Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0D02398g1205118758250.0
AAL177W1198108628090.0
Scas_711.361219110227160.0
YJL080C (SCP160)1222110527070.0
Kwal_14.23971206110026540.0
CAGL0M03223g1209110324800.0
AFL018C392146850.061
Kwal_27.12486299269840.082
KLLA0E00847g71375810.27
Scas_667.637838790.36
CAGL0L00297g138566790.44
AER186C316253760.80
Kwal_23.4035520144760.88
Scas_515.634260750.98
KLLA0F10703g417101751.1
CAGL0G04037g778202761.1
YBR249C (ARO4)37044741.4
Kwal_55.20652694305741.5
Scas_597.1337244731.9
KLLA0D01067g66074722.5
Scas_693.282447141714.5
AGL111W47150704.7
Sklu_2360.5372100695.5
YIL112W (HOS4)108371687.9
Scas_716.28110861688.4
CAGL0K07117g460756710.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D02398g
         (1187 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D02398g complement(202446..206063) similar to sp|P06105 Sac...  2248   0.0  
AAL177W [10] [Homologous to ScYJL080C (SCP160) - SH] complement(...  1086   0.0  
Scas_711.36                                                          1050   0.0  
YJL080C (SCP160) [2834] chr10 complement(285474..289142) Protein...  1047   0.0  
Kwal_14.2397                                                         1026   0.0  
CAGL0M03223g complement(366828..370457) similar to sp|P06105 Sac...   959   0.0  
AFL018C [3175] [Homologous to ScYBR233W (PBP2) - SH] (402853..40...    37   0.061
Kwal_27.12486                                                          37   0.082
KLLA0E00847g complement(87991..90132) some similarities with sgd...    36   0.27 
Scas_667.6                                                             35   0.36 
CAGL0L00297g 30464..34621 similar to sp|P23255 Saccharomyces cer...    35   0.44 
AER186C [2688] [Homologous to ScYBL032W (HEK2) - SH] (982057..98...    34   0.80 
Kwal_23.4035                                                           34   0.88 
Scas_515.6                                                             33   0.98 
KLLA0F10703g complement(984298..985551) similar to sp|P38151 Sac...    33   1.1  
CAGL0G04037g 383068..385404 similar to tr|Q07834 Saccharomyces c...    34   1.1  
YBR249C (ARO4) [428] chr2 complement(716839..717951) 2-Dehydro-3...    33   1.4  
Kwal_55.20652                                                          33   1.5  
Scas_597.13                                                            33   1.9  
KLLA0D01067g complement(94114..96096) similar to sp|P39923 Sacch...    32   2.5  
Scas_693.28                                                            32   4.5  
AGL111W [4201] [Homologous to ScYDR195W (REF2) - SH] complement(...    32   4.7  
Sklu_2360.5 YDR035W, Contig c2360 14257-15375                          31   5.5  
YIL112W (HOS4) [2564] chr9 (151592..154843) Component of Set3p c...    31   7.9  
Scas_716.28                                                            31   8.4  
CAGL0K07117g complement(700102..701484) similar to sp|P38151 Sac...    30   10.0 

>KLLA0D02398g complement(202446..206063) similar to sp|P06105
            Saccharomyces cerevisiae YJL080c SCP160 required for
            maintenance of exact ploidy singleton, start by
            similarity
          Length = 1205

 Score = 2248 bits (5825), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1130/1187 (95%), Positives = 1130/1187 (95%)

Query: 1    MSEITPDVAEDYSQIVVDTPPSSADDSSKLAGQTIEQTEKSNGEEAATAPAVKVLFPRLX 60
            MSEITPDVAEDYSQIVVDTPPSSADDSSKLAGQTIEQTEKSNGEEAATAPAVKVLFPRL 
Sbjct: 1    MSEITPDVAEDYSQIVVDTPPSSADDSSKLAGQTIEQTEKSNGEEAATAPAVKVLFPRLG 60

Query: 61   XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHGKNGRASSPGSAKPLRSRNIQEVFSLDL 120
                                           HGKNGRASSPGSAKPLRSRNIQEVFSLDL
Sbjct: 61   GNAAASASGNAVSWGSTLKSGSSVNSVSSLSHGKNGRASSPGSAKPLRSRNIQEVFSLDL 120

Query: 121  DAQYQITKTEFSSIVQSVKQKYDVSVESTLSKTSRTFLISGSSDKIGLAKRELVKKLTKP 180
            DAQYQITKTEFSSIVQSVKQKYDVSVESTLSKTSRTFLISGSSDKIGLAKRELVKKLTKP
Sbjct: 121  DAQYQITKTEFSSIVQSVKQKYDVSVESTLSKTSRTFLISGSSDKIGLAKRELVKKLTKP 180

Query: 181  VNVTFEVPSKTRSAIIGSGGKTIRAISDAAGVKIVVPKEVDEGTYDSDLEDYSVTISLHG 240
            VNVTFEVPSKTRSAIIGSGGKTIRAISDAAGVKIVVPKEVDEGTYDSDLEDYSVTISLHG
Sbjct: 181  VNVTFEVPSKTRSAIIGSGGKTIRAISDAAGVKIVVPKEVDEGTYDSDLEDYSVTISLHG 240

Query: 241  DAESVLVAKSKILDVVKEETKNAKIVLPVEDSKLVPFIDLESVEIPADVKAQLFTNNDPA 300
            DAESVLVAKSKILDVVKEETKNAKIVLPVEDSKLVPFIDLESVEIPADVKAQLFTNNDPA
Sbjct: 241  DAESVLVAKSKILDVVKEETKNAKIVLPVEDSKLVPFIDLESVEIPADVKAQLFTNNDPA 300

Query: 301  EIALNGPRDNVKLAKVKVINYLNELGLKIVVKKEKVPFKFHPLVKPSELNEKFHVEVQAP 360
            EIALNGPRDNVKLAKVKVINYLNELGLKIVVKKEKVPFKFHPLVKPSELNEKFHVEVQAP
Sbjct: 301  EIALNGPRDNVKLAKVKVINYLNELGLKIVVKKEKVPFKFHPLVKPSELNEKFHVEVQAP 360

Query: 361  SISGDDQFVFIGSSDNVNEAIVYAKNSSKFHTVESLEISKAHGKNVKHAKNLILYFQKYN 420
            SISGDDQFVFIGSSDNVNEAIVYAKNSSKFHTVESLEISKAHGKNVKHAKNLILYFQKYN
Sbjct: 361  SISGDDQFVFIGSSDNVNEAIVYAKNSSKFHTVESLEISKAHGKNVKHAKNLILYFQKYN 420

Query: 421  VLDQITEDFPQVQVVLPKVESIPALESVSITLISNNDAADAIKTVRKQIVALVNELSPEQ 480
            VLDQITEDFPQVQVVLPKVESIPALESVSITLISNNDAADAIKTVRKQIVALVNELSPEQ
Sbjct: 421  VLDQITEDFPQVQVVLPKVESIPALESVSITLISNNDAADAIKTVRKQIVALVNELSPEQ 480

Query: 481  TLTISDLDYHLFHKDIKQILVSTESDVPFIQLGDCFPGNDDILLITKINEDDFKPSDDEL 540
            TLTISDLDYHLFHKDIKQILVSTESDVPFIQLGDCFPGNDDILLITKINEDDFKPSDDEL
Sbjct: 481  TLTISDLDYHLFHKDIKQILVSTESDVPFIQLGDCFPGNDDILLITKINEDDFKPSDDEL 540

Query: 541  KVKLESVNQQLEPIRKKQSLLASNVVSLAKKEQDELLGESKVTLNLINEAVSHAGAHALI 600
            KVKLESVNQQLEPIRKKQSLLASNVVSLAKKEQDELLGESKVTLNLINEAVSHAGAHALI
Sbjct: 541  KVKLESVNQQLEPIRKKQSLLASNVVSLAKKEQDELLGESKVTLNLINEAVSHAGAHALI 600

Query: 601  KLSTPSVNQITIRGDDHGCKIASAAVKSIVENSSTESKITFQVPTNVVSRLIGPKGANLQ 660
            KLSTPSVNQITIRGDDHGCKIASAAVKSIVENSSTESKITFQVPTNVVSRLIGPKGANLQ
Sbjct: 601  KLSTPSVNQITIRGDDHGCKIASAAVKSIVENSSTESKITFQVPTNVVSRLIGPKGANLQ 660

Query: 661  QIREKFDVQTFIPQDSKDENTDVTLTGLQYNLDQAKTYILAEAKKWSDIITKELIVPMKY 720
            QIREKFDVQTFIPQDSKDENTDVTLTGLQYNLDQAKTYILAEAKKWSDIITKELIVPMKY
Sbjct: 661  QIREKFDVQTFIPQDSKDENTDVTLTGLQYNLDQAKTYILAEAKKWSDIITKELIVPMKY 720

Query: 721  HRTLSGPQGTYRIRLENKYSVFIRFPKDSELVTIRGPSRGVKAAYDELKALLDFEIENGH 780
            HRTLSGPQGTYRIRLENKYSVFIRFPKDSELVTIRGPSRGVKAAYDELKALLDFEIENGH
Sbjct: 721  HRTLSGPQGTYRIRLENKYSVFIRFPKDSELVTIRGPSRGVKAAYDELKALLDFEIENGH 780

Query: 781  KELLKVPVDYVTRVIGKSGETINDIKAEYGVELNFLDKTDSEKAKEAGEVELEITGSRSS 840
            KELLKVPVDYVTRVIGKSGETINDIKAEYGVELNFLDKTDSEKAKEAGEVELEITGSRSS
Sbjct: 781  KELLKVPVDYVTRVIGKSGETINDIKAEYGVELNFLDKTDSEKAKEAGEVELEITGSRSS 840

Query: 841  IKEAANKVKSIIDQASNFETVTLEDIDSKYYSDIIGRSGSQLKEIISKAGGDEIRNKRVN 900
            IKEAANKVKSIIDQASNFETVTLEDIDSKYYSDIIGRSGSQLKEIISKAGGDEIRNKRVN
Sbjct: 841  IKEAANKVKSIIDQASNFETVTLEDIDSKYYSDIIGRSGSQLKEIISKAGGDEIRNKRVN 900

Query: 901  IPDASSEDKVITIFGPSDFXXXXXXXXXXXXSGLENSITEELNIPQEKFGALIGPAGSVR 960
            IPDASSEDKVITIFGPSDF            SGLENSITEELNIPQEKFGALIGPAGSVR
Sbjct: 901  IPDASSEDKVITIFGPSDFVKKVVKQIKGVVSGLENSITEELNIPQEKFGALIGPAGSVR 960

Query: 961  RELETEFKVRIHVPNKNSSDEKVTVSGSPANXXXXXXXXXXXXXRDSFDLEIAVPAKYHS 1020
            RELETEFKVRIHVPNKNSSDEKVTVSGSPAN             RDSFDLEIAVPAKYHS
Sbjct: 961  RELETEFKVRIHVPNKNSSDEKVTVSGSPANIESCKKKIEKEIIRDSFDLEIAVPAKYHS 1020

Query: 1021 YVSNSGLIFQTLRNEFSIDVSHGNLTRTAQSLSRANYKVPENVAGGENESSNVLIQSVTE 1080
            YVSNSGLIFQTLRNEFSIDVSHGNLTRTAQSLSRANYKVPENVAGGENESSNVLIQSVTE
Sbjct: 1021 YVSNSGLIFQTLRNEFSIDVSHGNLTRTAQSLSRANYKVPENVAGGENESSNVLIQSVTE 1080

Query: 1081 TEAKVDTIPWRLTYSPIDLSDVLGEDYKKDEESKDQVLEKASKLIEDRIAEAKLVNTEGF 1140
            TEAKVDTIPWRLTYSPIDLSDVLGEDYKKDEESKDQVLEKASKLIEDRIAEAKLVNTEGF
Sbjct: 1081 TEAKVDTIPWRLTYSPIDLSDVLGEDYKKDEESKDQVLEKASKLIEDRIAEAKLVNTEGF 1140

Query: 1141 VWSKDAKKFNSIVGPNGRNIREIRNATKTVIHVPRKSDKVNNVIYVL 1187
            VWSKDAKKFNSIVGPNGRNIREIRNATKTVIHVPRKSDKVNNVIYVL
Sbjct: 1141 VWSKDAKKFNSIVGPNGRNIREIRNATKTVIHVPRKSDKVNNVIYVL 1187

>AAL177W [10] [Homologous to ScYJL080C (SCP160) - SH]
            complement(27774..31370) [3597 bp, 1198 aa]
          Length = 1198

 Score = 1086 bits (2809), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 578/1086 (53%), Positives = 751/1086 (69%), Gaps = 9/1086 (0%)

Query: 104  AKPLRSRNIQEVFSLDLDAQYQITKTEFSSIVQSVKQKYDVSVESTLSKTSRTFLISGSS 163
            AKP+RS+ +QE FSLDL  Q  I+K EFS  V SVKQ + VS+ESTLSK SRTFLI+GS 
Sbjct: 99   AKPMRSKTMQEAFSLDLQTQVTISKAEFSKFVVSVKQSHSVSIESTLSKLSRTFLITGSP 158

Query: 164  DKIGLAKRELVKKLTKPVNVTFEVPSKTRSAIIGSGGKTIRAISDAAG-VKIVVPKEVDE 222
              +  AKRELVKKLT+PV V  +VPSKT S+IIG GG+ IR I++AAG +KI + K  + 
Sbjct: 159  TNVYNAKRELVKKLTRPVTVVIQVPSKTVSSIIGPGGRMIREITNAAGGIKIDIAKTAEA 218

Query: 223  GTYDSDLEDYSVTISLHGDAESVLVAKSKILDVVKEETKNAKIVLPVEDSKLVPFIDLES 282
              YD+DL+D  + ISLHGD  SV  AK KIL +VKEETKNA I + VE+ +L+PFI L  
Sbjct: 219  DAYDADLDDQLINISLHGDVASVNFAKDKILSIVKEETKNATISVAVENKQLIPFISLAD 278

Query: 283  VEIPADVKAQLFTNNDPAEIALNGPRDNVKLAKVKVINYLNELGLKIVVKKEKVPFKFHP 342
            VEI  DV  + F N    +I L GPRD  K AKV V NYLN L  K+  KK  +P KF P
Sbjct: 279  VEISEDVTVKAFPNGS-EKIVLMGPRDEAKEAKVNVQNYLNTLASKVSEKKISIPRKFQP 337

Query: 343  LVKPSELNEKFHVEVQAPSISGDDQFVFIGSSDNVNEAIVYAKNSSKFHTVESLEISKAH 402
            L+   ++ EK+ V V  P+  GDD   F G S N+++AI YA+ SSK + VESLE+SKAH
Sbjct: 338  LIDAEDVREKYKVSVIFPTALGDDTVSFYGLSANLDDAIAYARQSSKQYIVESLEVSKAH 397

Query: 403  GKNVKHAKNLILYFQKYNVLDQITEDFPQVQVVLPKVESIPALESVSITLISNNDAADAI 462
            GKNV HAKNL+ YF KY++L  I E F +V++VLP  E +P L++VSI +IS  D A+  
Sbjct: 398  GKNVAHAKNLMFYFAKYDILKDIKESFKEVKLVLPTPEELPGLDNVSINIISKADIAEQT 457

Query: 463  KTVRKQIVALVNELSPEQTLTISDLDYHLFHKDIKQILVSTESDVPFIQLGDCFPGNDDI 522
            KTVRKQI+ +VN L+P   L + DLDY LFHKDIKQ L  +++++PF+QLGD + G++ +
Sbjct: 458  KTVRKQIINIVNRLTPSHVLAVDDLDYELFHKDIKQAL--SKAEIPFVQLGDHYEGDNTV 515

Query: 523  LLITKINEDDFKPSDDELKVKLESVNQQLEPIRKKQSLLASNVVSLAKKEQDELLGESKV 582
            LL  K++E+DF+PS +E+K  LE V   L+ +R KQS L + +V+   + Q     +  V
Sbjct: 516  LLFAKVDEEDFQPSPEEVKEHLEKVAAVLDEVRTKQSKLFTKIVNFDAEFQVLHFSDDSV 575

Query: 583  TLNLINEAVSHAGAHALIKLSTPSVNQITIRGDDHGCKIASAAVKSIVENSSTESKITFQ 642
            T NL+ E ++ AG HA IKL TPS ++ITIRGD+   K A  A +SI EN S +SK+T  
Sbjct: 576  TWNLVLENITSAGGHAQIKLHTPSEDEITIRGDEKAVKAAVKAFESIAENPSKKSKLTVS 635

Query: 643  VPTNVVSRLIGPKGANLQQIREKFDVQTFIPQDSKDENTDVTLTGLQYNLDQAKTYILAE 702
            VP N VSRLIGPKG NL QIR+KFDVQ  +P +S D NT++TLTGL+YNL  AKT+I +E
Sbjct: 636  VPANTVSRLIGPKGTNLAQIRQKFDVQIDVPSESNDTNTEITLTGLEYNLQHAKTHIASE 695

Query: 703  AKKWSDIITKELIVPMKYHRTLSGPQGTYRIRLENKYSVFIRFPKDSELVTIRGPSRGVK 762
            AKKW+DI TKELIVP KYH +L G QGTYRIRLENKYSV I+FPK+ E+VTI+GPSRGV 
Sbjct: 696  AKKWADITTKELIVPTKYHGSLIGSQGTYRIRLENKYSVRIQFPKEGEVVTIKGPSRGVN 755

Query: 763  AAYDELKALLDFEIENGHKELLKVPVDYVTRVIGKSGETINDIKAEYGVELNFLDKTDSE 822
             A+ ELKALLDFEIENGHK ++ VPV++V RVIGK+G+ IN I+AE GVEL  L  T + 
Sbjct: 756  KAHAELKALLDFEIENGHKSVINVPVEHVPRVIGKNGDVINGIRAELGVELKLLQNTKTA 815

Query: 823  KAKEAGEVELEITGSRSSIKEAANKVKSIIDQASNFETVTLEDIDSKYYSDIIGRSGSQL 882
            K +    V+LEITGSR +IKEA+  V +II +AS+F T  LE ID+KY+  I+G  GS L
Sbjct: 816  KEQNLDTVQLEITGSRQAIKEASKAVDAIIAEASDFTTKQLE-IDAKYHKLIVGPGGSTL 874

Query: 883  KEIISKAGGDEIRNKRVNIPDASSEDKVITIFGPSDFXXXXXXXXXXXXSGLENSITEEL 942
            K+ ISKAGGD+IRNK V++P+A S +KVITI GP  F              ++ S+ +EL
Sbjct: 875  KDFISKAGGDDIRNKTVDVPNAESTNKVITISGPKTFVEKMSKALNQIVQDIKASVAKEL 934

Query: 943  NIPQEKFGALIGPAGSVRRELETEFKVRIHVPNKNSSDEKVTVSGSPANXXXXXXXXXXX 1002
            NIP ++ GALIGP GSVRR+LE++F VRI VP+K   + KVT+ G P             
Sbjct: 935  NIPADRQGALIGPGGSVRRQLESQFNVRIEVPDK-GKEGKVTIHGRPEAVEKCEKEIFST 993

Query: 1003 XXRDSFDLEIAVPAKYHSYVSNSGLIFQTLRNEFSIDVSHGNLTRTAQSLSRANYKVP-E 1061
              RDS+D EI VPA YH++VS  G +   LR  + I+V HGN ++ A  LSR+   +P E
Sbjct: 994  IIRDSYDQEIMVPAVYHAFVSERGQLINKLRMTYFINVKHGNSSKKANKLSRSEQPIPIE 1053

Query: 1062 NVAGGENESSNVLIQSVTETEAKV-DTIPWRLTYSPIDLSDVLGEDYKKDEESKDQVLEK 1120
             V G E E + + I+ V+  EA   D IPWRLTY  +DLSD+LGE+  K   +K+Q LE 
Sbjct: 1054 RVRGSEGEGTKLTIEEVSAPEASANDNIPWRLTYEHVDLSDILGEE-GKHAMTKEQALEA 1112

Query: 1121 ASKLIEDRIAEAKLVNTEGFVWSKDAKKFNSIVGPNGRNIREIRNATKTVIHVPRKSDKV 1180
            A+  I++RI  A   N  G++W ++ KKFN +VGP G NI++IR  T T+I+VP+KSDKV
Sbjct: 1113 AADQIKERIELAPKANCIGYLWCENVKKFNKVVGPGGSNIKQIRETTNTLINVPKKSDKV 1172

Query: 1181 NNVIYV 1186
            +++IYV
Sbjct: 1173 SDIIYV 1178

>Scas_711.36
          Length = 1219

 Score = 1050 bits (2716), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 547/1102 (49%), Positives = 747/1102 (67%), Gaps = 23/1102 (2%)

Query: 104  AKPLRSRNIQEVFSLDLDAQYQITKTEFSSIVQSVKQKYDVSVESTLSKTSRTFLISGSS 163
            AK +RS+NIQE F+LDL +Q  ITK E S IVQSVKQ Y+VSVESTLSK SRTFLISG +
Sbjct: 102  AKRMRSKNIQESFTLDLQSQLSITKPELSRIVQSVKQAYNVSVESTLSKNSRTFLISGVA 161

Query: 164  DKIGLAKRELVKKLTKPVNVTFEVPSKTRSAIIGSGGKTIRAISDAAGVKIVVPKEVDEG 223
             K+  AKR+LVK+LT+P++    VP++ R+AIIGSGGKTIR IS+   V I + +E +  
Sbjct: 162  TKVQDAKRDLVKQLTRPIDDVMTVPARCRAAIIGSGGKTIRGISEQYDVTINLARENNPD 221

Query: 224  TYDSDLEDYSVTISLHGDAESVLVAKSKILDVVKEETKNAKIVLPVEDSKLVPFIDLESV 283
            +YD DL D++  ++ HGD ESV +AK +I ++VKEETK   + +PV+D K++PFIDL ++
Sbjct: 222  SYDEDLNDFTANVNFHGDFESVNMAKRRIEEIVKEETKTLSLRVPVKDEKIIPFIDLSAI 281

Query: 284  EIPADVKAQLFTNNDPAEIALNGPRDNVKLAKVKVINYLNELGLKIVVKKEKVPFKFHPL 343
             +P  VK   +   D AE+ ++GPRD+VK  K  V +YLN+L   +  +K K+P KF  L
Sbjct: 282  TVPEGVKCNFY--RDTAEVNISGPRDDVKATKTGVQDYLNQLSSTLTEEKIKIPTKFQFL 339

Query: 344  VKPSELNEKFHVEVQAPSISGDDQFVFIGSSDNVNEAIVYAKNSSKFHTVESLEISKAHG 403
            +    L ++F+V V  PS   D+   F+G  D V EAI +A+ +SK  TV+SL+ISK+H 
Sbjct: 340  IDTKALKKEFNVIVTFPSDPTDELVSFVGQKDKVTEAIAFARANSKTFTVDSLDISKSHS 399

Query: 404  KNVKHAKNLILYFQKYNVLDQITEDFPQVQVVLPKVESIPALESVSITLISNNDAADAIK 463
            KN+ HAKNL LYF KY  L  I E +P+V++VLP    +    SV I + + +++A+ IK
Sbjct: 400  KNLAHAKNLALYFTKYPALKDIKEAYPEVKIVLPAPSLLKDAASVVINISAKSESANEIK 459

Query: 464  TVRKQIVALVNELSPEQTLTISDLDYHLFHKDIKQILVSTESDVPFIQLGDCFPGNDDIL 523
              RK+++  VN ++P  TLTI+DLDY LFHK IK  L++TE  VPFIQLGD FPGND I+
Sbjct: 460  FARKELINFVNTITPLDTLTITDLDYELFHKSIKSTLLATEDKVPFIQLGDYFPGNDSIV 519

Query: 524  LITKINEDDFKPSDDELKVKLESVNQQLEPIRKKQSLLASNVVSLAKKEQDELLGESKVT 583
            L     E+DFKPS +E+  +LE VN  LEP+R K + + + V +L  K QD+LL  S  T
Sbjct: 520  LFYSSPEEDFKPSAEEINAELEKVNASLEPLRAKLNKMTNKVYTLDAKIQDDLLSPSSAT 579

Query: 584  LNLINEAVSHAGAHALIKLSTPSVNQITIRGDDHGCKIASAAVKSIVENSSTESKITFQV 643
            L+LI E VS    +  IKL TP  N++TIRGDD   K A+ A+ SIVEN + +SKIT +V
Sbjct: 580  LHLILEDVSKEEGNLQIKLHTPEANKVTIRGDDKAVKTANKALTSIVENPTKKSKITVEV 639

Query: 644  PTNVVSRLIGPKGANLQQIREKFDVQTFIPQ--DSKDENTDVTLTGLQYNLDQAKTYILA 701
             +N ++RL+G KG+NL +IREKFD Q  +P   + KD+  ++ LTG +YNL+QAK +I A
Sbjct: 640  ASNSIARLVGTKGSNLNEIREKFDCQIDVPNHDEIKDKTAEIVLTGQEYNLEQAKKFIAA 699

Query: 702  EAKKWSDIITKELIVPMKYHRTLSGPQGTYRIRLENKYSVFIRFPKDSELVTIRGPSRGV 761
            EAKKW+DI+TKEL+VP KYH +L G  G YR RL++KYSVFI FP+DS++VTIRGPSRGV
Sbjct: 700  EAKKWADIVTKELVVPQKYHGSLIGANGVYRNRLQDKYSVFINFPRDSDIVTIRGPSRGV 759

Query: 762  KAAYDELKALLDFEIENGHKELLKVPVDYVTRVIGKSGETINDIKAEYGVELNFLDKTDS 821
            K A+ EL ALLDFE ENG+K+++ VP ++V R+IGK+G  INDI+A++GVE++FL K+  
Sbjct: 760  KQAFTELSALLDFERENGYKKIVVVPAEHVPRIIGKAGANINDIRADFGVEMDFLQKSTD 819

Query: 822  EKAKEAGEVELEITGSRSSIKEAANKVKSIIDQASNFETVTLEDIDSKYYSDIIGRSGSQ 881
             K +E GEVELEITG+R++I EAANKV+ IID+A++F++ TL  +  KY+  I+G  G  
Sbjct: 820  PKVQETGEVELEITGTRAAINEAANKVQEIIDEAADFDSETL-SVARKYHRIIVGSGGHN 878

Query: 882  LKEIISKAGGDEIRNKRVNIPDASSEDKVITIFGPSDFXXXXXXXXXXXXSGLENSITEE 941
            L++IISKAGGD+IRNK ++IP+A+SE  VIT+ GP  F               ENS+T+ 
Sbjct: 879  LRDIISKAGGDDIRNKNIDIPNANSESDVITVQGPKKFVASVLKQINKIVEDGENSVTKT 938

Query: 942  LNIPQEKFGALIGPAGSVRRELETEFKVRIHVPNKNSSDEKVTVSGSPANXXXXXXXXXX 1001
            L IP+E+ GAL+GP G +RR+LETEF V + VP+KN +   V ++G P N          
Sbjct: 939  LEIPEERHGALVGPGGMIRRQLETEFNVILEVPHKNETG-PVRITGLPENVEKAEKKILT 997

Query: 1002 XXXRDSFDLEIAVPAKYHSYVSNSGLIFQTLRNEFSIDVSHGNLTRTAQSLSRANYKVP- 1060
               RDSFD E++VPA  H +VS  G   Q LR E  ++V HGN +R A  L+R+N  +P 
Sbjct: 998  EIVRDSFDRELSVPASLHEFVSERGAFTQKLRIEEFVNVKHGNASRRATRLNRSNVVIPV 1057

Query: 1061 ENVAGGENESSNVLIQSVTET--EAKVDT----IPWRLTYSPIDLSDVLGEDYKK----- 1109
            E V     +      ++V E   E + D     IPWRLTY PID S+VL ED  +     
Sbjct: 1058 EKVRPATEDEKKEQFRAVIEEVGEPRNDKEDGDIPWRLTYEPIDFSEVLSEDSDETKEAT 1117

Query: 1110 -----DEESKDQVLEKASKLIEDRIAEAKLVNTEGFVWSKDAKKFNSIVGPNGRNIREIR 1164
                 DE  K++ L K  K+IEDR+A+A      G++W  D +KFN +VGP G NI++IR
Sbjct: 1118 PKVEIDEAKKEETLNKVVKMIEDRVAKAASSTFAGYIWCADPRKFNKVVGPGGSNIKKIR 1177

Query: 1165 NATKTVIHVPRKSDKVNNVIYV 1186
            +A   +I+VPR+SDKVN+VIYV
Sbjct: 1178 DAADVIINVPRRSDKVNDVIYV 1199

 Score = 34.3 bits (77), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 34/56 (60%)

Query: 649  SRLIGPKGANLQQIREKFDVQTFIPQDSKDENTDVTLTGLQYNLDQAKTYILAEAK 704
            ++++GP G+N+++IR+  DV   +P+ S   N  + + G +  +++A+  IL   K
Sbjct: 1163 NKVVGPGGSNIKKIRDAADVIINVPRRSDKVNDVIYVRGTKEGVEKAEALILQALK 1218

>YJL080C (SCP160) [2834] chr10 complement(285474..289142) Protein
            involved in control of mitotic chromosome transmission,
            contains 14 KH domains which are found in RNA-binding
            proteins such as Mer1p and mouse hnRNP X [3669 bp, 1222
            aa]
          Length = 1222

 Score = 1047 bits (2707), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 553/1105 (50%), Positives = 750/1105 (67%), Gaps = 25/1105 (2%)

Query: 104  AKPLRSRNIQEVFSLDLDAQYQITKTEFSSIVQSVKQKYDVSVESTLSKTSRTFLISGSS 163
            AK +RS+NIQE F+LDL +Q  ITK E S IVQSVK+ +DVSVESTLSK +RTFL+SG +
Sbjct: 101  AKRMRSKNIQEAFTLDLQSQLSITKPELSRIVQSVKKNHDVSVESTLSKNARTFLVSGVA 160

Query: 164  DKIGLAKRELVKKLTKPVNVTFEVPSKTRSAIIGSGGKTIRAISDAAGVKIVVPKEVDEG 223
              +  AKRELVKKLTKP+N   EVPSK +++IIGSGG+TIR ISDA  VKI V KEV+E 
Sbjct: 161  ANVHEAKRELVKKLTKPINAVIEVPSKCKASIIGSGGRTIREISDAYEVKINVSKEVNEN 220

Query: 224  TYDSDLEDYSVTISLHGDAESVLVAKSKILDVVKEETKNAKIVLPVEDSKLVPFIDLE-- 281
            +YD D++D +  +SL GD ESV +AK+KIL +VKEETKNA I L VED K +P+ID+   
Sbjct: 221  SYDEDMDDTTSNVSLFGDFESVNLAKAKILAIVKEETKNATIKLVVEDEKYLPYIDVSEF 280

Query: 282  -SVEIPADVKAQLFTNNDPAEIALNGPRDNVKLAKVKVINYLNELGLKIVVKKEKVPFKF 340
             S E   +VK Q +  +   +I + GPR+  K  K  + +YL +L   +  +K K+P KF
Sbjct: 281  ASDEGDEEVKVQFYKKS--GDIVILGPREKAKATKTSIQDYLKKLASNLDEEKVKIPSKF 338

Query: 341  HPLVKPSELNEKFHVEVQAPSISGDDQFVFIGSSDNVNEAIVYAKNSSKFHTVESLEISK 400
              L+   EL EK++V V  PS   D+   F+G  D V EAI YA++SSK + VESL+ISK
Sbjct: 339  QFLIDAEELKEKYNVIVTFPSTPDDELVSFVGLRDKVGEAITYARSSSKSYVVESLDISK 398

Query: 401  AHGKNVKHAKNLILYFQKYNVLDQITEDFPQVQVVLPKVESIPALESVSITLISNNDAAD 460
            AH KN+ HAKNLI+YF KY+VL  + E  P V++ LP ++S+P  E+V+I + + +D A+
Sbjct: 399  AHSKNLTHAKNLIMYFTKYSVLKGLEESHPNVKISLPSIQSLPTAETVTIHISAKSDEAN 458

Query: 461  AIKTVRKQIVALVNELSPEQTLTISDLDYHLFHKDIKQILVSTESDVPFIQLGDCFPGND 520
             IK VRK++++ VN + P +TL I+DLDY LF   IK  L+++ES V F+Q GD +P ++
Sbjct: 459  DIKAVRKELISFVNNIPPSETLVITDLDYELFGGSIKHCLLASESSVAFVQFGDYYPNDN 518

Query: 521  DILLITKINEDDFKPSDDELKVKLESVNQQLEPIRKKQSLLASNVVSLAKKEQDELLGES 580
             ILL+    ++DFKPS +E++  L   N+ L  +R KQ+ + +     +++ QD L   S
Sbjct: 519  SILLVALTEDEDFKPSIEEIQASLNKANESLNSLRTKQNNMETKTYEFSEEVQDSLFKPS 578

Query: 581  KVTLNLINEAVSHAGAHALIKLSTPSVNQITIRGDDHGCKIASAAVKSIVENSSTESKIT 640
              T  LI E +S    H  IKL TP  NQ+T+RGD+   K A+   +SI+ + S++SK+T
Sbjct: 579  SATWKLIMEDISEQEGHLQIKLHTPEENQLTVRGDEKAAKAANKIFESILNSPSSKSKMT 638

Query: 641  FQVPTNVVSRLIGPKGANLQQIREKFDVQTFIPQD-----SKDENTDVTLTGLQYNLDQA 695
              +P N V+RLIG KG+NLQQIREKF  Q  IP +     SKD+  +VTLTGL+YNL  A
Sbjct: 639  VNIPANSVARLIGNKGSNLQQIREKFACQIDIPNEENNNASKDKTVEVTLTGLEYNLTHA 698

Query: 696  KTYILAEAKKWSDIITKELIVPMKYHRTLSGPQGTYRIRLENKYSVFIRFPKDSELVTIR 755
            K Y+ AEAKKW+DIITKELIVP+K+H +L GP GTYR RL+ KY+VFI FP+D+E+VTIR
Sbjct: 699  KKYLAAEAKKWADIITKELIVPVKFHGSLIGPHGTYRNRLQEKYNVFINFPRDNEIVTIR 758

Query: 756  GPSRGVKAAYDELKALLDFEIENGHKELLKVPVDYVTRVIGKSGETINDIKAEYGVELNF 815
            GPSRGV  A++ELKALLDFE+ENGHK ++ VP ++V R+IGK+G+ INDI+AEYGVE++F
Sbjct: 759  GPSRGVNKAHEELKALLDFEMENGHKMVINVPAEHVPRIIGKNGDNINDIRAEYGVEMDF 818

Query: 816  LDKTDSEKAKEAGEVELEITGSRSSIKEAANKVKSIIDQASNFETVTLEDIDSKYYSDII 875
            L K+   KA+E GEVELEITGSR +IK+AA +V+SI+ +AS+F T  L+ ID KY+  I+
Sbjct: 819  LQKSTDPKAQETGEVELEITGSRQNIKDAAKRVESIVAEASDFVTEVLK-IDHKYHKSIV 877

Query: 876  GRSGSQLKEIISKAGGDEIRNKRVNIPDASSEDKVITIFGPSDFXXXXXXXXXXXXSGLE 935
            G  G  L+EIISKAGG+EIRNK V+IP+A SE+K IT+ GP  F               E
Sbjct: 878  GSGGHILREIISKAGGEEIRNKSVDIPNADSENKDITVQGPQKFVKKVVEEINKIVKDAE 937

Query: 936  NSITEELNIPQEKFGALIGPAGSVRRELETEFKVRIHVPNKNSSDEKVTVSGSPANXXXX 995
            NS+T+ ++IP E+ GALIGP G VRR+LE+EF + + VPNK+    K+T++G+P N    
Sbjct: 938  NSVTKTIDIPAERKGALIGPGGIVRRQLESEFNINLFVPNKDDPSGKITITGAPENVEKA 997

Query: 996  XXXXXXXXXRDSFDLEIAVPAKYHSYVSNSGLIFQTLRNEFSIDVSHGNLTRTAQSLSRA 1055
                     R++FD E+ VPA  + YVS  G   Q LR + S++V  GN ++ A  L+RA
Sbjct: 998  EKKILNEIIRENFDREVDVPASIYEYVSERGAFIQKLRMDLSVNVRFGNTSKKANKLARA 1057

Query: 1056 NYKVP-ENVAG---GEN-ESSNVLIQSV-TETEAKVDTIPWRLTYSPIDLSDVL--GE-- 1105
              ++P E V G   GEN E +   I+ V   T ++   I  RLTY PIDLS +L  GE  
Sbjct: 1058 PIEIPLEKVCGSTEGENAEKTKFTIEEVGAPTSSEEGDITMRLTYEPIDLSSILSDGEEK 1117

Query: 1106 ----DYKKDEESKDQVLEKASKLIEDRIAEAKLVNTEGFVWSKDAKKFNSIVGPNGRNIR 1161
                D   D   K++ L+ A KLI++RIA+A      G+VW  D ++FN IVGP G NI+
Sbjct: 1118 EVTKDTSNDSAKKEEALDTAVKLIKERIAKAPSATYAGYVWGADTRRFNMIVGPGGSNIK 1177

Query: 1162 EIRNATKTVIHVPRKSDKVNNVIYV 1186
            +IR A   +I+VPRKSDKVN+V+Y+
Sbjct: 1178 KIREAADVIINVPRKSDKVNDVVYI 1202

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 39/73 (53%)

Query: 633  SSTESKITFQVPTNVVSRLIGPKGANLQQIREKFDVQTFIPQDSKDENTDVTLTGLQYNL 692
            S+T +   +   T   + ++GP G+N+++IRE  DV   +P+ S   N  V + G +  +
Sbjct: 1150 SATYAGYVWGADTRRFNMIVGPGGSNIKKIREAADVIINVPRKSDKVNDVVYIRGTKAGV 1209

Query: 693  DQAKTYILAEAKK 705
            ++A   +L   ++
Sbjct: 1210 EKAGEMVLKSLRR 1222

>Kwal_14.2397
          Length = 1206

 Score = 1026 bits (2654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/1100 (49%), Positives = 739/1100 (67%), Gaps = 19/1100 (1%)

Query: 97   RASSPG-SAKPLRSRNIQEVFSLDLDAQYQITKTEFSSIVQSVKQKYDVSVESTLSKTSR 155
            R+++P  SAKP RS+ IQE FSLDL +Q  ++K +FS I+Q +K  + VSVESTLSK+SR
Sbjct: 96   RSTTPALSAKPARSKTIQEAFSLDLQSQISMSKPDFSRIIQGIKTTHSVSVESTLSKSSR 155

Query: 156  TFLISGSSDKIGLAKRELVKKLTKPVNVTFEVPSKTRSAIIGSGGKTIRAISDAAGVKIV 215
            TFLI G    +  A+RE+VKKLTKPV VT EVPSKTRSAIIG+GGK IR IS+   V+I 
Sbjct: 156  TFLIFGKPQDVKAARREIVKKLTKPVTVTIEVPSKTRSAIIGAGGKKIREISEPLEVRID 215

Query: 216  VPKEVDEGTYDSDLEDYSVTISLHGDAESVLVAKSKILDVVKEETKNAKIVLPVEDSKLV 275
            + KE+ E TYD DL+D  V +S+HGD ESV +A+ KI  +VKE+TKNA I + VED  LV
Sbjct: 216  IGKEIKEDTYDEDLDDSMVDVSIHGDLESVRIAQQKISAIVKEDTKNASIQVNVEDKNLV 275

Query: 276  PFIDLESVEIPADVKAQLFTNNDPAEIALNGPRDNVKLAKVKVINYLNELGLKIVVKKEK 335
            PFI+LE +++P D K     N    +I L+G RD V+ AK  ++ YL EL  +I   K K
Sbjct: 276  PFINLEGLKLPVDAK----FNTASGQIQLSGLRDEVQAAKANILQYLRELSSQIKTLKVK 331

Query: 336  VPFKFHPLVKPSELNEKFHVEVQAPSISGDDQFVFIGSSDNVNEAIVYAKNSSKFHTVES 395
            +P KF  L+  SE+ EKF+V V  P+ +G ++  F+G + +++EA+ +A+ +SK + VES
Sbjct: 332  IPVKFQFLIDESEIKEKFNVTVHLPT-AGGEEVSFVGPAVHLDEAVSFARENSKKYIVES 390

Query: 396  LEISKAHGKNVKHAKNLILYFQKYNVLDQITEDFPQVQVVLPKVESIPALESVSITLISN 455
            LEISKAHGKNV HAKN+ +YF+ YNVL+ I + FP V+  +P  + +   ++V+I + + 
Sbjct: 391  LEISKAHGKNVAHAKNIAIYFEIYNVLEPIKKAFPNVRFAIPSPQELQDADAVAIRISTT 450

Query: 456  NDAADAIKTVRKQIVALVNELSPEQTLTISDLDYHLFHKDIKQILVSTESDVPFIQLGDC 515
            ++ AD +KTVRK I+ LVNEL   Q L + DLDY L+ KDIK +L+  + +  F+QLGD 
Sbjct: 451  SENADDLKTVRKDIINLVNELPTSQVLVVEDLDYELYSKDIKHLLLQQQQNADFVQLGDF 510

Query: 516  FPGNDDILLITKINEDDFKPSDDELKVKLESVNQQLEPIRKKQSLLASNVVSLAKKEQDE 575
            FPGND ILL  +++++DF+PSDDELK  L  VN  LEP+R KQS L+  +  +  ++QD 
Sbjct: 511  FPGNDKILLFARLSDEDFRPSDDELKQTLADVNSALEPLRAKQSNLSLKIFEIPSEKQDA 570

Query: 576  LLGESKVTLNLINEAVSHAGAHALIKLSTPSVNQITIRGDDHGCKIASAAVKSIVENSST 635
                S  T  LI + ++  G HA  KL  P+ +Q+TIRGD    K+A+AA++SIV NS  
Sbjct: 571  FFKPSTFTRELIEQDIATEGGHAQFKLHAPTADQLTIRGDTKAVKVATAAIESIVANSGE 630

Query: 636  ESKITFQVPTNVVSRLIGPKGANLQQIREKFDVQTFIPQDSKDENTDVTLTGLQYNLDQA 695
            + +  F V +N V RLIG KGANL  IREK+     + Q+S    T+VT+TGL+Y+++ A
Sbjct: 631  KFETKFAVSSNSVPRLIGSKGANLNAIREKYQCNIDVAQESSGNQTEVTVTGLKYSVEHA 690

Query: 696  KTYILAEAKKWSDIITKELIVPMKYHRTLSGPQGTYRIRLENKYSVFIRFPK--DSELVT 753
            K Y+L+E+KKW+D+ITKEL V  KY   L G QGTYR RL+ KYSV I FP   ++E VT
Sbjct: 691  KAYLLSESKKWADVITKELNVLPKYRGRLIGSQGTYRNRLQTKYSVHIHFPMEGENEGVT 750

Query: 754  IRGPSRGVKAAYDELKALLDFEIENGHKELLKVPVDYVTRVIGKSGETINDIKAEYGVEL 813
            IRGPSRGV  AYDELKALLDFEIENGH  ++ VP ++V R+IGK+G+ INDI+A+ GVEL
Sbjct: 751  IRGPSRGVAKAYDELKALLDFEIENGHTSIITVPTEHVPRIIGKNGDNINDIRADCGVEL 810

Query: 814  NFLDKTDSEKAKEAGEVELEITGSRSSIKEAANKVKSIIDQASNFETVTLEDIDSKYYSD 873
            +FL KT   KA E G+VELEITGSR +IKEA  KV++I+ +AS+ ET + E ++ KY  D
Sbjct: 811  DFLQKTTDPKAVETGKVELEITGSRQAIKEATQKVEAIVKEASDVETESFE-VNPKYIRD 869

Query: 874  IIGRSGSQLKEIISKAGGDEIRNKRVNIPDASSEDKVITIFGPSDFXXXXXXXXXXXXSG 933
            I+G  G  LK +ISKAGGDEIRNK V+IPDA+S+DK ITI GP  F              
Sbjct: 870  IVGAGGRVLKSLISKAGGDEIRNKSVDIPDANSQDKKITIQGPHAFVQTMVKEIKLIIKE 929

Query: 934  LENSITEELNIPQEKFGALIGPAGSVRRELETEFKVRIHVPNKNSSDEKVTVSGSPANXX 993
             E+S+ +EL++P ++ GALIGP G VRR+LE+EF +++ +P+      KV + G P N  
Sbjct: 930  REDSVEKELDVPADRVGALIGPGGMVRRQLESEFNIKLSLPDIGDKSSKVKILGLPDNIA 989

Query: 994  XXXXXXXXXXXRDSFDLEIAVPAKYHSYVSNSGLIFQTLRNEFSIDVSHGNLTRTAQSLS 1053
                       RDS D E+ VPA  H +VS  G + Q LR+++ ++V  GN    A  L+
Sbjct: 990  ACEKKIFTQLIRDSCDAEVQVPASLHEFVSEKGALIQRLRSDYFVNVRFGNSNGKANKLA 1049

Query: 1054 RANYKVPENVAGGENESSNVLIQSVTE-----TEAKVDTIPWRLTYSPIDLSDVLGEDYK 1108
            R+N  +P   A G  E S   I+  TE      E     IPWRL+Y P+DLSD+L E+ K
Sbjct: 1050 RSNLNIPVEKATGTAEES---IKFTTEEIPLAIEESQGFIPWRLSYEPVDLSDILTEEEK 1106

Query: 1109 KDEE--SKDQVLEKASKLIEDRIAEAKLVNTEGFVWSKDAKKFNSIVGPNGRNIREIRNA 1166
             +E+   K++VLE   KLI+DRI  A   +T G++WS  + +F  +VG  G NI++IR A
Sbjct: 1107 ANEKEPKKEEVLETVEKLIKDRIELATKASTVGYLWSSKSSEFRKVVGSMGSNIKKIREA 1166

Query: 1167 TKTVIHVPRKSDKVNNVIYV 1186
            T T+I+VP+K+DKV+++IY+
Sbjct: 1167 TGTLINVPKKNDKVSDIIYI 1186

>CAGL0M03223g complement(366828..370457) similar to sp|P06105
            Saccharomyces cerevisiae YJL080c SCP160 required for
            maintenance of exact ploidy, hypothetical start
          Length = 1209

 Score =  959 bits (2480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 517/1103 (46%), Positives = 724/1103 (65%), Gaps = 22/1103 (1%)

Query: 99   SSPGSAKPLRSRNIQEVFSLDLDAQYQITKTEFSSIVQSVKQKYDVSVESTLSKTSRTFL 158
            +S  SA  +RS NIQE F+LDL +Q  +TK E S I+Q+VKQ  +VSVESTLS+ SRTFL
Sbjct: 94   ASATSAGRMRSNNIQETFTLDLQSQLSVTKLELSRILQTVKQANNVSVESTLSRNSRTFL 153

Query: 159  ISGSSDKIGLAKRELVKKLTKPVNVTFEVPSKTRSAIIGSGGKTIRAISDAAGVKIVVPK 218
            ISG + K+  AKREL+K LT+P+    EVPS+ ++ IIGSGGK IR ISD   VKI + K
Sbjct: 154  ISGPAPKVKEAKRELIKMLTRPITENIEVPSRCKAVIIGSGGKNIREISDRYDVKIHISK 213

Query: 219  EVDEGTYDSDLEDYSVTISLHGDAESVLVAKSKILDVVKEETKNAKIVLPVEDSKLVPFI 278
            E    +Y+ DL+D    IS+ GD ESV  AK+KIL +V E+ KN    L VEDS L  F+
Sbjct: 214  EPKPDSYNEDLDDDLSDISIFGDFESVKQAKAKILSIVNEDLKNITARLSVEDSTLGSFV 273

Query: 279  DLESVEIPADVKAQLFTNNDPAEIALNGPRDNVKLAKVKVINYLNELGLKIVVKKEKVPF 338
            +++ V    DVK Q +   D     + G  D++K AK K+ +YL +L  ++  +  K+P 
Sbjct: 274  NVKEVS-SDDVKVQYY--QDTGSFTITGSLDDIKNAKTKIKDYLQKLSNELAEENVKIPS 330

Query: 339  KFHPLVKPSELNEKFHVEVQAPSISGDDQFVFIGSSDNVNEAIVYAKNSSKFHTVESLEI 398
            KF  L+   E+ ++F V V+ P  S D+   F G  D V EAI +A+ SSK + V+SL+I
Sbjct: 331  KFQFLIDADEVKDRFGVIVKFPKSSSDETVQFAGLKDKVAEAISFARTSSKQYIVDSLDI 390

Query: 399  SKAHGKNVKHAKNLILYFQKYNVLDQITEDFPQVQVVLPKVESIPALESVSITLISNNDA 458
            SKAH KN+ HAK L++YFQKYNVLD++ E+FP V+ VLP +E +   + V I L + ND 
Sbjct: 391  SKAHNKNLDHAKRLVIYFQKYNVLDKVAEEFPDVKYVLPSIEDLQNAKEVFIYLSAKNDK 450

Query: 459  ADAIKTVRKQIVALVNELSPEQTLTISDLDYHLFHKDIKQILVSTESDVPFIQLGDCFPG 518
               IK  R++I+A+VN+++P +TL I DLDY LFH++IK IL+  ES+  FIQ+GD F G
Sbjct: 451  TSEIKAARREIIAIVNDITPAETLVIDDLDYELFHRNIKHILLGHESEAKFIQIGDYFKG 510

Query: 519  NDDILLITKINEDDFKPSDDELKVKLESVNQQLEPIRKKQSLLASNVVSLAKKEQDELLG 578
            +D ++L     ++DFKPS DE+K  LE VN  L  +RKKQ+ L      L  ++QDE  G
Sbjct: 511  DDSVVLFATSTDEDFKPSTDEIKESLEKVNANLNDLRKKQNSLEVATYDLESEKQDEFFG 570

Query: 579  ESKVTLNLINEAVSHAGAHALIKLSTPSVNQITIRGDDHGCKIASAAVKSIVENSSTESK 638
            +  V L LI E +S    H  IKL +P  N++T+RGD+   K A+  +KSIVEN ST +K
Sbjct: 571  KDSVALKLILEDISGDDGHIQIKLHSPEKNKMTLRGDERAVKKANKDIKSIVENPSTTAK 630

Query: 639  ITFQVPTNVVSRLIGPKGANLQQIREKFDVQTFIPQDS---KDENTDVTLTGLQYNLDQA 695
            IT +VP   VSRLIG KGANLQ++R K++    IPQ     +D+  ++T+ GLQ+ ++ A
Sbjct: 631  ITVEVPVASVSRLIGNKGANLQKLRNKYNCSIDIPQQGESDQDKTVEITIKGLQFIIEHA 690

Query: 696  KTYILAEAKKWSDIITKELIVPMKYHRTLSGPQGTYRIRLENKYSVFIRFPKDSELVTIR 755
            K  I  EAK+ +DI+TKEL+   KYHR LSGPQG YR RL+ KY+VFI F K++  +TI+
Sbjct: 691  KKDIANEAKRLADIVTKELVAQAKYHRNLSGPQGMYRTRLQEKYNVFINFLKENNTITIK 750

Query: 756  GPSRGVKAAYDELKALLDFEIENGHKELLKVPVDYVTRVIGKSGETINDIKAEYGVELNF 815
            GPSRGV  AYDELKALLDFE+ENGHK ++ VPV++++R+IGK+G+TIN +  E+GVEL+F
Sbjct: 751  GPSRGVNKAYDELKALLDFEMENGHKTIVNVPVEHMSRIIGKNGDTINGLSDEFGVELDF 810

Query: 816  LDKTDSEKAKEAGEVELEITGSRSSIKEAANKVKSIIDQASNFETVTLEDIDSKYYSDII 875
            L K+D  KA E G VELEITG+R++IKEA+ K+ +I+ +A++  T  L DID KY+  I+
Sbjct: 811  LQKSDDPKAVETGVVELEITGNRNAIKEASTKIAAIVSEAADHVTEKL-DIDRKYHKTIV 869

Query: 876  GRSGSQLKEIISKAGGDEIRNKRVNIPDASSEDKVITIFGPSDFXXXXXXXXXXXXSGLE 935
            G  G  L+EIIS AGGDE+R + V+IP+A SE  +ITI GP  F               +
Sbjct: 870  GAGGHTLREIISNAGGDEVRGRAVDIPNADSESSIITIQGPKKFVSNVVKAINKIVEESQ 929

Query: 936  NSITEELNIPQEKFGALIGPAGSVRRELETEFKVRIHVPNKNSSDEKVTVSGSPANXXXX 995
            NSIT+++ +P E+ GALIGP G VR++LE+EF ++++VP ++  + +V+++G P N    
Sbjct: 930  NSITKKIEVPGERLGALIGPGGIVRKQLESEFNIQLYVPKRDEEETRVSLTGLPENIEKA 989

Query: 996  XXXXXXXXXRDSFDLEIAVPAKYHSYVSNSGLIFQTLRNEFSIDVSHGNLTRTAQSLSRA 1055
                     RD+FDLEI VPA   +YVS+ G + Q LR E  ++V +GN T+ A +L+R 
Sbjct: 990  EKKIFTEIIRDNFDLEIMVPANVQNYVSDRGNLPQRLRLEKFVNVRYGNATKKANNLNRT 1049

Query: 1056 NYKVP-ENVAGGENESSNVLIQ----SVTETEAKVD-TIPWRLTYSPIDLSDVLGEDYKK 1109
               +P E VAG E E     ++    SV E    VD  IPWRL Y PID   +L E+  +
Sbjct: 1050 PVDIPYEKVAGAEGEKVKFTVEETGPSVVEN---VDGEIPWRLIYEPIDFDSILDEENGE 1106

Query: 1110 ------DEESKDQVLEKASKLIEDRIAEAKLVNTEGFVWSKDAKKFNSIVGPNGRNIREI 1163
                  DE  K Q+L++A ++IE+RI +A      G+VW+ D  KF  +VG  G N+++I
Sbjct: 1107 KKEASVDENKKQQLLKEAKEIIENRINDAPNATYSGYVWTSDPSKFFKVVGMGGSNVKKI 1166

Query: 1164 RNATKTVIHVPRKSDKVNNVIYV 1186
            R +T  +++VP+KSDK+NNVI++
Sbjct: 1167 RESTNCIVYVPKKSDKINNVIFI 1189

 Score = 31.6 bits (70), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 14/56 (25%), Positives = 33/56 (58%)

Query: 650  RLIGPKGANLQQIREKFDVQTFIPQDSKDENTDVTLTGLQYNLDQAKTYILAEAKK 705
            +++G  G+N+++IRE  +   ++P+ S   N  + + G + N+++A   I+   K+
Sbjct: 1154 KVVGMGGSNVKKIRESTNCIVYVPKKSDKINNVIFIKGAKENVEKAGEAIIKSLKQ 1209

>AFL018C [3175] [Homologous to ScYBR233W (PBP2) - SH]
           (402853..404031) [1179 bp, 392 aa]
          Length = 392

 Score = 37.4 bits (85), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 67/146 (45%), Gaps = 16/146 (10%)

Query: 780 HKELLKVPVDYVTRVIGKSGETINDIKAEYGVELNFLDKTDSEKAKEAGEVELEITGSRS 839
           H  +L + V   + V+G  GE I+ IK E G  +N      SE  K   E  + + GS  
Sbjct: 49  HMRMLCL-VKDASMVVGHKGERISRIKLETGTRINV-----SENIKNVPERVVFLRGSCE 102

Query: 840 SIKEAANKVKSII----DQASNFETVTLED---IDSKYYSDIIGRSGSQLKEIISKAGGD 892
           ++ +A  K+   I    D+ SN  ++ L     +       +IG+ GS+L+EI   +   
Sbjct: 103 NVAKAFGKISRAINDEDDRESNDRSLPLTVNLLVPHHLMGYVIGKQGSRLREIEDLSAAR 162

Query: 893 EIRNKRVNIPDASSEDKVITIFGPSD 918
            +   +  +P   S D+V+ I G +D
Sbjct: 163 LVAGPQ-QLP--LSNDRVLCITGVAD 185

>Kwal_27.12486
          Length = 299

 Score = 37.0 bits (84), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 65/269 (24%), Positives = 107/269 (39%), Gaps = 62/269 (23%)

Query: 775 EIEN----GHKELLKVPVDYVTRVIGKSGETINDIKAEYGVELNFLDKTDSEKAKEAGEV 830
           E+EN     H+ L  V +    R+IG  G TI  I+    V++       S   +   + 
Sbjct: 3   ELENQDTISHRVL--VSLKEAARIIGAQGMTIQKIRESSNVKIGI-----SPHERGCSDR 55

Query: 831 ELEITGSRSSIKEAANKVKSIIDQAS-----------NF-----ETVTLED--------- 865
            L  +GS  ++  A   V  +++Q             NF       V ++D         
Sbjct: 56  ILSCSGSAQAVANAIGDVVEVLNQDESEPETHSYKPLNFILPRPSEVEIQDPESAKRIGN 115

Query: 866 ----IDSKYYSDIIGRSGSQLKEIISKAGGDEIRNKRVNIPDASSEDKVITIFG-PSDFX 920
               + +   S IIG  GS++K +I K G   + +K   +PD  S+D+V+ I G P    
Sbjct: 116 LRLIVSNSQVSSIIGTQGSRIKALIEKHGVKVVASKNF-LPD--SQDRVVEIQGFPGSIA 172

Query: 921 XXXXXXXX----------------XXXSGLENSITEELNIPQEKFGALIGPAGSVRRELE 964
                                      S  E S+T+E+ IP E  GAL+G  G+    L 
Sbjct: 173 SCIIEISELLATETKPSHEKQYYPHTKSQEEGSVTKEVAIPVEFVGALLGRGGNRVSSLR 232

Query: 965 TEFKVRIHVPNK-NSSDEKV-TVSGSPAN 991
              K ++ V ++ N  + +V T++G+  N
Sbjct: 233 KYTKTKVIVSDEPNEENNRVFTITGNNQN 261

>KLLA0E00847g complement(87991..90132) some similarities with
           sgd|S0003955 Saccharomyces cerevisiae YLL032c,
           hypothetical start
          Length = 713

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 36/75 (48%), Gaps = 15/75 (20%)

Query: 712 KELIVPMKYHRTLSGPQGTYRIRLENKYSVFIRFPKDSEL------------VTIRGPSR 759
           K   +P  YHR + G  G+    +  KY+VFI+F    +L            V IR PS+
Sbjct: 449 KSFFIPEAYHRPVIGTGGSVIQTIMRKYNVFIQFSNSFQLPQGDWTFTRYDNVIIRCPSK 508

Query: 760 ---GVKAAYDELKAL 771
               ++AA ++L +L
Sbjct: 509 NTINIEAAKEQLLSL 523

>Scas_667.6
          Length = 378

 Score = 35.0 bits (79), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 24/38 (63%)

Query: 182 NVTFEVPSKTRSAIIGSGGKTIRAISDAAGVKIVVPKE 219
           N+   VP++  S+IIG GG  I+A+ +  GVKIV  K 
Sbjct: 158 NLRLIVPNRHLSSIIGKGGVRIKALIETYGVKIVASKH 195

>CAGL0L00297g 30464..34621 similar to sp|P23255 Saccharomyces
            cerevisiae YCR042c TSM1, hypothetical start
          Length = 1385

 Score = 35.0 bits (79), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 37/66 (56%), Gaps = 4/66 (6%)

Query: 1007 SFDLEIAVPAKYHSYVSNSGLIFQTLRNEFSIDVSHGNLTRTAQSLSRANYKVPENVAGG 1066
            ++++EI++P   H  +  S L  +  RN+F  D ++  L++ AQ      Y V EN+A  
Sbjct: 233  TWEIEISIPKTVHDLIKESRLSERLARNKFGSDDTNTLLSKAAQE----EYDVEENLANE 288

Query: 1067 ENESSN 1072
            E+E+ N
Sbjct: 289  ESENDN 294

>AER186C [2688] [Homologous to ScYBL032W (HEK2) - SH]
           (982057..983007) [951 bp, 316 aa]
          Length = 316

 Score = 33.9 bits (76), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 56/253 (22%), Positives = 99/253 (39%), Gaps = 66/253 (26%)

Query: 793 RVIGKSGETINDIKAEYGVELNFLDKTDSEKAKEAGEVELEITGSRSSIKEA-ANKVKSI 851
           R++G+ G TI++I+   GV++       S K K   +  LE+TGS  ++  + A+ VK +
Sbjct: 46  RILGRGGNTIDNIRKANGVKIGI-----STKEKSCSDRLLEVTGSIDAVANSLADVVKVL 100

Query: 852 IDQASNFETVTLED-----------------------------------IDSKYYSDIIG 876
               +N E    E                                    + +   S IIG
Sbjct: 101 TADDTNEEDAEPEPEQHIFKHLNFILPPPSPDEAEDPMKVKQIGNLRLIVTNSQVSSIIG 160

Query: 877 RSGSQLKEIISKAGGDEIRNKRVNIPDASSEDKVITIFG-PSDFXXXXXXXXXX------ 929
            +GS++K++I       + +K   +PD  S+D+++ I G P+                  
Sbjct: 161 TAGSKIKKLIDTHSSKLVVSKTF-LPD--SQDRILEIQGFPNSIANCIKDISQTLIKDDV 217

Query: 930 -----------XXSGLENSITEELNIPQEKFGALIGPAGSVRRELETEFKVRIHV---PN 975
                           +  +T  + IP E  GAL+G  G+    L    + +I V   PN
Sbjct: 218 LDTKEKRYYPHSKHSKDIHVTATVAIPAEYVGALLGHGGNRIANLRKYTRTKITVAQEPN 277

Query: 976 KNSSDEKVTVSGS 988
           +N+  E  T++G+
Sbjct: 278 QNNERE-FTITGN 289

>Kwal_23.4035
          Length = 520

 Score = 33.9 bits (76), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 30/144 (20%), Positives = 66/144 (45%), Gaps = 18/144 (12%)

Query: 266 VLPVEDSKLVPFIDLESVEIPADVKAQLFTNNDPAEIALNGPRDNVKLAKVKVINYLNEL 325
           ++P E+  + P  D+    I   + A + T+  PA IA +               YLN +
Sbjct: 142 LIPCENCGITPDFDM----IENSITAVVDTSAQPASIACSA------------CTYLNPI 185

Query: 326 GLK-IVVKKEKVPFKFHPLVKPSELNEKFHVEVQAPSISGDDQFVFIGSSDNVNEAIVYA 384
            L+   +   ++P K   L  PS  +++  +E+++     +D  +F+  S  +++ ++++
Sbjct: 186 ALRNCEMCGNRLPVKEGALEMPSPPDKRVKIELESNDGLSEDSRIFVQLSFRMSDGVLFS 245

Query: 385 KNSSKFH-TVESLEISKAHGKNVK 407
           +  S+   T E  ++ K + K  K
Sbjct: 246 QTISELLVTQERAKVEKVYNKGAK 269

>Scas_515.6
          Length = 342

 Score = 33.5 bits (75), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 30/60 (50%), Gaps = 5/60 (8%)

Query: 710 ITKELIVPMKYHRTLSGPQGTYRIRLENKYSVFIRF--PKDSE---LVTIRGPSRGVKAA 764
           ITK +  P KY   + G +GTY   L    S  IR   P D E   +++IRGP   V AA
Sbjct: 266 ITKVVTYPDKYSSKVIGREGTYINMLRESTSCSIRLKSPDDKEDLAIISIRGPPLCVDAA 325

>KLLA0F10703g complement(984298..985551) similar to sp|P38151
           Saccharomyces cerevisiae YBR233w PBP2 PAB1 binding
           protein singleton, hypothetical start
          Length = 417

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 44/101 (43%), Gaps = 12/101 (11%)

Query: 792 TRVIGKSGETINDIKAEYGVELNFLDKTDSEKAKEAGEVELEITGSRSSIKEAANKVKSI 851
           ++V+G  GE +N IK+E    +N  D  +        E  + + G    +  A  K+   
Sbjct: 79  SKVVGGKGERVNRIKSETNTRINVSDNING-----VMERVIFVRGKCEEVARAFGKIVRA 133

Query: 852 I----DQASNFETVTLED---IDSKYYSDIIGRSGSQLKEI 885
           I    D  SN  ++ L     I   +   IIGR GS+L EI
Sbjct: 134 INNESDDDSNERSLPLVVNLLIPHHFMGCIIGRQGSRLHEI 174

>CAGL0G04037g 383068..385404 similar to tr|Q07834 Saccharomyces
           cerevisiae YLL032c, hypothetical start
          Length = 778

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 48/202 (23%), Positives = 83/202 (41%), Gaps = 23/202 (11%)

Query: 631 ENSSTESKITFQVPTNVVSRLIGPKGANLQQIREKFDVQTFIPQDSKDENTDVTLTGLQY 690
           E+   E K  F++  +    + G K   L +I EK   Q  +  +  D+N  +++   + 
Sbjct: 377 ESQIEELKAIFEIHPDYDDFISGKKNGKLTRIMEKSQAQLDLNFEEDDKNMFLSIISNKV 436

Query: 691 -NLDQAKTYILAEAKKWSDIITKELIVPMKYHRTLSGPQGTYRIRLENKYSVFIRFPKDS 749
            NL+ A T +L E             +P  YHR   G  G+       K++VFI+F    
Sbjct: 437 NNLESAFTLLLDELP-----CEGTFFIPEVYHRPAIGSGGSIIQTTMRKHNVFIQFSNTF 491

Query: 750 EL------------VTIRGP---SRGVKAAYDELKALL-DFEIENGHKELLKVPVDYVTR 793
            L            V IR P    +G+  A ++LK L+ ++  +     +   P  Y   
Sbjct: 492 LLPQSGLSFVRFDNVIIRCPFKNRKGIDLAIEDLKVLIQEYSEQQPSTNIRLSPAQY-KH 550

Query: 794 VIGKSGETINDIKAEYGVELNF 815
           V+ +   TI  ++ +  V L+F
Sbjct: 551 VLFEHINTIGHLEKQNNVFLDF 572

>YBR249C (ARO4) [428] chr2 complement(716839..717951)
            2-Dehydro-3-deoxyphosphoheptonate aldolase
            (3-deoxy-D-arabino-heptulosonate-7-phosphate synthase or
            DAHP synthase), inhibited by tyrosine [1113 bp, 370 aa]
          Length = 370

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 25/44 (56%)

Query: 1034 NEFSIDVSHGNLTRTAQSLSRANYKVPENVAGGENESSNVLIQS 1077
            N   ID SHGN  +  ++  + N  V E +A GEN  + V+I+S
Sbjct: 274  NGLMIDYSHGNSNKDFRNQPKVNDVVCEQIANGENAITGVMIES 317

>Kwal_55.20652
          Length = 694

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 63/305 (20%), Positives = 120/305 (39%), Gaps = 24/305 (7%)

Query: 594 AGAHALIKLSTPSVNQITIRGDDHGCKIASAAVKSIVENSSTESKITFQVPTNVVSRLIG 653
           +GA+ +I     +V  + + G+ H        ++ +      + K   ++  +    + G
Sbjct: 332 SGANVIILQPQCTVFSVVLVGNSHDVLKCLHFMEVLCSEMEVQIKFLVELYPDYKDFISG 391

Query: 654 PKGANLQQIREKFDVQTFIPQDSKDENTDVTLTGLQYNLDQAKTYILAEAKKWSDIITKE 713
            K   + +I +       +       N  +TLT   +    A   +L E    ++I    
Sbjct: 392 KKNGKISRITDNAKCVLSLEFQEDQSNMLITLTSNSFAAANAGINLLGEELP-AEI---S 447

Query: 714 LIVPMKYHRTLSGPQGTYRIRLENKYSVFIRFPKDSEL------------VTIRGPSRGV 761
             +P  YHR + G  G+    +  +++VFI+F    +L            V IR PS+  
Sbjct: 448 FFIPEAYHRPVIGTGGSVIQTIMRRFNVFIQFSNTFQLPQNDFGLTRHNNVVIRCPSKNR 507

Query: 762 KA---AYDELKALLDFEIENGHKELLKVPVDYVTRVIGKSGETINDIKAEYGVELNFLDK 818
           K+   A  EL  L++       K  L+                 +++ AE   +     K
Sbjct: 508 KSISQAKKELMRLVNEYSNQQPKTCLRFSPGQYRFYFQDCNHFKHNLIAELEKKTGVYIK 567

Query: 819 TDSEKAKEAGEVELEITGSRSSIKEAANKVKSIIDQASNFETVTLEDI-DSKYYSDIIGR 877
             +E  K+  E  LEI GS  + K AA+++      AS  E V  +++ D+  +++I+  
Sbjct: 568 FPTELPKK--EWSLEIRGSEQNSKNAASEMAKTF--ASEREIVMSDNLTDTLNFTNIVVA 623

Query: 878 SGSQL 882
           S  +L
Sbjct: 624 SLQRL 628

>Scas_597.13
          Length = 372

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 24/44 (54%)

Query: 1034 NEFSIDVSHGNLTRTAQSLSRANYKVPENVAGGENESSNVLIQS 1077
            N   ID SHGN  +  ++  + N  V E +A GEN    V+I+S
Sbjct: 274  NGLMIDYSHGNSNKDFRNQPKVNDAVCEQIANGENAIIGVMIES 317

>KLLA0D01067g complement(94114..96096) similar to sp|P39923
           Saccharomyces cerevisiae YEL062w NPR2 nitrogen permease
           regulator singleton, start by similarity
          Length = 660

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 37/74 (50%), Gaps = 4/74 (5%)

Query: 218 KEVDEGTYDSDLEDYSVTISLHGDAESVLVAKSKILDVVKEETKNAKIVLPVEDSKLVPF 277
           K  D    D   E  S+TIS H D +S      K L+++KE  KN K ++ +ED  +  F
Sbjct: 138 KSNDSNAADQSTEMGSITISEHTDIKSTGDDGEKYLEIIKELAKNQKSLI-IEDLLMKLF 196

Query: 278 IDLESVE---IPAD 288
           +DL +     IP D
Sbjct: 197 LDLNNYSECLIPID 210

>Scas_693.28
          Length = 2447

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 72/141 (51%), Gaps = 11/141 (7%)

Query: 1033 RN-EFSIDVSHGNL--TRTAQSLSRANYKVPENVAGGENESSN-VLIQSVTETEAKVDTI 1088
            RN +FSI++S   L   R  Q++++   K  E+    ENE  N  L +++ E     DT 
Sbjct: 67   RNADFSIELSENLLKECRKLQAINQEKSKALED-KTKENEKINEKLNKALKEYRNSKDT- 124

Query: 1089 PWRLTYSPIDLSDVLGEDYKKDEESKDQVLEKASKLIEDRIAEAKLVNTE--GFVWSKDA 1146
             W L    +D+S+   +  K D + KD  LEK +K + D++AE + +N E  G +   + 
Sbjct: 125  NWELENKLMDISNQFKQ-VKNDLKIKDLELEKINKSLNDKMAEVEKINLEKDGLINKSNV 183

Query: 1147 KK--FNSIVGPNGRNIREIRN 1165
            ++  F + +    RNI ++ +
Sbjct: 184  ERTSFQNEIKSLKRNISDLND 204

>AGL111W [4201] [Homologous to ScYDR195W (REF2) - SH]
           complement(498099..499514) [1416 bp, 471 aa]
          Length = 471

 Score = 31.6 bits (70), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 3/50 (6%)

Query: 738 KYSVFIRFPKDSELVTIRG---PSRGVKAAYDELKALLDFEIENGHKELL 784
           K    IRF  DS+LVT+ G   P  GV  + D LK +L+  +E   +E L
Sbjct: 298 KKRAVIRFVDDSKLVTVFGDDLPESGVVTSPDRLKKILNPYVEGEPREFL 347

>Sklu_2360.5 YDR035W, Contig c2360 14257-15375
          Length = 372

 Score = 31.2 bits (69), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 45/100 (45%), Gaps = 11/100 (11%)

Query: 1038 IDVSHGNLTRTAQSLSRANYKVPENVAGGENESSNVLIQSVTETEAKVDTIP----WRLT 1093
            ID SHGN ++  ++  +    + + +  GEN    V+I+S    E + D  P      L 
Sbjct: 279  IDCSHGNSSKDFRNQPKVAQSIYDQLTAGENAICGVMIES-NLVEGRQDVPPEGGREGLK 337

Query: 1094 YSPIDLSDVLGEDYKKDEESKDQVLEKASKLIEDRIAEAK 1133
            Y        +G       ES +QVLE  +K +++R A  K
Sbjct: 338  YGCSITDACIG------WESTEQVLELLAKGVQNRRATLK 371

>YIL112W (HOS4) [2564] chr9 (151592..154843) Component of Set3p
           complex that has histone deacetylase activity and a role
           in repression of meiotic-specific sporulation gene
           expression, contains ankyrin repeats [3252 bp, 1083 aa]
          Length = 1083

 Score = 30.8 bits (68), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 37/71 (52%), Gaps = 3/71 (4%)

Query: 188 PSKTRSAIIGSGGKTIRAISDAAGVKIVVPKEVDEGTYDSDLEDYSVTISLHGDAESVLV 247
           P + +     SGG+T   I+   G   VV K ++EG YD + +D +   +LH   E+ L 
Sbjct: 318 PKQKKGIYRDSGGRTRLQIACDKGKYDVVKKMIEEGGYDINDQDNAGNTALH---EAALQ 374

Query: 248 AKSKILDVVKE 258
              +I++++ E
Sbjct: 375 GHIEIVELLIE 385

>Scas_716.28
          Length = 1108

 Score = 30.8 bits (68), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 31/61 (50%), Gaps = 6/61 (9%)

Query: 1053 SRANYKVPENVAGGENESSNVLIQSVTETEAKVDTIPWRLTYSPIDLSDVLGEDYKKDEE 1112
            S + Y+ P+ V  GEN SSN    S +   + + TIP  L  S ++L   LG   K DE 
Sbjct: 32   SGSQYQYPQVVTPGENVSSNATSLSYSAFNSPISTIPNSLNASSVNL---LG---KNDER 85

Query: 1113 S 1113
            S
Sbjct: 86   S 86

>CAGL0K07117g complement(700102..701484) similar to sp|P38151
           Saccharomyces cerevisiae YBR233w PAB1-binding protein 2,
           hypothetical start
          Length = 460

 Score = 30.4 bits (67), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 42/75 (56%), Gaps = 12/75 (16%)

Query: 789 DYVTRVIGKSGETINDIKAEYGVELNFLDKTDSEKAKEAGEVELEITGSRSSIKEA---- 844
           ++V  +IGK G+ IN +K   G  + F+D     + +   E +L I G+  +++ A    
Sbjct: 392 NFVGNIIGKEGKHINSVKESTGCAI-FIDN----RIEGVSERKLTIKGTYMALQAAIMLI 446

Query: 845 ANKVKSIIDQASNFE 859
           +NK++  ID+A NFE
Sbjct: 447 SNKIE--IDRA-NFE 458

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.311    0.130    0.349 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 36,447,733
Number of extensions: 1615038
Number of successful extensions: 5627
Number of sequences better than 10.0: 79
Number of HSP's gapped: 5641
Number of HSP's successfully gapped: 92
Length of query: 1187
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1074
Effective length of database: 12,684,275
Effective search space: 13622911350
Effective search space used: 13622911350
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 67 (30.4 bits)