSDPQLLLKVLDIHDEL 115

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.134    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,688,062
Number of extensions: 252938
Number of successful extensions: 564
Number of sequences better than 10.0: 22
Number of HSP's gapped: 544
Number of HSP's successfully gapped: 22
Length of query: 209
Length of database: 16,596,109
Length adjustment: 97
Effective length of query: 112
Effective length of database: 13,238,163
Effective search space: 1482674256
Effective search space used: 1482674256
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)