Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0D02376g20720410711e-151
Sklu_2238.22072057541e-102
Kwal_14.23942072057272e-98
AAL176C2052047062e-95
Scas_675.282162137003e-94
CAGL0G07689g2152126933e-93
YKR014C (YPT52)2342316684e-89
YOR089C (VPS21)2102044875e-62
KLLA0C13728g2081764841e-61
Kwal_23.29782112074753e-60
CAGL0J08635g2081914753e-60
YNL093W (YPT53)2201864642e-58
Scas_662.262121734572e-57
ACL084C2072004502e-56
Sklu_2366.32181983686e-44
YER031C (YPT31)2231733616e-43
Kwal_14.24842031983607e-43
Scas_574.22221803592e-42
AEL187C2081913554e-42
Sklu_2293.32142023554e-42
CAGL0K09394g2211993531e-41
YLR262C (YPT6)2151733503e-41
CAGL0K06017g2191733494e-41
AGR257C2201713495e-41
Scas_712.412191963461e-40
Kwal_56.225552121733452e-40
YGL210W (YPT32)2221953442e-40
YBR264C (YPT10)1991603405e-40
AER434C2191963418e-40
KLLA0F01232g2102053408e-40
CAGL0C02453g2182073401e-39
CAGL0I09306g2061693345e-39
KLLA0F20471g2121733346e-39
Scas_203.22511753324e-38
CAGL0K12672g2062053136e-36
Kwal_14.11162042053041e-34
CAGL0E02607g2082053015e-34
Scas_713.52111882981e-33
YFL038C (YPT1)2062032981e-33
KLLA0D05313g2041912972e-33
YML001W (YPT7)2082052972e-33
ABR220W2042032921e-32
Sklu_2373.32081962902e-32
Kwal_56.224402081962884e-32
ACR003C2081962876e-32
Scas_674.52081792876e-32
Sklu_2144.32041912781e-30
KLLA0D01265g2071792736e-30
Kwal_47.190551791672692e-29
CAGL0F02123g2152042684e-29
Sklu_1136.11821422655e-29
Scas_707.262101632667e-29
KLLA0E12111g2141922642e-28
YFL005W (SEC4)2151632632e-28
Sklu_1815.22131882606e-28
Kwal_23.50582131632562e-27
Scas_656.22181632563e-27
AGL021W2122012502e-26
Kwal_33.140152712042306e-23
Kwal_56.233612141702171e-21
YOR185C (GSP2)2201702181e-21
YLR293C (GSP1)2191702172e-21
Scas_586.62191702153e-21
CAGL0I00594g2141702144e-21
AGR294C2141702144e-21
KLLA0C05126g2141702135e-21
KLLA0A04499g2141702135e-21
Sklu_2285.42141702136e-21
Scas_444.4*2891682114e-20
YKR055W (RHO4)2911672081e-19
KLLA0B10626g2081731962e-18
Scas_610.42111731943e-18
ACL087C1871841923e-18
CAGL0I08459g2101731926e-18
CAGL0E03113g3232051976e-18
ABR183W2071731918e-18
Sklu_1655.12871671959e-18
YPR165W (RHO1)2091941901e-17
Sklu_2151.32091731901e-17
CAGL0K08316g3231841941e-17
KLLA0D08327g2541901921e-17
Scas_575.102712091922e-17
Scas_691.362121731883e-17
Kwal_55.219412091761873e-17
CAGL0J05632g1881931863e-17
Sklu_1816.11881881863e-17
ABR182W2091841874e-17
KLLA0C13816g1871761854e-17
KLLA0A05643g2181911856e-17
ABL139C2941901871e-16
Kwal_14.22442442141841e-16
ACR257C2591661851e-16
Kwal_55.219372081811821e-16
Sklu_2151.42071781822e-16
Scas_578.71871801776e-16
YGR152C (RSR1)2721741816e-16
Scas_703.412252091789e-16
Kwal_33.144522602241772e-15
YNL090W (RHO2)1921701724e-15
Sklu_2007.22611391736e-15
KLLA0C12001g2591741711e-14
Kwal_47.169832231731701e-14
AFR464W2641731711e-14
YOR101W (RAS1)3091651685e-14
Kwal_55.219714211711695e-14
KLLA0B05038g2231751631e-13
Scas_547.32231241631e-13
Sklu_1653.32561241631e-13
AER132W2321241631e-13
ADL252W2241301594e-13
Kwal_23.48752301341594e-13
Scas_417.32911471597e-13
YNL098C (RAS2)3221651598e-13
YIL118W (RHO3)2311911561e-12
KLLA0F03443g2231251561e-12
Scas_671.352341251552e-12
Scas_697.463241651545e-12
YNL180C (RHO5)3312111545e-12
CAGL0G08558g2271221515e-12
CAGL0L11242g2541231517e-12
ADL162W4041161538e-12
Sklu_2345.52191591481e-11
YML064C (TEM1)2451251472e-11
CAGL0J11242g3841511483e-11
Scas_677.202831481474e-11
ADL262W2701851455e-11
Kwal_26.83872921651431e-10
CAGL0B04521g3391661431e-10
CAGL0G05764g2901881412e-10
YNL304W (YPT11)3551041413e-10
Scas_628.212081841365e-10
Sklu_2354.104221301334e-09
AGL093W1911261286e-09
KLLA0A04213g1911261276e-09
Kwal_34.161421921531277e-09
Kwal_23.31351911261278e-09
YCR027C (RHB1)2092051271e-08
KLLA0C12881g3731081281e-08
YLR229C (CDC42)1911261251e-08
Scas_721.961911291242e-08
CAGL0F05269g1911261242e-08
CAGL0M03817g4751051272e-08
KLLA0A11330g1901691215e-08
Scas_697.54*1811261162e-07
Sklu_2320.21641251125e-07
CAGL0I03916g1811631111e-06
Kwal_47.182412301291121e-06
Kwal_23.29441841261082e-06
YDL137W (ARF2)1811631083e-06
Scas_624.4*1811631083e-06
Scas_701.42*1811631083e-06
KLLA0C13563g1821261073e-06
CAGL0J09064g1811631073e-06
Scas_503.2527761095e-06
ACL078W1811261057e-06
Sklu_1681.21621621039e-06
YOR094W (ARF3)1831261041e-05
YDL192W (ARF1)1811631022e-05
Kwal_56.244531811631003e-05
Kwal_56.244621811781003e-05
KLLA0B02046g1901371003e-05
ADR094W181163994e-05
CAGL0I00858g197169994e-05
KLLA0F05225g181126961e-04
Sklu_2365.2197100952e-04
CAGL0E05896g189137952e-04
Scas_706.2*190144933e-04
Scas_567.9199167933e-04
YPL218W (SAR1)190132915e-04
Sklu_2202.618396915e-04
KLLA0E24805g18395906e-04
Kwal_27.1187219796907e-04
AGR221W18396870.002
YBR164C (ARL1)18398860.002
CAGL0I10835g18396850.003
Scas_700.1118396850.003
AFL114W190130850.003
YPL051W (ARL3)19893820.008
KLLA0E11638g405256820.011
Scas_698.27701143810.017
KLLA0C06358g299141800.021
KLLA0C13387g21195790.022
CAGL0L12826g199166780.024
Scas_680.21183133780.025
Kwal_56.2414914989770.030
AGL261W198179770.036
KLLA0F02662g253140770.046
Sklu_1358.1218139750.080
KLLA0E07634g501169720.22
AEL232C309133720.22
Scas_688.2439398700.45
KLLA0A03465g659123690.53
Scas_721.9039763690.60
YMR023C (MSS1)526173690.62
Kwal_26.681066426690.65
ADR402W66126680.78
YML121W (GTR1)310131670.87
CAGL0E06292g40832671.0
Sklu_2411.4496131671.1
ABL104C55654661.2
Kwal_33.14296299131641.9
Sklu_2335.9331134632.8
Scas_692.9309131632.9
Scas_691.35*263261643.0
AGR030C32475623.4
KLLA0E12837g19954613.6
CAGL0B02453g316135614.6
YAL048C66295615.2
AFR446W299131598.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D02376g
         (204 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D02376g 201512..202135 similar to sp|P36018 Saccharomyces c...   417   e-151
Sklu_2238.2 YKR014C, Contig c2238 2956-3579 reverse complement        295   e-102
Kwal_14.2394                                                          284   2e-98
AAL176C [11] [Homologous to ScYKR014C (YPT52) - SH] (31588..3220...   276   2e-95
Scas_675.28                                                           274   3e-94
CAGL0G07689g complement(729919..730566) highly similar to sp|P36...   271   3e-93
YKR014C (YPT52) [3269] chr11 complement(465010..465714) GTP-bind...   261   4e-89
YOR089C (VPS21) [4894] chr15 complement(490197..490829) GTP-bind...   192   5e-62
KLLA0C13728g 1173329..1173955 highly similar to sp|P36017 Saccha...   191   1e-61
Kwal_23.2978                                                          187   3e-60
CAGL0J08635g complement(853978..854604) highly similar to sp|P36...   187   3e-60
YNL093W (YPT53) [4498] chr14 (449868..450530) GTP-binding protei...   183   2e-58
Scas_662.26                                                           180   2e-57
ACL084C [965] [Homologous to ScYOR089C (VPS21) - SH; ScYNL093W (...   177   2e-56
Sklu_2366.3 , Contig c2366 5288-5944 reverse complement               146   6e-44
YER031C (YPT31) [1456] chr5 complement(214075..214746) GTP-bindi...   143   6e-43
Kwal_14.2484                                                          143   7e-43
Scas_574.2                                                            142   2e-42
AEL187C [2319] [Homologous to ScYBR264C (YPT10) - SH] (284984..2...   141   4e-42
Sklu_2293.3 YLR262C, Contig c2293 4975-5619                           141   4e-42
CAGL0K09394g complement(929234..929899) highly similar to sp|P51...   140   1e-41
YLR262C (YPT6) [3655] chr12 complement(668246..668893) GTP-bindi...   139   3e-41
CAGL0K06017g complement(586093..586752) highly similar to sp|Q99...   139   4e-41
AGR257C [4568] [Homologous to ScYLR262C (YPT6) - SH] (1225886..1...   139   5e-41
Scas_712.41                                                           137   1e-40
Kwal_56.22555                                                         137   2e-40
YGL210W (YPT32) [1786] chr7 (93795..94463) GTP-binding protein r...   137   2e-40
YBR264C (YPT10) [444] chr2 complement(737727..738326) Member of ...   135   5e-40
AER434C [2934] [Homologous to ScYGL210W (YPT32) - SH; ScYER031C ...   135   8e-40
KLLA0F01232g complement(114430..115062) similar to sp|P36019 Sac...   135   8e-40
CAGL0C02453g 247493..248149 highly similar to sp|P38555 Saccharo...   135   1e-39
CAGL0I09306g complement(897087..897707) similar to sp|P38146 Sac...   133   5e-39
KLLA0F20471g 1901749..1902387 highly similar to sp|Q99260 Saccha...   133   6e-39
Scas_203.2                                                            132   4e-38
CAGL0K12672g 1255541..1256161 highly similar to sp|P01123 Saccha...   125   6e-36
Kwal_14.1116                                                          121   1e-34
CAGL0E02607g complement(248761..249387) highly similar to sp|P32...   120   5e-34
Scas_713.5                                                            119   1e-33
YFL038C (YPT1) [1645] chr6 complement(55365..55985) GTP-binding ...   119   1e-33
KLLA0D05313g 459496..460110 gi|10129780|emb|CAC08198.1 Kluyverom...   119   2e-33
YML001W (YPT7) [3965] chr13 (267174..267800) GTP-binding protein...   119   2e-33
ABR220W [814] [Homologous to ScYFL038C (YPT1) - SH] complement(8...   117   1e-32
Sklu_2373.3 YML001W, Contig c2373 10977-11603                         116   2e-32
Kwal_56.22440                                                         115   4e-32
ACR003C [1051] [Homologous to ScYML001W (YPT7) - SH] (359762..36...   115   6e-32
Scas_674.5                                                            115   6e-32
Sklu_2144.3 YFL038C, Contig c2144 4079-4693                           111   1e-30
KLLA0D01265g 110784..111407 highly similar to sp|P32939 Saccharo...   109   6e-30
Kwal_47.19055                                                         108   2e-29
CAGL0F02123g 212117..212764 highly similar to sp|P07560 Saccharo...   107   4e-29
Sklu_1136.1 YGL210W, Contig c1136 1284-1832                           106   5e-29
Scas_707.26                                                           107   7e-29
KLLA0E12111g 1075299..1075943 highly similar to sp|P07560 Saccha...   106   2e-28
YFL005W (SEC4) [1676] chr6 (130329..130976) GTP-binding protein ...   105   2e-28
Sklu_1815.2 YFL005W, Contig c1815 3148-3789 reverse complement        104   6e-28
Kwal_23.5058                                                          103   2e-27
Scas_656.2                                                            103   3e-27
AGL021W [4290] [Homologous to ScYFL005W (SEC4) - SH] complement(...   100   2e-26
Kwal_33.14015                                                          93   6e-23
Kwal_56.23361                                                          88   1e-21
YOR185C (GSP2) [4981] chr15 complement(681444..682106) Ran, a GT...    89   1e-21
YLR293C (GSP1) [3684] chr12 complement(720773..721432) Ran, a GT...    88   2e-21
Scas_586.6                                                             87   3e-21
CAGL0I00594g 44835..45479 highly similar to sp|P32835 Saccharomy...    87   4e-21
AGR294C [4605] [Homologous to ScYOR185C (GSP2) - SH; ScYLR293C (...    87   4e-21
KLLA0C05126g complement(463657..464301) highly similar to sp|P32...    87   5e-21
KLLA0A04499g complement(404732..405376) highly similar to sp|P32...    87   5e-21
Sklu_2285.4 YLR293C, Contig c2285 4349-4993 reverse complement         87   6e-21
Scas_444.4*                                                            86   4e-20
YKR055W (RHO4) [3306] chr11 (547858..548733) GTP-binding protein...    85   1e-19
KLLA0B10626g 936497..937123 gi|22858698|gb|AAN05733.1 Kluyveromy...    80   2e-18
Scas_610.4                                                             79   3e-18
ACL087C [962] [Homologous to ScYNL090W (RHO2) - SH] (191573..192...    79   3e-18
CAGL0I08459g 829292..829924 highly similar to sp|P06780 Saccharo...    79   6e-18
CAGL0E03113g complement(289164..290135) some similarities with s...    80   6e-18
ABR183W [776] [Homologous to ScYPR165W (RHO1) - SH] complement(7...    78   8e-18
Sklu_1655.1 YKR055W, Contig c1655 395-1258 reverse complement          80   9e-18
YPR165W (RHO1) [5580] chr16 (875362..875991) GTP-binding protein...    78   1e-17
Sklu_2151.3 YPR165W, Contig c2151 2495-3124 reverse complement         78   1e-17
CAGL0K08316g 838393..839364 some similarities with sp|Q00246 Sac...    79   1e-17
KLLA0D08327g 708240..709004 similar to sp|P53879 Saccharomyces c...    79   1e-17
Scas_575.10                                                            79   2e-17
Scas_691.36                                                            77   3e-17
Kwal_55.21941                                                          77   3e-17
CAGL0J05632g complement(537342..537908) highly similar to sp|P06...    76   3e-17
Sklu_1816.1 YNL090W, Contig c1816 115-681                              76   3e-17
ABR182W [775] [Homologous to ScYPR165W (RHO1) - SH] complement(7...    77   4e-17
KLLA0C13816g 1183412..1183975 highly similar to sp|P06781 Saccha...    76   4e-17
KLLA0A05643g 528976..529632 similar to sp|Q00246 Saccharomyces c...    76   6e-17
ABL139C [453] [Homologous to ScYNL180C (RHO5) - SH] (134875..135...    77   1e-16
Kwal_14.2244                                                           75   1e-16
ACR257C [1304] [Homologous to ScYKR055W (RHO4) - SH] (808667..80...    76   1e-16
Kwal_55.21937                                                          75   1e-16
Sklu_2151.4 , Contig c2151 3640-4263 reverse complement                75   2e-16
Scas_578.7                                                             73   6e-16
YGR152C (RSR1) [2106] chr7 complement(794677..795495) GTP-bindin...    74   6e-16
Scas_703.41                                                            73   9e-16
Kwal_33.14452                                                          73   2e-15
YNL090W (RHO2) [4501] chr14 (456565..457143) GTP-binding protein...    71   4e-15
Sklu_2007.2 YNL180C, Contig c2007 789-1574 reverse complement          71   6e-15
KLLA0C12001g complement(1029092..1029871) similar to sp|P13856 S...    70   1e-14
Kwal_47.16983                                                          70   1e-14
AFR464W [3656] [Homologous to ScYGR152C (RSR1) - SH] complement(...    70   1e-14
YOR101W (RAS1) [4906] chr15 (515244..516173) GTP-binding protein...    69   5e-14
Kwal_55.21971                                                          70   5e-14
KLLA0B05038g complement(457608..458279) similar to sp|P38987 Sac...    67   1e-13
Scas_547.3                                                             67   1e-13
Sklu_1653.3 YML064C, Contig c1653 2277-3047                            67   1e-13
AER132W [2636] [Homologous to ScYML064C (TEM1) - SH] complement(...    67   1e-13
ADL252W [1489] [Homologous to ScYIL118W (RHO3) - SH] complement(...    66   4e-13
Kwal_23.4875                                                           66   4e-13
Scas_417.3                                                             66   7e-13
YNL098C (RAS2) [4493] chr14 complement(439602..440570) GTP-bindi...    66   8e-13
YIL118W (RHO3) [2558] chr9 (139749..140444) GTP-binding protein ...    65   1e-12
KLLA0F03443g 324020..324691 highly similar to sp|Q9HF51 Ashbya g...    65   1e-12
Scas_671.35                                                            64   2e-12
Scas_697.46                                                            64   5e-12
YNL180C (RHO5) [4420] chr14 complement(299654..300649) GTPase of...    64   5e-12
CAGL0G08558g complement(804969..805652) highly similar to sp|Q00...    63   5e-12
CAGL0L11242g 1197075..1197839 highly similar to sp|P38987 Saccha...    63   7e-12
ADL162W [1579] [Homologous to ScYNL304W (YPT11) - SH] complement...    64   8e-12
Sklu_2345.5 YCR027C, Contig c2345 9936-10595                           62   1e-11
YML064C (TEM1) [3905] chr13 complement(145139..145876) GTP-bindi...    61   2e-11
CAGL0J11242g 1092630..1093784 similar to sp|P53879 Saccharomyces...    62   3e-11
Scas_677.20                                                            61   4e-11
ADL262W [1479] [Homologous to ScYOR101W (RAS1) - SH; ScYNL098C (...    60   5e-11
Kwal_26.8387                                                           60   1e-10
CAGL0B04521g complement(439732..440751) similar to sp|P01120 Sac...    60   1e-10
CAGL0G05764g complement(552809..553681) similar to sp|P53879 Sac...    59   2e-10
YNL304W (YPT11) [4309] chr14 (60482..61549) Predicted GTPase pos...    59   3e-10
Scas_628.21                                                            57   5e-10
Sklu_2354.10 YNL304W, Contig c2354 13851-15119                         56   4e-09
AGL093W [4218] [Homologous to ScYLR229C (CDC42) - SH] complement...    54   6e-09
KLLA0A04213g complement(382243..382818) highly similar to sp|P19...    54   6e-09
Kwal_34.16142                                                          54   7e-09
Kwal_23.3135                                                           54   8e-09
YCR027C (RHB1) [561] chr3 complement(167365..167994) Protein inv...    54   1e-08
KLLA0C12881g 1090895..1092016 weakly similar to sp|P48559 Saccha...    54   1e-08
YLR229C (CDC42) [3629] chr12 complement(604214..604789) Rho-type...    53   1e-08
Scas_721.96                                                            52   2e-08
CAGL0F05269g complement(533759..534334) highly similar to sp|P19...    52   2e-08
CAGL0M03817g complement(431237..432664) weakly similar to sp|P48...    54   2e-08
KLLA0A11330g 982552..983124 similar to ca|CA6070|IPF4842 Candida...    51   5e-08
Scas_697.54*                                                           49   2e-07
Sklu_2320.2 YOR094W, Contig c2320 3571-4065                            48   5e-07
CAGL0I03916g 343014..343559 highly similar to sp|P11076 Saccharo...    47   1e-06
Kwal_47.18241                                                          48   1e-06
Kwal_23.2944                                                           46   2e-06
YDL137W (ARF2) [731] chr4 (216529..217074) GTP-binding protein o...    46   3e-06
Scas_624.4*                                                            46   3e-06
Scas_701.42*                                                           46   3e-06
KLLA0C13563g complement(1157278..1157826) highly similar to sp|P...    46   3e-06
CAGL0J09064g 892556..893101 highly similar to sp|P11076 Saccharo...    46   3e-06
Scas_503.2                                                             47   5e-06
ACL078W [971] [Homologous to ScYOR094W (ARF3) - SH] complement(2...    45   7e-06
Sklu_1681.2 YDL137W, Contig c1681 2279-2767                            44   9e-06
YOR094W (ARF3) [4899] chr15 (502795..503346) Protein with simila...    45   1e-05
YDL192W (ARF1) [681] chr4 (116322..116867) GTP-binding protein i...    44   2e-05
Kwal_56.24453                                                          43   3e-05
Kwal_56.24462                                                          43   3e-05
KLLA0B02046g 178646..179218 highly similar to sp|P20606 Saccharo...    43   3e-05
ADR094W [1835] [Homologous to ScYDL192W (ARF1) - SH; ScYDL137W (...    43   4e-05
CAGL0I00858g complement(63365..63958) similar to sp|P39110 Sacch...    43   4e-05
KLLA0F05225g 515391..515936 highly similar to sp|P19146 Saccharo...    42   1e-04
Sklu_2365.2 YPL051W, Contig c2365 827-1420 reverse complement          41   2e-04
CAGL0E05896g join(complement(585178..585202),complement(584348.....    41   2e-04
Scas_706.2*                                                            40   3e-04
Scas_567.9                                                             40   3e-04
YPL218W (SAR1) [5231] chr16 (138697..138724,138864..139408) Comp...    40   5e-04
Sklu_2202.6 YBR164C, Contig c2202 5407-5958                            40   5e-04
KLLA0E24805g 2194554..2195105 highly similar to sp|P38116 Saccha...    39   6e-04
Kwal_27.11872                                                          39   7e-04
AGR221W [4532] [Homologous to ScYBR164C (ARL1) - SH] complement(...    38   0.002
YBR164C (ARL1) [350] chr2 complement(567832..568383) GTP-binding...    38   0.002
CAGL0I10835g 1060258..1060809 highly similar to sp|P38116 Saccha...    37   0.003
Scas_700.11                                                            37   0.003
AFL114W [3081] [Homologous to ScYPL218W (SAR1) - SH] complement(...    37   0.003
YPL051W (ARL3) [5389] chr16 (459958..460554) ADP-ribosylation fa...    36   0.008
KLLA0E11638g 1028781..1029998 some similarities with sp|P01120 S...    36   0.011
Scas_698.27                                                            36   0.017
KLLA0C06358g complement(563583..564482) highly similar to sp|Q00...    35   0.021
KLLA0C13387g complement(1142002..1142637) similar to sp|P01119 S...    35   0.022
CAGL0L12826g complement(1370767..1371366) highly similar to tr|Q...    35   0.024
Scas_680.21                                                            35   0.025
Kwal_56.24149                                                          34   0.030
AGL261W [4051] [Homologous to ScYPL051W (ARL3) - SH] complement(...    34   0.036
KLLA0F02662g 241804..242565 some similarities with sp|Q8VEH3 Mus...    34   0.046
Sklu_1358.1 YMR138W, Contig c1358 536-1192                             33   0.080
KLLA0E07634g 688734..690239 similar to sp|P32559 Saccharomyces c...    32   0.22 
AEL232C [2274] [Homologous to NOHBY] (196356..197285) [930 bp, 3...    32   0.22 
Scas_688.24                                                            32   0.45 
KLLA0A03465g complement(314573..316552) similar to sp|P39722 Sac...    31   0.53 
Scas_721.90                                                            31   0.60 
YMR023C (MSS1) [3987] chr13 complement(319436..321016) Mitochond...    31   0.62 
Kwal_26.6810                                                           31   0.65 
ADR402W [2142] [Homologous to ScYAL048C - SH] complement(1426900...    31   0.78 
YML121W (GTR1) [3850] chr13 (26930..27862) GTP-binding protein i...    30   0.87 
CAGL0E06292g 633135..634361 some similarities with sp|P01119 Sac...    30   1.0  
Sklu_2411.4 YMR023C, Contig c2411 8898-10388                           30   1.1  
ABL104C [488] [Homologous to ScYDR232W (HEM1) - SH] (202777..204...    30   1.2  
Kwal_33.14296                                                          29   1.9  
Sklu_2335.9 YML121W, Contig c2335 18260-19255 reverse complement       29   2.8  
Scas_692.9                                                             29   2.9  
Scas_691.35*                                                           29   3.0  
AGR030C [4340] [Homologous to ScYDR044W (HEM13) - SH] (768609..7...    28   3.4  
KLLA0E12837g 1135181..1135780 similar to sgd|S0005972 Saccharomy...    28   3.6  
CAGL0B02453g complement(234125..235075) highly similar to sp|Q00...    28   4.6  
YAL048C (YAL048C) [19] chr1 complement(52804..54792) Protein inv...    28   5.2  
AFR446W [3638] [Homologous to ScYML121W (GTR1) - SH] complement(...    27   8.8  

>KLLA0D02376g 201512..202135 similar to sp|P36018 Saccharomyces
           cerevisiae YKR014c YPT52 GTP-binding protein of the rab
           family, start by similarity
          Length = 207

 Score =  417 bits (1071), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 204/204 (100%), Positives = 204/204 (100%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEI 60
           MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEI
Sbjct: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEI 60

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVG 120
           WDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVG
Sbjct: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVG 120

Query: 121 NKLDLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERLYLQNKDK 180
           NKLDLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERLYLQNKDK
Sbjct: 121 NKLDLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERLYLQNKDK 180

Query: 181 IQESKKPNNNNISLQRPSTNDSQS 204
           IQESKKPNNNNISLQRPSTNDSQS
Sbjct: 181 IQESKKPNNNNISLQRPSTNDSQS 204

>Sklu_2238.2 YKR014C, Contig c2238 2956-3579 reverse complement
          Length = 207

 Score =  295 bits (754), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 171/205 (83%), Gaps = 2/205 (0%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEI 60
           MLQFKLVLLGDSSVGKSSIVHRFVKDSFDE+RESTIGAAFLSQTIKL ++Y++ V+KFEI
Sbjct: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKL-KDYNDTVVKFEI 59

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVG 120
           WDTAGQERYKSLAPMYYRNAN ALVVYDVT+PDSL KA+ WVDELK KV D+ L+ICLVG
Sbjct: 60  WDTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVG 119

Query: 121 NKLDLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERLYLQNKDK 180
           NKLDL  E      VD+ DA+ +A +  LLFH+VSAKTG+ V  +FQ+IGE+LYLQ KD 
Sbjct: 120 NKLDLCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIGEKLYLQKKDS 179

Query: 181 IQESKKPNN-NNISLQRPSTNDSQS 204
           ++ + +  +  N+ LQRP+TND+ S
Sbjct: 180 LEAASQTRHVVNVELQRPTTNDATS 204

>Kwal_14.2394
          Length = 207

 Score =  284 bits (727), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 141/205 (68%), Positives = 163/205 (79%), Gaps = 2/205 (0%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEI 60
           MLQFKLVLLGDSSVGKSSIVHRFVKDSFDE+RESTIGAAFLSQTIKL E++++  +KFEI
Sbjct: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKL-EKHEDVTIKFEI 59

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVG 120
           WDTAGQERYKSLAPMYYRNANAALVVYDVT+  SL KA+ WV+ELK KV D  L+ICLVG
Sbjct: 60  WDTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVG 119

Query: 121 NKLDLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERLYLQNKDK 180
           NKLDL +E E    V++ DA+ +AQE  LLFH+VSAKTG  V  +FQ+IGE +Y +    
Sbjct: 120 NKLDLCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVYQKKGAA 179

Query: 181 IQESKKPNNN-NISLQRPSTNDSQS 204
              S +     N+ LQRPSTNDS S
Sbjct: 180 TAASPQARKTPNVKLQRPSTNDSTS 204

>AAL176C [11] [Homologous to ScYKR014C (YPT52) - SH] (31588..32205)
           [618 bp, 205 aa]
          Length = 205

 Score =  276 bits (706), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 134/204 (65%), Positives = 170/204 (83%), Gaps = 2/204 (0%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEI 60
           MLQFKLVLLGDSSVGKSSIVHRFVKDSFDE+RESTIGAAFLS+TIKL++ +D+ ++KFEI
Sbjct: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLAD-HDDAMIKFEI 59

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVG 120
           WDTAGQERYKSLAPMYYRNANAALVVYDVT+ DSL KA+ WV+ELK KV D+ L+I LVG
Sbjct: 60  WDTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVG 119

Query: 121 NKLDLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERLYLQNKDK 180
           NKLDLV E     ++D  +A+ +A+ + L+FH+VSAKTG  ++ VFQ IG +LY Q ++ 
Sbjct: 120 NKLDLVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGIGGKLYEQRRES 179

Query: 181 IQESKKPNNNNISLQRPSTNDSQS 204
           +  ++  ++++I LQRP+TND+ S
Sbjct: 180 L-AAQPQHSSSIQLQRPTTNDATS 202

>Scas_675.28
          Length = 216

 Score =  274 bits (700), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 142/213 (66%), Positives = 168/213 (78%), Gaps = 9/213 (4%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQ--VLKF 58
           MLQFKLVLLGDSSVGKSSIVHRFVKDSFDE RESTIGAAFLSQTIK+  E  E+  V+KF
Sbjct: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKF 60

Query: 59  EIWDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICL 118
           EIWDTAGQERYKSLAPMYYRNANAALVVYD+T+ DSL KA+ WV+ELK KV D+ L+I L
Sbjct: 61  EIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFL 120

Query: 119 VGNKLDLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERLYLQNK 178
           VGNKLDL    E    VD ++A+ +A+E NLLF +VSAKTG+ V +VF+ IGE+LY   K
Sbjct: 121 VGNKLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYASKK 180

Query: 179 DKIQESK------KPNNN-NISLQRPSTNDSQS 204
           D+I   K      + NN+ +I+ QRPSTND+ +
Sbjct: 181 DEILAKKNRELGNRVNNSVDINAQRPSTNDTTT 213

>CAGL0G07689g complement(729919..730566) highly similar to sp|P36018
           Saccharomyces cerevisiae YKR014c YPT52 GTP-binding
           protein, start by similarity
          Length = 215

 Score =  271 bits (693), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 135/212 (63%), Positives = 167/212 (78%), Gaps = 8/212 (3%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEI 60
           MLQFKLVLLGDSSVGKSSIVHRFVKD+FDE RESTIGAAFLSQT+K+ +  ++ V+KFEI
Sbjct: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEI 60

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVG 120
           WDTAGQERYKSLAPMYYRNANAALVVYDVT+PDSL KA+ WV EL+ KV D++L+I LVG
Sbjct: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVG 120

Query: 121 NKLDLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERLY------ 174
           NK+D+V   ES   ++  +  E+AQ   LLF +VSAKTG  V  +FQ+IGE+LY      
Sbjct: 121 NKVDIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQLYSTKKAS 180

Query: 175 LQNKDKIQESKKPNNNNISL--QRPSTNDSQS 204
           L+NKD+ + +   ++N + +  QRPSTND+ S
Sbjct: 181 LKNKDQSRRTDSVSSNTVDIQTQRPSTNDTSS 212

>YKR014C (YPT52) [3269] chr11 complement(465010..465714) GTP-binding
           protein of the rab family (ras superfamily) involved in
           endocytosis and transport of proteins to the vacuole
           [705 bp, 234 aa]
          Length = 234

 Score =  261 bits (668), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 142/231 (61%), Positives = 165/231 (71%), Gaps = 27/231 (11%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKL----SEEYDEQVL 56
           MLQFKLVLLGDSSVGKSSIVHRFVKD+FDE RESTIGAAFLSQ+I +      E  + V+
Sbjct: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVI 60

Query: 57  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLII 116
           KFEIWDTAGQERYKSLAPMYYRNANAALVVYD+T+ DSL KA+ WVDELK KV DD L+I
Sbjct: 61  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVI 120

Query: 117 CLVGNKLDLVSERESTSL----------------VDEADAREFAQENNLLFHQVSAKTGE 160
            L+GNK+DL  E  ST                  +   +A+++AQE  LLF +VSAKTGE
Sbjct: 121 YLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGE 180

Query: 161 NVIKVFQDIGERLYLQNKDKI---QESKKPNNNN----ISLQRPSTNDSQS 204
            V ++FQDIGE+LY   KD+I   Q  +    NN    I+LQRPSTND  S
Sbjct: 181 GVKEIFQDIGEKLYDLKKDEILSKQNRQIGGGNNGQVDINLQRPSTNDPTS 231

>YOR089C (VPS21) [4894] chr15 complement(490197..490829) GTP-binding
           protein required for sorting of vacuolar proteins and
           involved in late stage of endocytosis, member of the rab
           family in the ras superfamily [633 bp, 210 aa]
          Length = 210

 Score =  192 bits (487), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 104/204 (50%), Positives = 137/204 (67%), Gaps = 11/204 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDT 63
            KLVLLG+++VGKSSIV RFV + F E +E TIGAAFL+Q + +    +E  +KFEIWDT
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVTI----NEHTVKFEIWDT 63

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGNKL 123
           AGQER+ SLAPMYYRNA AALVVYDVT+P S  KA+ WV EL E+ + D +II LVGNK+
Sbjct: 64  AGQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQASKD-IIIALVGNKI 122

Query: 124 DLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERLYLQN---KDK 180
           D++ E     +  E +  + A+E  LLF + SAKTGENV  VF  IGE++ L+    ++ 
Sbjct: 123 DMLQEGGERKVARE-EGEKLAEEKGLLFFETSAKTGENVNDVFLGIGEKIPLKTAEEQNS 181

Query: 181 IQESKKPNNNNISLQRPSTNDSQS 204
               ++ NN  + L   + ND  S
Sbjct: 182 ASNERESNNQRVDLN--AANDGTS 203

>KLLA0C13728g 1173329..1173955 highly similar to sp|P36017
           Saccharomyces cerevisiae YOR089c VPS21 GTP-binding
           protein, start by similarity
          Length = 208

 Score =  191 bits (484), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 98/176 (55%), Positives = 128/176 (72%), Gaps = 6/176 (3%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDT 63
            KLVLLG+++VGKSSIV RFV + F E +E TIGAAFL+Q + +++      +KFEIWDT
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVNMAD----HTIKFEIWDT 63

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGNKL 123
           AGQER+ SLAPMYYRNA AALVVYDVT+P S  KA+ WV EL E+ +   ++I LVGNK+
Sbjct: 64  AGQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQASKG-IVIALVGNKM 122

Query: 124 DLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERLYLQNKD 179
           DL+   E   +  E +A + +QE NLLF + SAKTG+NV +VF  IGE++ L+  D
Sbjct: 123 DLLESEEDRKVAKE-EAEKLSQEENLLFFETSAKTGDNVNEVFLAIGEKIPLKKSD 177

>Kwal_23.2978
          Length = 211

 Score =  187 bits (475), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 103/207 (49%), Positives = 139/207 (67%), Gaps = 13/207 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDT 63
            KLVLLG+++VGKSSIV RFV + F E +E TIGAAFL+Q + + +      +KFEIWDT
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVNMGD----HTIKFEIWDT 63

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGNKL 123
           AGQER+ SLAPMYYRNA AALVVYDVT+P S  KA+ WV EL+E+ + D ++I LVGNKL
Sbjct: 64  AGQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELREQASKD-IVIALVGNKL 122

Query: 124 DLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERLYLQNKDKIQE 183
           D+V E      V   +A   A +  LLF + SAKTG NV +VF  IG+++ L++  + Q+
Sbjct: 123 DIV-ESGGERKVAREEAENLAAQEQLLFFETSAKTGSNVNEVFLGIGQKIPLKSPQQ-QQ 180

Query: 184 SKKPNNNNIS------LQRPSTNDSQS 204
           ++ P+   I+      L+    N +QS
Sbjct: 181 AQGPSGLRINDDARVDLRAAQGNSAQS 207

>CAGL0J08635g complement(853978..854604) highly similar to sp|P36017
           Saccharomyces cerevisiae YOR089c VPS21 GTP-binding
           protein, start by similarity
          Length = 208

 Score =  187 bits (475), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 136/191 (71%), Gaps = 9/191 (4%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEI 60
           +   KLVLLG+++VGKSSIV RFV + F E +E TIGAAFL+Q + +    +E  +KFEI
Sbjct: 5   ITSLKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVTI----NEHTVKFEI 60

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVG 120
           WDTAGQER+ SLAPMYYRNA AALVVYDVT+P S  KA+ WV EL+E+ + D +II LVG
Sbjct: 61  WDTAGQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELQEQASKD-IIIALVG 119

Query: 121 NKLDLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERLYLQNKDK 180
           NK+D++ E  +   V   +A + A+E NLLF + SAK+GEN+  VF  IGE++ L+  + 
Sbjct: 120 NKIDVL-ENGTERSVSREEAEKLAEEENLLFFETSAKSGENITDVFLAIGEKVPLKTAN- 177

Query: 181 IQESKKPNNNN 191
             ++  PNN N
Sbjct: 178 --QANVPNNAN 186

>YNL093W (YPT53) [4498] chr14 (449868..450530) GTP-binding protein
           involved in endocytosis and transport of proteins to the
           vacuole, member of the rab family in the ras superfamily
           [663 bp, 220 aa]
          Length = 220

 Score =  183 bits (464), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 98/186 (52%), Positives = 130/186 (69%), Gaps = 9/186 (4%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIW 61
           L  K+VLLG+S+VGKSSIV RFV D F E +E TIGAAFL++ I      D +V+KFEIW
Sbjct: 11  LTIKVVLLGESAVGKSSIVLRFVSDDFKESKEPTIGAAFLTKRIT----RDGKVIKFEIW 66

Query: 62  DTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGN 121
           DTAGQER+  LAPMYYRNA AALVV+DVT   S  KA+ WV+EL EKV  D ++I LVGN
Sbjct: 67  DTAGQERFAPLAPMYYRNAQAALVVFDVTNEGSFYKAQNWVEELHEKVGHD-IVIALVGN 125

Query: 122 KLDLVS---ERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERLYLQNK 178
           K+DL++   E E+ ++   A  +   +  NLL+ + SAKTGEN+ ++FQ +GE++    +
Sbjct: 126 KMDLLNNDDENENRAMKAPA-VQNLCERENLLYFEASAKTGENIYQIFQTLGEKVPCPEQ 184

Query: 179 DKIQES 184
           +  Q S
Sbjct: 185 NTRQSS 190

>Scas_662.26
          Length = 212

 Score =  180 bits (457), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 123/173 (71%), Gaps = 5/173 (2%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDT 63
            KLVLLG+++VGKSSIV RFV + F E +E TIGAAFL+Q + +    ++  +KFEIWDT
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVNI----NDNTVKFEIWDT 63

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGNKL 123
           AGQER+ SLAPMYYRNA AAL+VYDVT+P S  KA+ W+ EL E+ N D +II LVGNK+
Sbjct: 64  AGQERFASLAPMYYRNAQAALIVYDVTKPQSFIKARHWIKELHEQANKD-MIIALVGNKV 122

Query: 124 DLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERLYLQ 176
           D++   E    V   +  + A+E  LLF + SAKTG NV + F  IGE++ L+
Sbjct: 123 DVLENNEDERKVAREEGEKLAEEEGLLFFETSAKTGLNVTETFVAIGEKIPLK 175

>ACL084C [965] [Homologous to ScYOR089C (VPS21) - SH; ScYNL093W
           (YPT53) - SH] (199020..199643) [624 bp, 207 aa]
          Length = 207

 Score =  177 bits (450), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 136/200 (68%), Gaps = 7/200 (3%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDT 63
            KLVLLG+++VGKSSIV RFV + F E +E TIGAAFL+Q + +    D + +KFEIWDT
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVNM----DSKTIKFEIWDT 63

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGNKL 123
           AGQER+ SLAPMYYRNA AALVVYD+T+P S  KA+ WV EL E+ +   ++I LVGNKL
Sbjct: 64  AGQERFASLAPMYYRNAQAALVVYDITKPQSFIKARHWVKELHEQASKG-IVIALVGNKL 122

Query: 124 DLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERLYLQNKDKIQE 183
           DL+   E+   V   +A + A+E  LLF + SAKTG+ + +VF  IGE++ L    + Q 
Sbjct: 123 DLLENGEARK-VSREEAEKLAEEEGLLFFETSAKTGDKINEVFLAIGEKIPLAKVGE-QP 180

Query: 184 SKKPNNNNISLQRPSTNDSQ 203
           +  P+ +N  L   + + +Q
Sbjct: 181 ASGPSVDNARLDLNAVSSNQ 200

>Sklu_2366.3 , Contig c2366 5288-5944 reverse complement
          Length = 218

 Score =  146 bits (368), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 87/198 (43%), Positives = 123/198 (62%), Gaps = 25/198 (12%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKL------SEEYDEQVL 56
           + KLVLLG+SSVGKSSIV RF   +F     +TIGAAF ++T+ L      + E  ++ +
Sbjct: 8   ELKLVLLGESSVGKSSIVTRFTTGNFHR-SNATIGAAFTTKTLSLESIVPETGETIDKKI 66

Query: 57  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDK--- 113
           K EIWDTAGQERY+SLAPMYYRN + AL+V+DVT  DS+ +A+ W+DEL   +N+ +   
Sbjct: 67  KLEIWDTAGQERYRSLAPMYYRNTDVALIVFDVTNKDSIARAQSWIDELNRYINEGEHEE 126

Query: 114 --LIICLVGNKLDLVSE-RESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDI- 169
             ++I +VGNK+DL  E RE+ +L        + Q+    +  VSAKTG+ + ++F  I 
Sbjct: 127 RGILIKIVGNKIDLNPEARETQNL-------PYIQDQGYNWFPVSAKTGDGIDELFDTIV 179

Query: 170 ----GERLYLQNKDKIQE 183
                E+   QN  K  E
Sbjct: 180 KEIPWEKFTRQNLQKTNE 197

>YER031C (YPT31) [1456] chr5 complement(214075..214746) GTP-binding
           protein required in the secretory pathway at the stage
           of formation of trans-Golgi vesicles, member of the rab
           family in the ras superfamily of small GTP-binding
           proteins [672 bp, 223 aa]
          Length = 223

 Score =  143 bits (361), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 109/173 (63%), Gaps = 9/173 (5%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIW 61
           L FK+VL+GDS VGKS+++ RF K+ F+   +STIG  F ++T+    E D + +K +IW
Sbjct: 12  LLFKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTL----EIDGKRIKAQIW 67

Query: 62  DTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGN 121
           DTAGQERY+++   YYR A  AL+VYD+++  S      W+ EL+E   DD + + L+GN
Sbjct: 68  DTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENA-DDNVAVGLIGN 126

Query: 122 KLDLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERLY 174
           K DL   R     V   +++ FAQEN LLF + SA   ENV K F+++   +Y
Sbjct: 127 KSDLAHLRA----VPTEESKTFAQENQLLFTETSALNSENVDKAFEELINTIY 175

>Kwal_14.2484
          Length = 203

 Score =  143 bits (360), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 84/198 (42%), Positives = 120/198 (60%), Gaps = 22/198 (11%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWD 62
           + KLVLLG+SSVGKS++V RF   SF +   +TIGAAF ++ I    E   + +KFEIWD
Sbjct: 9   ELKLVLLGESSVGKSALVTRFTTGSFHK-SNATIGAAFTTKVISWETETARKEVKFEIWD 67

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDK---LIICLV 119
           TAGQERY++L PMYYRN + A VV+DVTE  +  KA  WV ELK  +  ++   ++I L+
Sbjct: 68  TAGQERYRALTPMYYRNTDVAFVVFDVTEESTSLKADSWVQELKSYMEGEEAHNIVIKLI 127

Query: 120 GNKLDLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERLYLQNKD 179
           GNK+D         L+DE   R+        +  VSAKTGE V  +F+ +  R    +K 
Sbjct: 128 GNKID---------LLDEVPPRKVG------WTPVSAKTGEGVADLFESVA-REVPSSKF 171

Query: 180 KIQESKKPN--NNNISLQ 195
           K+ ++  P+  +N + L+
Sbjct: 172 KVIDTTAPSSADNTVDLR 189

>Scas_574.2
          Length = 222

 Score =  142 bits (359), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 116/180 (64%), Gaps = 8/180 (4%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEI 60
           + ++K+V LG+  VGK+S++ RF+ D+FD++ ++TIG  FLS+T+ L    D++ ++ ++
Sbjct: 8   LTKYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYL----DDKTIRLQL 63

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVG 120
           WDTAGQER++SL P Y R++  A+VVYD+T+  S      W++++K +  DD +I+C+VG
Sbjct: 64  WDTAGQERFRSLIPSYIRDSRVAIVVYDITKKKSFEYIDKWIEDVKNERGDDNVILCIVG 123

Query: 121 NKLDLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERL-YLQNKD 179
           NK DL  ER+ T    E  A+    +   +F + S K G NV  +F+ I + L   QN D
Sbjct: 124 NKSDLSDERQVTIEEGENKAKILGAD---IFMETSTKAGYNVKNLFKKIAKSLPEFQNSD 180

>AEL187C [2319] [Homologous to ScYBR264C (YPT10) - SH]
           (284984..285610) [627 bp, 208 aa]
          Length = 208

 Score =  141 bits (355), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 84/191 (43%), Positives = 113/191 (59%), Gaps = 29/191 (15%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDE------- 53
             Q KLVLLG+SSVGKSSIV RF    F +  ++TIGAAF +++++  E+  +       
Sbjct: 6   CCQVKLVLLGESSVGKSSIVTRFTTGEFRK-NQATIGAAFTTRSVQWEEDAGDGSDAKEV 64

Query: 54  QVLKFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVND-- 111
           + + FEIWDTAGQERY+SLAPMYYRN + ALVVYDVTE  S   A+ W+DEL   + +  
Sbjct: 65  RSVTFEIWDTAGQERYRSLAPMYYRNTDVALVVYDVTEQQSFQNARSWIDELNTYIGEAQ 124

Query: 112 -DKLIICLVGNKLDLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIG 170
            + +++ +VGNK+DL        L     +  F          VSAKTGE + ++F DI 
Sbjct: 125 RNDVVVRIVGNKIDL---HAGGQLEQPLPSATF----------VSAKTGEGIEELFMDIA 171

Query: 171 -----ERLYLQ 176
                ER  LQ
Sbjct: 172 KHVKPERFVLQ 182

>Sklu_2293.3 YLR262C, Contig c2293 4975-5619
          Length = 214

 Score =  141 bits (355), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 76/202 (37%), Positives = 125/202 (61%), Gaps = 13/202 (6%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEI 60
           + ++K+V LG+  VGK+S++ RF+ D+FD++ ++TIG  FLS+T+ L    D++ ++ ++
Sbjct: 10  LTKYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYL----DDKTIRLQL 65

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVG 120
           WDTAGQER++SL P Y R+++ A+VVYDVT   S      W++++K +  ++ +I+C+VG
Sbjct: 66  WDTAGQERFRSLIPSYIRDSHVAIVVYDVTNKKSFEYIDKWIEDVKSERGEENVILCIVG 125

Query: 121 NKLDLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERL-YLQNKD 179
           NK DLV ER+ ++   E   R+    N  +F + S K G NV  +F+ I + L   QN  
Sbjct: 126 NKNDLVDERQVST---EEGERKAQVLNAKIFMETSTKAGFNVKNLFKKIAKSLPEFQN-- 180

Query: 180 KIQESKKPNNNNISLQRPSTND 201
               S  P +N  S  +P   D
Sbjct: 181 ---SSYSPLDNEQSENKPGVID 199

>CAGL0K09394g complement(929234..929899) highly similar to sp|P51996
           Saccharomyces cerevisiae YGL210w YPT32 or sp|P38555
           Saccharomyces cerevisiae YER031c YPT31, start by
           similarity
          Length = 221

 Score =  140 bits (353), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 81/199 (40%), Positives = 118/199 (59%), Gaps = 17/199 (8%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDT 63
           FK+VL+GDS VGKS+++ RF  + F+   +STIG  F ++TIK+    +++ +K +IWDT
Sbjct: 15  FKIVLIGDSGVGKSNLLSRFTTNEFNLESKSTIGVEFATRTIKV----EDKKIKAQIWDT 70

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGNKL 123
           AGQERY+++   YYR A  AL+VYD+++  +      W+ ELKE   DD + I L+GNK 
Sbjct: 71  AGQERYRAITSAYYRGAVGALIVYDISKSGTYENCNHWLTELKENA-DDNVAIGLIGNKS 129

Query: 124 DLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERLY-LQNKDKI- 181
           DL    E    V   +AR FA EN L F + SA   ENV   F+++ E++Y + NK ++ 
Sbjct: 130 DL----EHLRAVPTEEARGFASENQLFFTETSALNSENVDLAFRELIEQIYKMVNKHQVD 185

Query: 182 ------QESKKPNNNNISL 194
                   S  P    ISL
Sbjct: 186 LGENAKGSSGAPKGPTISL 204

>YLR262C (YPT6) [3655] chr12 complement(668246..668893) GTP-binding
           protein involved in the secretory pathway, member of the
           rab family in the ras superfamily [648 bp, 215 aa]
          Length = 215

 Score =  139 bits (350), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 65/173 (37%), Positives = 114/173 (65%), Gaps = 7/173 (4%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEI 60
           + ++K+V LG+  VGK+S++ RF+ D+FD++ ++TIG  FLS+T+ L    D++ ++ ++
Sbjct: 8   LTKYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYL----DDKTIRLQL 63

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVG 120
           WDTAGQER++SL P Y R++  A++VYD+T+  S      W++++K +  D+ +I+C+VG
Sbjct: 64  WDTAGQERFRSLIPSYIRDSRVAIIVYDITKRKSFEYIDKWIEDVKNERGDENVILCIVG 123

Query: 121 NKLDLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERL 173
           NK DL  ER+ ++   E  A+    +   +F + S K G NV  +F+ I + L
Sbjct: 124 NKSDLSDERQISTEEGEKKAKLLGAK---IFMETSTKAGYNVKALFKKIAKSL 173

>CAGL0K06017g complement(586093..586752) highly similar to sp|Q99260
           Saccharomyces cerevisiae YLR262c GTP-binding protein,
           start by similarity
          Length = 219

 Score =  139 bits (349), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 67/173 (38%), Positives = 113/173 (65%), Gaps = 7/173 (4%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEI 60
           + ++K+V LG+  VGK+S++ RF+ D+FD+  ++TIG  FLS+T+ L    D++ ++ ++
Sbjct: 9   LTKYKIVFLGEQGVGKTSLITRFMYDTFDDNYQATIGIDFLSKTMYL----DDKTIRLQL 64

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVG 120
           WDTAGQER++SL P Y R++  A+VVYD+T+  S      W++++K +   + +I+C+VG
Sbjct: 65  WDTAGQERFRSLIPSYIRDSRVAIVVYDITKRKSFEFIDKWIEDVKNERGAENVILCVVG 124

Query: 121 NKLDLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERL 173
           NK DL  ER+ T+   E  A++   +   +F Q S K G NV  +F+ I + L
Sbjct: 125 NKSDLADERQVTAEEGEKKAQDLGAK---IFMQTSTKVGYNVKNLFKKIAKSL 174

>AGR257C [4568] [Homologous to ScYLR262C (YPT6) - SH]
           (1225886..1226548) [663 bp, 220 aa]
          Length = 220

 Score =  139 bits (349), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 69/171 (40%), Positives = 113/171 (66%), Gaps = 7/171 (4%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWD 62
           ++K+V LG+  VGK+S++ RF+ D+FD++ ++TIG  FLS+T+ L    D++ ++ ++WD
Sbjct: 12  KYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTVYL----DDRTIRLQLWD 67

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGNK 122
           TAGQER++SL P Y R+++ A+VVYD+T   S      WV++++ +  ++ LI+C+VGNK
Sbjct: 68  TAGQERFRSLIPSYIRDSHVAIVVYDITNKKSFEYIDKWVEDVRNERGEENLILCIVGNK 127

Query: 123 LDLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERL 173
            DLV ER+ T    E  A+     N  +F + S K G NV  +F+ I + L
Sbjct: 128 SDLVDERKVTVEEGENKAKLL---NAKIFVETSTKAGFNVGALFKRIAKLL 175

>Scas_712.41
          Length = 219

 Score =  137 bits (346), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 75/196 (38%), Positives = 118/196 (60%), Gaps = 10/196 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDT 63
           FK+VL+GDS VGKS+++ RF  + F+   +STIG  F ++TI    E + + +K +IWDT
Sbjct: 14  FKIVLIGDSGVGKSNLLSRFTTNEFNIESKSTIGVEFATRTI----EVEGKKIKAQIWDT 69

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGNKL 123
           AGQERY+++   YYR A  AL+VYD+++  +      W+ EL++   DD + + L+GNK 
Sbjct: 70  AGQERYRAITSAYYRGAVGALIVYDISKSGTYENCNHWLKELRDNA-DDNVAVGLIGNKS 128

Query: 124 DLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERLY-LQNKDKIQ 182
           DL   R     V  A+A+ FA EN LLF + SA   ENV + F+++   +Y + +K ++ 
Sbjct: 129 DLAHLRA----VPTAEAKNFASENELLFTETSALNSENVDQAFRELITAIYQMVSKHQVD 184

Query: 183 ESKKPNNNNISLQRPS 198
                NN   + + P+
Sbjct: 185 LGDSGNNAAAAPKGPT 200

>Kwal_56.22555
          Length = 212

 Score =  137 bits (345), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 67/173 (38%), Positives = 114/173 (65%), Gaps = 7/173 (4%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEI 60
           + ++K+V LG+  VGK+S++ RF+ D+FD++ ++TIG  FLS+T+ L    D++ ++ ++
Sbjct: 10  LTKYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYL----DDKTIRLQL 65

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVG 120
           WDTAGQER++SL P Y R+++ A+VVYDVT   S      WV+++K +  ++ +++C+VG
Sbjct: 66  WDTAGQERFRSLIPSYIRDSHVAIVVYDVTNKKSFEYIDKWVEDVKSERGEENVVLCIVG 125

Query: 121 NKLDLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERL 173
           NK DL  ER+ ++   E   R+    N  +F + S K G NV  +F+ I + L
Sbjct: 126 NKNDLSDERQVST---EEGERKAQVLNAKIFIETSTKAGFNVKNLFRKIAKTL 175

>YGL210W (YPT32) [1786] chr7 (93795..94463) GTP-binding protein
           required in the secretory pathway at the stage of
           formation of trans-Golgi vesicles, member of the rab
           family in the ras superfamily [669 bp, 222 aa]
          Length = 222

 Score =  137 bits (344), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 77/195 (39%), Positives = 116/195 (59%), Gaps = 10/195 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDT 63
           FK+VL+GDS VGKS+++ RF  D F+   +STIG  F ++TI    E + + +K +IWDT
Sbjct: 14  FKIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTI----EVENKKIKAQIWDT 69

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGNKL 123
           AGQERY+++   YYR A  AL+VYD+++  S      W+ EL+E   DD + + L+GNK 
Sbjct: 70  AGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENA-DDNVAVGLIGNKS 128

Query: 124 DLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERLY-LQNKDKIQ 182
           DL   R     V   +A+ FA EN +LF + SA   +NV K F+++   ++ + +K ++ 
Sbjct: 129 DLAHLRA----VPTDEAKNFAMENQMLFTETSALNSDNVDKAFRELIVAIFQMVSKHQVD 184

Query: 183 ESKKPNNNNISLQRP 197
            S    NN  S   P
Sbjct: 185 LSGSGTNNMGSNGAP 199

>YBR264C (YPT10) [444] chr2 complement(737727..738326) Member of the
           rab family in the ras superfamily of small GTP-binding
           proteins [600 bp, 199 aa]
          Length = 199

 Score =  135 bits (340), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 75/160 (46%), Positives = 103/160 (64%), Gaps = 10/160 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKL--SEEYDEQVLKFEIW 61
            K+VLLGDSSVGK+SIV R     F     +TIGAAF+++TI++  ++   E+ +  EIW
Sbjct: 5   IKVVLLGDSSVGKTSIVTRLKSGKFLAKHAATIGAAFITKTIEVPSNDSSTEKRIHMEIW 64

Query: 62  DTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGN 121
           DTAGQERYKSL PMYYR+AN AL+V+++ +  SL  AK W  +L+++    ++II  VGN
Sbjct: 65  DTAGQERYKSLVPMYYRDANIALIVFELGDVSSLQCAKTWFQDLQDRAQGTQVII--VGN 122

Query: 122 KLDLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGEN 161
           K DLV E  S  +   A+ +       L +  VSAKTG N
Sbjct: 123 KYDLVCEEHSGEVTIPAELQ------GLPYVAVSAKTGYN 156

>AER434C [2934] [Homologous to ScYGL210W (YPT32) - SH; ScYER031C
           (YPT31) - SH] (1466442..1467052,1467106..1467154) [660
           bp, 219 aa]
          Length = 219

 Score =  135 bits (341), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 78/196 (39%), Positives = 115/196 (58%), Gaps = 10/196 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDT 63
           FK+VL+GDS VGKS+++ RF  D F+   +STIG  F ++TI    E + + +K +IWDT
Sbjct: 15  FKIVLIGDSGVGKSNLLSRFTTDEFNVNSKSTIGVEFATRTI----EVEGKKVKAQIWDT 70

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGNKL 123
           AGQERY+++   YYR A  AL+VYD+++  S      W+ EL+E   D+ + + L+GNK 
Sbjct: 71  AGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENA-DENVAVGLIGNKS 129

Query: 124 DLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERLYLQNKDKIQE 183
           DL   R     V   +A+ FAQ N +LF + SA   ENV   F+++   +Y Q   K Q 
Sbjct: 130 DLAHLRA----VPTDEAKNFAQGNQMLFTETSALNAENVDLAFRELITAIY-QMVSKNQV 184

Query: 184 SKKPNNNNISLQRPST 199
               NN + ++ R  T
Sbjct: 185 DLSENNGSGTVPRGPT 200

>KLLA0F01232g complement(114430..115062) similar to sp|P36019
           Saccharomyces cerevisiae YNL093w YPT53 GTP-binding
           protein of the RAB family (RAS superfamily), start by
           similarity
          Length = 210

 Score =  135 bits (340), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 89/205 (43%), Positives = 123/205 (60%), Gaps = 21/205 (10%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKL--SEEYDEQVLKFEIWD 62
           KLVLLG+SSVGKS+IV RF    F      TIGAAF ++ ++   SE+  ++ + FEIWD
Sbjct: 11  KLVLLGESSVGKSTIVTRFTTGEF-HINSPTIGAAFSTKAMEWVDSEDGIKRRVNFEIWD 69

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVND---DKLIICLV 119
           TAGQERY+SLAPMYYRN + AL+V+DVT+  S  KA+ W+DEL   + D   D + + +V
Sbjct: 70  TAGQERYRSLAPMYYRNTDVALIVFDVTQLASEKKAQSWIDELNNYLEDYKKDTVQLRVV 129

Query: 120 GNKLDLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERLYLQNKD 179
           GNK+DLV E    +L +  DA             VSAKTGE + ++F  IG+ + +    
Sbjct: 130 GNKIDLVDEE---TLQNWNDA-----------ELVSAKTGEGIDELFLKIGKDIPIDKFT 175

Query: 180 KIQESKKPNNNNISLQRPSTNDSQS 204
            +QE   P + + S +    N  QS
Sbjct: 176 LLQED-VPQSTSTSNEGGGINLEQS 199

>CAGL0C02453g 247493..248149 highly similar to sp|P38555
           Saccharomyces cerevisiae YER031c YPT31, start by
           similarity
          Length = 218

 Score =  135 bits (340), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 80/207 (38%), Positives = 119/207 (57%), Gaps = 21/207 (10%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDT 63
           FK+VL+GDS VGKS+++ RF  + F+   +STIG  F ++TI +    D + +K +IWDT
Sbjct: 14  FKIVLIGDSGVGKSNLLSRFTTNEFNIDSKSTIGVEFATRTIDV----DGKKIKAQIWDT 69

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGNKL 123
           AGQERY+++   YYR A  AL+VYD+++  S      W+ EL+E   DD + + L+GNK 
Sbjct: 70  AGQERYRAITSAYYRGAVGALIVYDISKSSSYENCHHWLSELRENA-DDNVAVGLIGNKS 128

Query: 124 DLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERLY--------- 174
           DL   R     V   +A++FA EN LLF + SA   +NV   F+++   ++         
Sbjct: 129 DLAHLRA----VPTEEAKQFASENQLLFTETSALNSDNVDLAFKELITAIHQKVSKHQVE 184

Query: 175 LQNKDKIQESKKPNNNNISLQRPSTND 201
           L N +K      PN   ISL  P+ N+
Sbjct: 185 LSNANK--PGAGPNGPTISLT-PAPNE 208

>CAGL0I09306g complement(897087..897707) similar to sp|P38146
           Saccharomyces cerevisiae YBR264c GTP-binding protein,
           hypothetical start
          Length = 206

 Score =  133 bits (334), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 72/169 (42%), Positives = 107/169 (63%), Gaps = 13/169 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDT 63
            K+VLLG+S+VGKS+IV RF    +     +TIGAA++++ ++   + D   ++ EIWDT
Sbjct: 11  LKVVLLGESAVGKSAIVTRFSTGKYLR-NNATIGAAYVTKDLEYIRDGDVYQVRLEIWDT 69

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVND---DKLIICLVG 120
           AGQERY+SL PMYYRN + A+VV+DV+   SL  A  W+DEL   V +   +++ I LVG
Sbjct: 70  AGQERYRSLTPMYYRNTDVAIVVFDVSNLRSLSMAHKWIDELNTYVENKGRERINIVLVG 129

Query: 121 NKLDLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDI 169
           NK+DL S+ E ++L    + +         F  VSAK+GE + ++F  I
Sbjct: 130 NKMDLCSDEERSTLPQRVEEQ---------FQAVSAKSGEGIEELFDHI 169

>KLLA0F20471g 1901749..1902387 highly similar to sp|Q99260
           Saccharomyces cerevisiae YLR262c YPT6 GTP-binding
           protein of the rab family, start by similarity
          Length = 212

 Score =  133 bits (334), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 68/173 (39%), Positives = 113/173 (65%), Gaps = 7/173 (4%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEI 60
           + ++K+V LG+  VGK+S++ RF+ D+FD+  ++TIG  FLS+T+ L    D++ ++ ++
Sbjct: 9   LRKYKIVFLGEQGVGKTSLITRFMYDTFDDNYQATIGIDFLSKTMYL----DDKTIRLQL 64

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVG 120
           WDTAGQER++SL P Y R+++ A+VVYDVT   S      W++++K +  ++ +I+ +VG
Sbjct: 65  WDTAGQERFRSLIPSYIRDSHVAIVVYDVTNRKSFEYIDKWIEDVKMERGEENVILVIVG 124

Query: 121 NKLDLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERL 173
           NK DLV ER+ ++   E   R+    N  LF + S K G NV  +F+ I + L
Sbjct: 125 NKSDLVEERQVST---EEGERKSTVLNAKLFIETSTKAGFNVKTLFKKIAKLL 174

>Scas_203.2
          Length = 251

 Score =  132 bits (332), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 111/175 (63%), Gaps = 19/175 (10%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIW 61
            + K VLLG+SSVG++SIV RF      + R   IGAAFL++ I+  +E +   +  EIW
Sbjct: 46  CRLKFVLLGESSVGRTSIVTRFTTGKIPKKRMLPIGAAFLNKNIRWVDEDNIYEVDLEIW 105

Query: 62  DTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDK---LIICL 118
           DTAGQERY+SLAP+YYRN + AL+V+DVT  ++  KA+ WVDEL+  +++++   + + L
Sbjct: 106 DTAGQERYRSLAPIYYRNTDVALIVFDVTSSNTFQKARSWVDELRSYLDNEQGKEIQLYL 165

Query: 119 VGNKLDLVSERES---TSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIG 170
           +GNK DL  E ES   T+++D              F +VSAK  E + ++F++I 
Sbjct: 166 IGNKCDL--EHESIAKTAILDMC-----------TFKEVSAKRDEGIQELFEEIA 207

>CAGL0K12672g 1255541..1256161 highly similar to sp|P01123
           Saccharomyces cerevisiae YFL038c YPT1, start by
           similarity
          Length = 206

 Score =  125 bits (313), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 75/205 (36%), Positives = 122/205 (59%), Gaps = 14/205 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDT 63
           FKL+L+G+S VGKS ++ RF  D++     STIG  F  +T++L    D + +K +IWDT
Sbjct: 9   FKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVEL----DGKTVKLQIWDT 64

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGNKL 123
           AGQER++++   YYR ++  ++VYDVT+ +S    K+W+ E+ ++     ++  LVGNK 
Sbjct: 65  AGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEI-DRYATSTVLKLLVGNKC 123

Query: 124 DLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVF----QDIGERLYLQNKD 179
           DL  +R    +V+   A+EFA+ N + F + SA    NV + F    + I E +  QN +
Sbjct: 124 DLADKR----VVEYDVAKEFAEANKMPFLETSALDSTNVEEAFLTMARQIKESMTQQNMN 179

Query: 180 KIQESKKPNNNNISLQRPSTNDSQS 204
           + Q+ KK +  N++L+  S   S S
Sbjct: 180 ESQQ-KKNDKGNVNLKGQSLTQSGS 203

>Kwal_14.1116
          Length = 204

 Score =  121 bits (304), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 75/205 (36%), Positives = 120/205 (58%), Gaps = 16/205 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDT 63
           FKL+L+GDS VGKS ++ RF  D++     STIG  F  +T++L    D + +K +IWDT
Sbjct: 9   FKLLLIGDSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVEL----DGKTVKLQIWDT 64

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGNKL 123
           AGQER++++   YYR A+  ++VYDVT+ DS    K+W+ E+ ++     ++  +VGNK 
Sbjct: 65  AGQERFRTITSSYYRGAHGIIIVYDVTDHDSFNDVKMWLQEI-DRYATAGVLKLMVGNKS 123

Query: 124 DLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVF----QDIGERLYLQNKD 179
           DL  +R    +V+   A+EFA    + F + SA    NV + F    + I E +  Q++D
Sbjct: 124 DLQDKR----MVEYDVAKEFADSLQIPFLETSALDSSNVEEAFLTMAKQIKESMAQQHRD 179

Query: 180 KIQESKKPNNNNISLQRPSTNDSQS 204
                KK +  N++L+  S ++S S
Sbjct: 180 T---GKKDDKANVNLKGQSLSNSSS 201

>CAGL0E02607g complement(248761..249387) highly similar to sp|P32939
           Saccharomyces cerevisiae YML001w YPT7 GTP-binding
           protein of the RAB family, start by similarity
          Length = 208

 Score =  120 bits (301), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 69/205 (33%), Positives = 117/205 (57%), Gaps = 10/205 (4%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDT 63
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + L    D++V+  ++WDT
Sbjct: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLD---DDKVVTMQVWDT 65

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVN---DDKLIICLVG 120
           AGQER++SL   +YR A+  ++VYDVT   S    K W DE     N    +     ++G
Sbjct: 66  AGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILG 125

Query: 121 NKLDLVSERESTSLVDEADAREFAQE-NNLLFHQVSAKTGENVIKVFQDIGERLYLQNKD 179
           NK+D+    +S  +V E   +E A+   ++     SAK+  NV   F++I +    QN++
Sbjct: 126 NKVDI---EDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQN 182

Query: 180 KIQESKKPNNNNISLQRPSTNDSQS 204
                +   N+ I++Q    ++S S
Sbjct: 183 DAHAFEDDFNDAINIQLEGESNSCS 207

>Scas_713.5
          Length = 211

 Score =  119 bits (298), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 67/188 (35%), Positives = 107/188 (56%), Gaps = 9/188 (4%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDT 63
           FKL+L+G+S VGKS ++ RF  D++     STIG  F  +T++L    D + +K +IWDT
Sbjct: 9   FKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVEL----DGKTVKLQIWDT 64

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGNKL 123
           AGQER++++   YYR ++  ++VYDVT+ DS    K+W+ E+ ++     ++  LVGNK 
Sbjct: 65  AGQERFRTITSSYYRGSHGIIIVYDVTDQDSFNGVKMWLQEI-DRYATSTVLKLLVGNKC 123

Query: 124 DLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERLYLQNKDKIQE 183
           DL  +R    +V+   A+EFA  N + F + SA    NV + F  +  ++      +  E
Sbjct: 124 DLTDKR----VVEYDVAKEFADANKMPFLETSALNSTNVEEAFLTMARQIKESMSQQKME 179

Query: 184 SKKPNNNN 191
               N  N
Sbjct: 180 DGGANGGN 187

>YFL038C (YPT1) [1645] chr6 complement(55365..55985) GTP-binding
           protein required for vesicle transport from ER to Golgi
           and within the Golgi stack, member of the rab family in
           the ras superfamily of GTP-binding proteins [621 bp, 206
           aa]
          Length = 206

 Score =  119 bits (298), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 72/203 (35%), Positives = 119/203 (58%), Gaps = 14/203 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDT 63
           FKL+L+G+S VGKS ++ RF  D++     STIG  F  +T++L    D + +K +IWDT
Sbjct: 9   FKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVEL----DGKTVKLQIWDT 64

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGNKL 123
           AGQER++++   YYR ++  ++VYDVT+ +S    K+W+ E+ ++     ++  LVGNK 
Sbjct: 65  AGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEI-DRYATSTVLKLLVGNKC 123

Query: 124 DLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVF----QDIGERLYLQNKD 179
           DL  +R    +V+   A+EFA  N + F + SA    NV   F    + I E +  QN +
Sbjct: 124 DLKDKR----VVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLN 179

Query: 180 KIQESKKPNNNNISLQRPSTNDS 202
           +  + KK +  N++L+  S  ++
Sbjct: 180 ETTQ-KKEDKGNVNLKGQSLTNT 201

>KLLA0D05313g 459496..460110 gi|10129780|emb|CAC08198.1
           Kluyveromyces lactis putative GTP-binding protein, start
           by similarity
          Length = 204

 Score =  119 bits (297), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 72/191 (37%), Positives = 109/191 (57%), Gaps = 13/191 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDT 63
           FKL+L+GDS VGKS ++ RF  D++     STIG  F  +T++L    D + +K +IWDT
Sbjct: 9   FKLLLIGDSGVGKSCLLLRFADDTYTNDYISTIGVDFKIKTVEL----DGKTVKLQIWDT 64

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGNKL 123
           AGQER++++   YYR A+  ++VYDVT+ +S    K W+ E+ ++     ++  LVGNK 
Sbjct: 65  AGQERFRTITSSYYRGAHGIIIVYDVTDQESFNNVKTWLQEI-DRFGTAGVLKLLVGNKN 123

Query: 124 DLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVF----QDIGERLYLQNKD 179
           DL  ++    +VD   A+EFA    + F + SA    NV + F    + I E +  Q KD
Sbjct: 124 DLTDKK----VVDTEVAKEFADSIGIPFIETSALDSSNVEEAFLIMTKQIKESVAKQQKD 179

Query: 180 KIQESKKPNNN 190
             +   K N N
Sbjct: 180 NGRAEDKSNVN 190

>YML001W (YPT7) [3965] chr13 (267174..267800) GTP-binding protein
           with a role in protein transport between endosome-like
           compartments, member of the rab family in the ras
           superfamily [627 bp, 208 aa]
          Length = 208

 Score =  119 bits (297), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 69/205 (33%), Positives = 113/205 (55%), Gaps = 10/205 (4%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDT 63
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + +     ++V   ++WDT
Sbjct: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVD---GDKVATMQVWDT 65

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVN---DDKLIICLVG 120
           AGQER++SL   +YR A+  ++VYDVT   S    K W DE     N    +     ++G
Sbjct: 66  AGQERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETFPFVILG 125

Query: 121 NKLDLVSERESTSLVDEADAREFAQE-NNLLFHQVSAKTGENVIKVFQDIGERLYLQNKD 179
           NK+D     ES  +V E  A+E A+   ++     SAK   NV   F++I      QN+ 
Sbjct: 126 NKID---AEESKKIVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIARSALQQNQA 182

Query: 180 KIQESKKPNNNNISLQRPSTNDSQS 204
             +  +   N+ I+++    N+S S
Sbjct: 183 DTEAFEDDYNDAINIRLDGENNSCS 207

>ABR220W [814] [Homologous to ScYFL038C (YPT1) - SH]
           complement(817290..817904) [615 bp, 204 aa]
          Length = 204

 Score =  117 bits (292), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 74/203 (36%), Positives = 116/203 (57%), Gaps = 16/203 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDT 63
           FKL+L+GDS VGKS ++ RF  D++     STIG  F  +T++L    D + +K +IWDT
Sbjct: 9   FKLLLIGDSGVGKSCLLLRFADDTYTNDYISTIGVDFKIKTVEL----DGKTVKLQIWDT 64

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGNKL 123
           AGQER++++   YYR A+  ++VYDVT+ +S    K W+ E+ ++     ++  LVGNK 
Sbjct: 65  AGQERFRTITSSYYRGAHGIIIVYDVTDQESFDNMKTWLQEI-DRYGTAGVVKLLVGNKN 123

Query: 124 DLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVF----QDIGERLYLQNKD 179
           DL  ++    +VD   AREFA   N+   + SA    NV + F    + I E +  Q K 
Sbjct: 124 DLKDKK----VVDFEVAREFADSLNIPVLETSALDSSNVEEAFLTMARQIKETMSHQQK- 178

Query: 180 KIQESKKPNNNNISLQRPSTNDS 202
             +  KK + + ++L+  S  +S
Sbjct: 179 --ESGKKDDKSGVNLKGQSLANS 199

>Sklu_2373.3 YML001W, Contig c2373 10977-11603
          Length = 208

 Score =  116 bits (290), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 110/196 (56%), Gaps = 10/196 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDT 63
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + + E+   +V   ++WDT
Sbjct: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDED---KVATMQVWDT 65

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVN---DDKLIICLVG 120
           AGQER++SL   +YR A+  ++VYDVT   S    K W DE     N    +     ++G
Sbjct: 66  AGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPESFPFVILG 125

Query: 121 NKLDLVSERESTSLVDEADAREFAQE-NNLLFHQVSAKTGENVIKVFQDIGERLYLQNKD 179
           NK+D+    ES  +V+   A+E A+   N+     SAK   NV   F++I      Q++ 
Sbjct: 126 NKIDV---EESKKVVNTRSAQELAKSLGNVPLFLTSAKGSINVETAFEEIARSALQQSQA 182

Query: 180 KIQESKKPNNNNISLQ 195
                +   N+ I++Q
Sbjct: 183 DADAFEDDFNDAINIQ 198

>Kwal_56.22440
          Length = 208

 Score =  115 bits (288), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 108/196 (55%), Gaps = 10/196 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDT 63
            K+++LGDS VGK+S++HR+V D F +  ++TIGA FL++ + +     ++V   ++WDT
Sbjct: 9   LKVIILGDSGVGKTSLMHRYVSDKFSQQYKATIGADFLTKEVSMD---GDKVATMQVWDT 65

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVN---DDKLIICLVG 120
           AGQER++SL   +YR A+  ++VYDVT   S    K W DE     N    +     ++G
Sbjct: 66  AGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILG 125

Query: 121 NKLDLVSERESTSLVDEADAREFAQE-NNLLFHQVSAKTGENVIKVFQDIGERLYLQNKD 179
           NKLD+    ES  +V    A++ A+   N+     SAK   NV   F++I      Q++ 
Sbjct: 126 NKLDV---EESKKVVSNRSAQDMAKSLGNIPLFLTSAKGSINVDTAFEEIARNALQQSQA 182

Query: 180 KIQESKKPNNNNISLQ 195
                +   N+ I++Q
Sbjct: 183 DADAFEDDFNDAINIQ 198

>ACR003C [1051] [Homologous to ScYML001W (YPT7) - SH]
           (359762..360388) [627 bp, 208 aa]
          Length = 208

 Score =  115 bits (287), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 66/196 (33%), Positives = 109/196 (55%), Gaps = 10/196 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDT 63
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + +     ++V   ++WDT
Sbjct: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVD---GDKVATMQVWDT 65

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVN---DDKLIICLVG 120
           AGQER++SL   +YR A+  ++VYDVT   S    K W DE     N    +     ++G
Sbjct: 66  AGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENVKSWRDEFLVHANVPSPESFPFVILG 125

Query: 121 NKLDLVSERESTSLVDEADAREFAQE-NNLLFHQVSAKTGENVIKVFQDIGERLYLQNKD 179
           NK+D+    ES  +V    ++E A+   N+ F   SAK   NV   F++I      Q++ 
Sbjct: 126 NKIDV---EESKKVVTTRTSQELAKSLGNIPFFLTSAKNAINVDDAFEEIARSALQQSQA 182

Query: 180 KIQESKKPNNNNISLQ 195
                +   N+ I++Q
Sbjct: 183 DAGAYEDDFNDAINIQ 198

>Scas_674.5
          Length = 208

 Score =  115 bits (287), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 101/179 (56%), Gaps = 10/179 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDT 63
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + +    D++V   ++WDT
Sbjct: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTID---DDKVATMQVWDT 65

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVN---DDKLIICLVG 120
           AGQER++SL   +YR A+  ++VYDVT   S    K W DE     N    +     ++G
Sbjct: 66  AGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILG 125

Query: 121 NKLDLVSERESTSLVDEADAREFAQE-NNLLFHQVSAKTGENVIKVFQDIGERLYLQNK 178
           NK+D+    E+  +V    A+E A+   N      SAK   N+   F++I      QN+
Sbjct: 126 NKVDI---DETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQQNQ 181

>Sklu_2144.3 YFL038C, Contig c2144 4079-4693
          Length = 204

 Score =  111 bits (278), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 68/191 (35%), Positives = 108/191 (56%), Gaps = 13/191 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDT 63
           FKL+L+GDS VGKS ++ RF  D++     STIG  F  +T+ L    D + +K +IWDT
Sbjct: 9   FKLLLIGDSGVGKSCLLLRFADDTYTNDYISTIGVDFKIKTVDL----DGKTVKLQIWDT 64

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGNKL 123
           AGQER++++   YYR A+  ++VYDVT+ +S    K W+ E+ ++     ++  LVGNK 
Sbjct: 65  AGQERFRTITSSYYRGAHGIIIVYDVTDQESFNNVKTWLQEI-DRYGTAGVLKLLVGNKN 123

Query: 124 DLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVF----QDIGERLYLQNKD 179
           DL  ++    +V+   A+EFA    +   + SA    NV + F    + I E +  Q +D
Sbjct: 124 DLTDKK----VVEYEVAKEFADSLQIPVLETSALDSSNVEEAFLTMARQIKESMSQQQRD 179

Query: 180 KIQESKKPNNN 190
             ++ +K   N
Sbjct: 180 NGKKEEKAGVN 190

>KLLA0D01265g 110784..111407 highly similar to sp|P32939
           Saccharomyces cerevisiae YML001w YPT7 GTP-binding
           protein of the RAB family, start by similarity
          Length = 207

 Score =  109 bits (273), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 102/179 (56%), Gaps = 10/179 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDT 63
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + ++   D++V   ++WDT
Sbjct: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVN---DDKVATMQVWDT 64

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVN---DDKLIICLVG 120
           AGQER++SL   +YR A+  ++VYDVT   S    K W DE     N    +     ++ 
Sbjct: 65  AGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILA 124

Query: 121 NKLDLVSERESTSLVDEADAREFAQE-NNLLFHQVSAKTGENVIKVFQDIGERLYLQNK 178
           NK+D+    ES  +V    A+E A+   N+     SAK   NV   F++I      Q++
Sbjct: 125 NKVDV---EESKKVVSSRSAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQ 180

>Kwal_47.19055
          Length = 179

 Score =  108 bits (269), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 62/167 (37%), Positives = 99/167 (59%), Gaps = 10/167 (5%)

Query: 33  ESTIGAAFLSQTIKLSEEYDEQVLKFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTEP 92
           +STIG  F ++TI    E + + +K +IWDTAGQERY+++   YYR A  AL+VYD+++ 
Sbjct: 4   KSTIGVEFATRTI----EVEGKKIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKS 59

Query: 93  DSLPKAKLWVDELKEKVNDDKLIICLVGNKLDLVSERESTSLVDEADAREFAQENNLLFH 152
            S      W+ EL+E   D+ + + L+GNK DL   R     V   +A+ FAQEN LLF 
Sbjct: 60  SSYENCNHWLTELRENA-DENVAVGLIGNKSDLAHLR----AVPTDEAKNFAQENQLLFT 114

Query: 153 QVSAKTGENVIKVFQDIGERLY-LQNKDKIQESKKPNNNNISLQRPS 198
           + SA   ENV + F+++   +Y + +K ++  ++  NN   + + P+
Sbjct: 115 ETSALNSENVDQAFRELISAIYQMVSKHQVDLNEYGNNAGQAPKGPT 161

>CAGL0F02123g 212117..212764 highly similar to sp|P07560
           Saccharomyces cerevisiae YFL005w SEC4, start by
           similarity
          Length = 215

 Score =  107 bits (268), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 71/204 (34%), Positives = 113/204 (55%), Gaps = 15/204 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDT 63
            K++L+GDS VGKS ++ RFV+D F+    +TIG  F  +T+ +    + + +K ++WDT
Sbjct: 21  MKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDI----NGKKVKLQLWDT 76

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGNKL 123
           AGQER++++   YYR A   ++VYDVT+  +    K W   + E  ND+  ++ LVGNK 
Sbjct: 77  AGQERFRTITTAYYRGAMGIILVYDVTDERTFANIKQWFKTVNEHANDEAQLL-LVGNKS 135

Query: 124 DLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERLYLQNKDKIQE 183
           D+      T +V        A+E  L F + SAK  +NV ++F  +  RL +Q K    +
Sbjct: 136 DM-----DTRVVTYEQGEALAKELGLPFIESSAKNDDNVNEIFFTLA-RL-IQEKIDSNK 188

Query: 184 SKKPN---NNNISLQRPSTNDSQS 204
              PN   + NIS+     + S+S
Sbjct: 189 LSGPNSGKDGNISINANKGDSSKS 212

>Sklu_1136.1 YGL210W, Contig c1136 1284-1832
          Length = 182

 Score =  106 bits (265), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 58/142 (40%), Positives = 86/142 (60%), Gaps = 9/142 (6%)

Query: 33  ESTIGAAFLSQTIKLSEEYDEQVLKFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTEP 92
           +STIG  F ++TI    E + + +K +IWDTAGQERY+++   YYR A  AL+VYD+++ 
Sbjct: 4   KSTIGVEFATRTI----EVEGKKIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKS 59

Query: 93  DSLPKAKLWVDELKEKVNDDKLIICLVGNKLDLVSERESTSLVDEADAREFAQENNLLFH 152
           +S      W+ EL+E   D+ + + L+GNK DL   R     V   +A+ FAQEN LLF 
Sbjct: 60  NSYENCNHWLTELRENA-DENVAVGLIGNKSDLAHLR----AVPTDEAKNFAQENQLLFT 114

Query: 153 QVSAKTGENVIKVFQDIGERLY 174
           + SA   ENV   F+++   +Y
Sbjct: 115 ETSALNSENVDLAFRELITAIY 136

>Scas_707.26
          Length = 210

 Score =  107 bits (266), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 60/163 (36%), Positives = 95/163 (58%), Gaps = 10/163 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDT 63
            K++L+GDS VGKS ++ RFV+D F+    +TIG  F  +T+ +    + + +K ++WDT
Sbjct: 17  MKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDI----NGKKVKLQLWDT 72

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGNKL 123
           AGQER++++   YYR A   ++VYDVT+  +    K W   + E  ND+  ++ LVGNK 
Sbjct: 73  AGQERFRTITTAYYRGAMGIILVYDVTDERTFSNVKQWFKTVNEHANDEAQLL-LVGNKS 131

Query: 124 DLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVF 166
           D+      T +V        A+E  L F + SAK  +NV ++F
Sbjct: 132 DM-----DTRVVTYEQGESLAKELGLPFIESSAKNDDNVNEIF 169

>KLLA0E12111g 1075299..1075943 highly similar to sp|P07560
           Saccharomyces cerevisiae YFL005w SEC4 GTP-binding
           protein of the ras superfamily, start by similarity
          Length = 214

 Score =  106 bits (264), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 61/192 (31%), Positives = 105/192 (54%), Gaps = 10/192 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDT 63
            K++LLGDS VGKS ++ RFV+D F     +TIG  F  +T+ ++ +     +K ++WDT
Sbjct: 21  MKILLLGDSGVGKSCLLVRFVEDKFTPTFITTIGIDFKIKTVDINGKR----VKLQLWDT 76

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGNKL 123
           AGQER++++   YYR A   +++YDVT+  +    + W   + +  ++D +++ LVGNK 
Sbjct: 77  AGQERFRTITTAYYRGAMGIVLIYDVTDERTFENIRQWFSTVNQHASED-VVMLLVGNKK 135

Query: 124 DLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERLYLQNKDKIQE 183
           D+      T  V        A+E  + F + SAK   NV ++F  + + +  +  D   E
Sbjct: 136 DM-----DTRTVSYEQGEALAKELGIPFIEASAKDDTNVSEIFFTLAKLIQEKIDDGKME 190

Query: 184 SKKPNNNNISLQ 195
            K     N+S++
Sbjct: 191 GKAEKEGNVSIR 202

>YFL005W (SEC4) [1676] chr6 (130329..130976) GTP-binding protein
           involved in vesicular transport between Golgi and plasma
           membrane, member of the rab family in the ras
           superfamily [648 bp, 215 aa]
          Length = 215

 Score =  105 bits (263), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 59/163 (36%), Positives = 95/163 (58%), Gaps = 10/163 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDT 63
            K++L+GDS VGKS ++ RFV+D F+    +TIG  F  +T+ +    + + +K ++WDT
Sbjct: 21  MKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDI----NGKKVKLQLWDT 76

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGNKL 123
           AGQER++++   YYR A   ++VYDVT+  +    K W   + E  ND+  ++ LVGNK 
Sbjct: 77  AGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDEAQLL-LVGNKS 135

Query: 124 DLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVF 166
           D+      T +V        A+E  + F + SAK  +NV ++F
Sbjct: 136 DM-----ETRVVTADQGEALAKELGIPFIESSAKNDDNVNEIF 173

>Sklu_1815.2 YFL005W, Contig c1815 3148-3789 reverse complement
          Length = 213

 Score =  104 bits (260), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 63/188 (33%), Positives = 104/188 (55%), Gaps = 14/188 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDT 63
            K++L+GDS VGKS ++ RFV+D F     +TIG  F  +T+ +    + + +K ++WDT
Sbjct: 21  MKILLVGDSGVGKSCLLVRFVEDKFSPSFITTIGIDFKIKTVDI----NGKKIKLQLWDT 76

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGNKL 123
           AGQER++++   YYR A   ++VYDVT+  +    K W+  + +  ND+  ++ LVGNK 
Sbjct: 77  AGQERFRTITTAYYRGAMGIILVYDVTDERTFSNIKQWLSTVNQHANDEAQLL-LVGNKS 135

Query: 124 DLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERLYLQNKDKIQE 183
           D+      T  V        ++E  L F + SAK  +NV ++F  + + +    ++KI  
Sbjct: 136 DM-----DTRAVTYEQGEALSKELGLPFVEASAKNDDNVNEIFFTLAKLI----QEKIDN 186

Query: 184 SKKPNNNN 191
            K   N N
Sbjct: 187 DKLVGNTN 194

>Kwal_23.5058
          Length = 213

 Score =  103 bits (256), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 59/163 (36%), Positives = 96/163 (58%), Gaps = 10/163 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDT 63
            K++L+GDS VGKS ++ RFV+D F     +TIG  F  +T+ +    + + +K ++WDT
Sbjct: 21  MKILLVGDSGVGKSCLLVRFVEDKFSPSFITTIGIDFKIKTVDI----NGKKVKLQLWDT 76

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGNKL 123
           AGQER++++   YYR A   ++VYDVT+  +    K W   + +  ND+  ++ LVGNK 
Sbjct: 77  AGQERFRTITTAYYRGAMGIILVYDVTDERTFANVKQWFSTVNQHANDEAQLL-LVGNKS 135

Query: 124 DLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVF 166
           D+ +   ST   D+ ++   A+E  + F + SAK   NV  +F
Sbjct: 136 DMDTRAVST---DQGES--LAKELGIPFVEASAKDDTNVNDIF 173

>Scas_656.2
          Length = 218

 Score =  103 bits (256), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 58/163 (35%), Positives = 95/163 (58%), Gaps = 10/163 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDT 63
            K++L+GDS VGKS ++ RFV++ F+    +TIG  F  +T+ +      + +K ++WDT
Sbjct: 27  MKILLIGDSGVGKSCLLVRFVENKFNPSFITTIGIDFKIKTLDIQG----RKIKLQLWDT 82

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGNKL 123
           AGQER++++   YYR A   ++VYDVT+  +    + W   + E  N +++ + LVGNK 
Sbjct: 83  AGQERFRTITTAYYRGAMGIILVYDVTDERTFQNIRQWYSTVNEHAN-EQVQLLLVGNKS 141

Query: 124 DLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVF 166
           DL + +     V +    E A+E  L F + SAK  +NV  +F
Sbjct: 142 DLGNRQ-----VTKEQGEELARELGLPFMEASAKNDDNVNDLF 179

>AGL021W [4290] [Homologous to ScYFL005W (SEC4) - SH]
           complement(681760..682398) [639 bp, 212 aa]
          Length = 212

 Score =  100 bits (250), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 64/201 (31%), Positives = 107/201 (53%), Gaps = 14/201 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDT 63
            K++L+GDS VGKS ++ RFV+D F     +TIG  F  + + +    + + +K ++WDT
Sbjct: 20  MKILLVGDSGVGKSCLLVRFVEDKFSPSFITTIGIDFKIKAVDI----NGKKIKLQLWDT 75

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGNKL 123
           AGQER++++   YYR A   ++VYDVT+  +    + W   + +  N++  ++ LVGNK 
Sbjct: 76  AGQERFRTITTAYYRGAMGIILVYDVTDERTFENIRQWFTTVNQHANEEAQLL-LVGNKK 134

Query: 124 DLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERLY--LQNKDKI 181
           D+      T  V        A+E  + F + SAK  ENV  +F  + + +   + N   +
Sbjct: 135 DM-----DTRAVTYEQGESLAKELGVPFIEASAKDDENVSDIFFTLAKLIQEKIDNDKLV 189

Query: 182 QESKKPNNNNIS--LQRPSTN 200
             S +  + NIS     PS+N
Sbjct: 190 NNSGREGSVNISSGSNMPSSN 210

>Kwal_33.14015
          Length = 271

 Score = 93.2 bits (230), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 107/204 (52%), Gaps = 13/204 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWD 62
             K+V++GD +VGK+ ++  + +  F E    T+   ++++     +  D  V++  +WD
Sbjct: 65  HLKIVVVGDGAVGKTCLLISYTQGHFPEEYIPTVFENYVTKM----KGPDNTVVELALWD 120

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAK-LWVDELKEKVNDDKLIICLVGN 121
           TAGQE Y  L P+ Y + +  +V Y V    SL   + LW+ E++    D  ++  LVG 
Sbjct: 121 TAGQEEYNRLRPLSYTDVDLLMVCYSVDSKTSLLNVQELWIPEVRHFCPDTPIL--LVGL 178

Query: 122 KLDLVSERESTSLVDEADAREFAQENNLLFH-QVSAKTGENVIKVFQ-DIGERLYLQNKD 179
           K DL +      LVD  +A  FA E+NLL H Q S+K+ +NV ++F   +   LY    D
Sbjct: 179 KSDLYALDNLDKLVDPGEADLFATEHNLLGHYQCSSKSRQNVEELFNVAMATLLY----D 234

Query: 180 KIQESKKPNNNNISLQRPSTNDSQ 203
            +QE K+ +  NI   R    +SQ
Sbjct: 235 PVQERKRISVANIFGPRREFKNSQ 258

>Kwal_56.23361
          Length = 214

 Score = 88.2 bits (217), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 56/170 (32%), Positives = 90/170 (52%), Gaps = 12/170 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDT 63
           FKLVL+GD   GK++ V R +   F++   +TIG     +   L+   D   LKF++WDT
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGV----EVHPLAFYTDFGELKFDVWDT 63

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGNKL 123
           AGQE++  L   YY NA   ++++DVT   +      W  +L     +  +++C  GNK+
Sbjct: 64  AGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLC--GNKV 121

Query: 124 DLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERL 173
           D V ER+      +A    F ++ NL ++ +SAK+  N  K F  +  +L
Sbjct: 122 D-VKERKV-----KAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKL 165

>YOR185C (GSP2) [4981] chr15 complement(681444..682106) Ran, a
           GTP-binding protein member of the ras superfamily
           involved in trafficking through nuclear pores [663 bp,
           220 aa]
          Length = 220

 Score = 88.6 bits (218), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 55/170 (32%), Positives = 90/170 (52%), Gaps = 12/170 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDT 63
           FKLVL+GD   GK++ V R +   F++   +TIG       +     + E  +KF++WDT
Sbjct: 14  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEV--HPLSFYTNFGE--IKFDVWDT 69

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGNKL 123
           AGQE++  L   YY NA  A++++DVT   +      W  +L     +  +++C  GNK+
Sbjct: 70  AGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLC--GNKV 127

Query: 124 DLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERL 173
           D V ER+      +A    F ++ NL ++ +SAK+  N  K F  +  +L
Sbjct: 128 D-VKERKV-----KAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKL 171

>YLR293C (GSP1) [3684] chr12 complement(720773..721432) Ran, a
           GTP-binding protein of the ras superfamily involved in
           trafficking through nuclear pores [660 bp, 219 aa]
          Length = 219

 Score = 88.2 bits (217), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 55/170 (32%), Positives = 90/170 (52%), Gaps = 12/170 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDT 63
           FKLVL+GD   GK++ V R +   F++   +TIG       +     + E  +KF++WDT
Sbjct: 13  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEV--HPLSFYTNFGE--IKFDVWDT 68

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGNKL 123
           AGQE++  L   YY NA  A++++DVT   +      W  +L     +  +++C  GNK+
Sbjct: 69  AGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLC--GNKV 126

Query: 124 DLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERL 173
           D V ER+      +A    F ++ NL ++ +SAK+  N  K F  +  +L
Sbjct: 127 D-VKERKV-----KAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKL 170

>Scas_586.6
          Length = 219

 Score = 87.4 bits (215), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 55/170 (32%), Positives = 88/170 (51%), Gaps = 12/170 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDT 63
           FKLVL+GD   GK++ V R +   F++   +TIG       +     Y E  +KF+ WDT
Sbjct: 13  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEV--HPLSFFTNYGE--IKFDCWDT 68

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGNKL 123
           AGQE++  L   YY NA   ++++DVT   +      W  +L     +  +++C  GNK+
Sbjct: 69  AGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLC--GNKV 126

Query: 124 DLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERL 173
           D V ER+      +A    F ++ NL ++ +SAK+  N  K F  +  +L
Sbjct: 127 D-VKERKV-----KAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKL 170

>CAGL0I00594g 44835..45479 highly similar to sp|P32835 Saccharomyces
           cerevisiae YLR293c GSP1, start by similarity
          Length = 214

 Score = 87.0 bits (214), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 54/170 (31%), Positives = 89/170 (52%), Gaps = 12/170 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDT 63
           FKLVL+GD   GK++ V R +   F++   +TIG       +     + E  +KF++WDT
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEV--HPLAFHTNFGE--IKFDVWDT 63

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGNKL 123
           AGQE++  L   YY NA   ++++DVT   +      W  +L     +  +++C  GNK+
Sbjct: 64  AGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLC--GNKV 121

Query: 124 DLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERL 173
           D V ER+      +A    F ++ NL ++ +SAK+  N  K F  +  +L
Sbjct: 122 D-VKERKV-----KAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKL 165

>AGR294C [4605] [Homologous to ScYOR185C (GSP2) - SH; ScYLR293C
           (GSP1) - SH] (1287042..1287686) [645 bp, 214 aa]
          Length = 214

 Score = 87.0 bits (214), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 54/170 (31%), Positives = 89/170 (52%), Gaps = 12/170 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDT 63
           FKLVL+GD   GK++ V R +   F++   +TIG       +     + E  +KF++WDT
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEV--HPLAFYTNFGE--IKFDVWDT 63

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGNKL 123
           AGQE++  L   YY NA   ++++DVT   +      W  +L     +  +++C  GNK+
Sbjct: 64  AGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLC--GNKV 121

Query: 124 DLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERL 173
           D V ER+      +A    F ++ NL ++ +SAK+  N  K F  +  +L
Sbjct: 122 D-VKERKV-----KAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKL 165

>KLLA0C05126g complement(463657..464301) highly similar to sp|P32836
           Saccharomyces cerevisiae YOR185c GSP2 GTP-binding
           protein of the RAS superfamily, start by similarity
          Length = 214

 Score = 86.7 bits (213), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 54/170 (31%), Positives = 89/170 (52%), Gaps = 12/170 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDT 63
           FKLVL+GD   GK++ V R +   F++   +TIG       +     + E  +KF++WDT
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEV--HPLAFYTNFGE--IKFDVWDT 63

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGNKL 123
           AGQE++  L   YY NA   ++++DVT   +      W  +L     +  +++C  GNK+
Sbjct: 64  AGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLC--GNKV 121

Query: 124 DLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERL 173
           D V ER+      +A    F ++ NL ++ +SAK+  N  K F  +  +L
Sbjct: 122 D-VKERKV-----KAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKL 165

>KLLA0A04499g complement(404732..405376) highly similar to sp|P32836
           Saccharomyces cerevisiae YOR185c GSP2 GTP-binding
           protein of the RAS superfamily, start by similarity
          Length = 214

 Score = 86.7 bits (213), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 54/170 (31%), Positives = 89/170 (52%), Gaps = 12/170 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDT 63
           FKLVL+GD   GK++ V R +   F++   +TIG       +     + E  +KF++WDT
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEV--HPLAFYTNFGE--IKFDVWDT 63

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGNKL 123
           AGQE++  L   YY NA   ++++DVT   +      W  +L     +  +++C  GNK+
Sbjct: 64  AGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLC--GNKV 121

Query: 124 DLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERL 173
           D V ER+      +A    F ++ NL ++ +SAK+  N  K F  +  +L
Sbjct: 122 D-VKERKV-----KAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKL 165

>Sklu_2285.4 YLR293C, Contig c2285 4349-4993 reverse complement
          Length = 214

 Score = 86.7 bits (213), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 54/170 (31%), Positives = 89/170 (52%), Gaps = 12/170 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDT 63
           FKLVL+GD   GK++ V R +   F++   +TIG       +     + E  +KF++WDT
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEV--HPLAFYTNFGE--IKFDVWDT 63

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGNKL 123
           AGQE++  L   YY NA   ++++DVT   +      W  +L     +  +++C  GNK+
Sbjct: 64  AGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLC--GNKV 121

Query: 124 DLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERL 173
           D V ER+      +A    F ++ NL ++ +SAK+  N  K F  +  +L
Sbjct: 122 D-VKERKV-----KAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKL 165

>Scas_444.4*
          Length = 289

 Score = 85.9 bits (211), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 59/168 (35%), Positives = 88/168 (52%), Gaps = 9/168 (5%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIW 61
              K+V++GD  VGK+ ++  +V+  F      T+   +++      E  D +V++  +W
Sbjct: 62  FHVKIVIVGDEGVGKTCLLISYVQREFPTGDIPTVFENYVTD----FEGPDGEVVELALW 117

Query: 62  DTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKL-WVDELKEKVNDDKLIICLVG 120
           DTA QE Y  L P+ Y + +  LV Y V  P SL   K  W+ E+K       +I  LVG
Sbjct: 118 DTAAQEDYNRLRPLSYTDVDILLVCYSVANPTSLKNIKRSWIPEVKHFCYKTPVI--LVG 175

Query: 121 NKLDLVSEREST-SLVDEADAREFAQENNLLFH-QVSAKTGENVIKVF 166
            K DL    E+T +LVD  +A + A++   L H Q SAKT +NV  VF
Sbjct: 176 LKSDLYDSNENTDTLVDPKEAEQLAEKLGALAHLQCSAKTRQNVEDVF 223

>YKR055W (RHO4) [3306] chr11 (547858..548733) GTP-binding protein,
           member of the rho family in the ras superfamily [876 bp,
           291 aa]
          Length = 291

 Score = 84.7 bits (208), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 53/167 (31%), Positives = 86/167 (51%), Gaps = 8/167 (4%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWD 62
             K+V++GD +VGK+ ++  +V+ +F      TI   +++      E  + Q+++  +WD
Sbjct: 72  HLKIVVVGDGAVGKTCLLISYVQGTFPTDYIPTIFENYVTNI----EGPNGQIIELALWD 127

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAK-LWVDELKEKVNDDKLIICLVGN 121
           TAGQE Y  L P+ Y NA+  +V Y V    SL   + LW  E+K       ++  LVG 
Sbjct: 128 TAGQEEYSRLRPLSYTNADVLMVCYSVGSKTSLKNVEDLWFPEVKHFCPSTPIM--LVGL 185

Query: 122 KLDLVSERESTSLVDEADAREFAQENNLLFH-QVSAKTGENVIKVFQ 167
           K DL      + LV+ + A   A+      H Q SA+  EN+ +VF+
Sbjct: 186 KSDLYEADNLSDLVEPSSAESLAKRLGAFAHIQCSARLKENIDEVFE 232

>KLLA0B10626g 936497..937123 gi|22858698|gb|AAN05733.1 Kluyveromyces
           lactis RHO1, start by similarity
          Length = 208

 Score = 80.1 bits (196), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 57/173 (32%), Positives = 89/173 (51%), Gaps = 17/173 (9%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDTA 64
           KLV++GD + GK+ ++  F K  F +    T+   +++       E D + ++  +WDTA
Sbjct: 14  KLVIVGDGACGKTCLLIVFAKGKFPQVYVPTVFDNYVADV-----EVDGRRVELALWDTA 68

Query: 65  GQERYKSLAPMYYRNANAALVVYDVTEPDSLPKA-KLWVDELKEKVNDDKLIICLVGNKL 123
           GQE Y  L P+ Y ++N  L+ Y +  PDSL    + W+ E+        +I  LVG K 
Sbjct: 69  GQEDYDRLRPLSYPDSNVVLICYSIDLPDSLENVMEKWISEVLHFCQGVPII--LVGCKA 126

Query: 124 DL------VSERESTSL--VDEADAREFA-QENNLLFHQVSAKTGENVIKVFQ 167
           DL      V E  +  L  V +A A+E A Q   + + + SAKTG  V +VF+
Sbjct: 127 DLRNDPQVVEELRAQGLQPVSQAQAQEVADQIGAVDYIECSAKTGYGVREVFE 179

>Scas_610.4
          Length = 211

 Score = 79.3 bits (194), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 87/173 (50%), Gaps = 17/173 (9%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDTA 64
           KLV++GD + GK+ ++  F K  F E    T+   +++       E D + ++  +WDTA
Sbjct: 12  KLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVADV-----EVDGRRVELALWDTA 66

Query: 65  GQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAK-LWVDELKEKVNDDKLIICLVGNKL 123
           GQE Y  L P+ Y ++N  L+ + +  PDSL   +  W+ E+        +I  LVG K+
Sbjct: 67  GQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVQEKWIAEVLHFCQGVPII--LVGCKV 124

Query: 124 DLVSE--------RESTSLVDEADAREFA-QENNLLFHQVSAKTGENVIKVFQ 167
           DL ++         E    V  AD +  A Q     +++ SAKTG  V +VF+
Sbjct: 125 DLRNDPQTIEALREEGQQPVSSADGQSVADQIGATGYYECSAKTGFGVREVFE 177

>ACL087C [962] [Homologous to ScYNL090W (RHO2) - SH]
           (191573..192136) [564 bp, 187 aa]
          Length = 187

 Score = 78.6 bits (192), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 90/184 (48%), Gaps = 9/184 (4%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEI 60
           +++ KLV++GD + GK+S++H F    F E    T+   +++         D   ++  +
Sbjct: 5   VVRRKLVIIGDGACGKTSLLHVFTLGKFPEEYLPTVFENYVTDC-----RVDGIKVQLAL 59

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAK-LWVDELKEKVNDDKLIICLV 119
           WDTAGQE Y+ L PM Y  A+  L+ + + +P SL  A+  W  E      +  +I  LV
Sbjct: 60  WDTAGQEEYERLRPMSYSKADIILIGFAIDDPGSLSNAREKWTVEALRYCPNAPII--LV 117

Query: 120 GNKLDLVSERESTSLVDEADAREFAQENNL-LFHQVSAKTGENVIKVFQDIGERLYLQNK 178
           G K DL       ++V  + A+E  +      + + SA TGE V  VF+       L NK
Sbjct: 118 GLKKDLRRPGTQCAMVAPSQAQEVVRAIGAKKYMECSALTGEGVDDVFELATRTSLLVNK 177

Query: 179 DKIQ 182
           +  Q
Sbjct: 178 EPGQ 181

>CAGL0I08459g 829292..829924 highly similar to sp|P06780
           Saccharomyces cerevisiae YPR165w RHO1, start by
           similarity
          Length = 210

 Score = 78.6 bits (192), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 87/173 (50%), Gaps = 17/173 (9%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDTA 64
           KLV++GD + GK+ ++  F K  F E    T+   +++       E D + ++  +WDTA
Sbjct: 12  KLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVADV-----EVDGRRVELALWDTA 66

Query: 65  GQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAK-LWVDELKEKVNDDKLIICLVGNKL 123
           GQE Y  L P+ Y ++N  L+ + +  PDSL   +  W+ E+        +I  LVG K+
Sbjct: 67  GQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVQEKWIAEVLHFCQGVPII--LVGCKV 124

Query: 124 DLVSE--------RESTSLVDEADAREFA-QENNLLFHQVSAKTGENVIKVFQ 167
           DL ++         E    V  AD +  A Q     +++ SAKTG  V +VF+
Sbjct: 125 DLRNDPQTLEQLRAEGLQPVATADGQNVADQIGATGYYECSAKTGYGVREVFE 177

>CAGL0E03113g complement(289164..290135) some similarities with
           sp|P13856 Saccharomyces cerevisiae YGR152c RSR1
           GTP-binding protein, start by similarity
          Length = 323

 Score = 80.5 bits (197), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 67/205 (32%), Positives = 110/205 (53%), Gaps = 19/205 (9%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEI 60
           M  +KLV+LG   VGKSS+  +FV+  + +  + TI  ++  +TI    E D +V   EI
Sbjct: 1   MRDYKLVVLGAGGVGKSSLTVQFVQGVYLDTYDPTIEDSY-RKTI----EIDNKVFDLEI 55

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKV----NDDKLII 116
            DTAG  ++ ++  +Y +     L+VY VT+ DSL +    + ELKE+V    +  ++ +
Sbjct: 56  LDTAGVAQFTAMRELYIKAGMGFLLVYSVTDRDSLRE----LMELKEQVLRIKDSQRVPM 111

Query: 117 CLVGNKLDLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERLYLQ 176
            LVGNK DLV +R    +  E      +Q   + F++ SA    NV +VF D+  ++   
Sbjct: 112 VLVGNKADLVDDR---IIPVEEGIGVSSQWGKVPFYETSALLRSNVDEVFVDLVRQII-- 166

Query: 177 NKDKIQESKKPNNNNISLQRPSTND 201
            +++I+      NN+ SL + S ND
Sbjct: 167 -RNEIETVTNTTNNHPSLSQASLND 190

>ABR183W [776] [Homologous to ScYPR165W (RHO1) - SH]
           complement(755914..756537) [624 bp, 207 aa]
          Length = 207

 Score = 78.2 bits (191), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 89/173 (51%), Gaps = 17/173 (9%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDTA 64
           KLV++GD + GK+ ++  F K  F +    T+   +++       E D + ++  +WDTA
Sbjct: 13  KLVIVGDGACGKTCLLIVFAKGKFPQVYVPTVFDNYVADV-----EVDGRRVELALWDTA 67

Query: 65  GQERYKSLAPMYYRNANAALVVYDVTEPDSLPKA-KLWVDELKEKVNDDKLIICLVGNKL 123
           GQE Y  L P+ Y ++N  L+ Y +  PDSL    + W+ E+        +I  LVG K 
Sbjct: 68  GQEDYDRLRPLSYPDSNVVLICYSIDLPDSLENVMEKWISEVLYFCQGVPII--LVGCKA 125

Query: 124 DLVSE--------RESTSLVDEADAREFA-QENNLLFHQVSAKTGENVIKVFQ 167
           DL ++        ++    V +A A+E A Q   + + + SAKTG  V +VF+
Sbjct: 126 DLRNDPQVIEQLRQQGQQPVSQAQAQEVADQIGAVEYIECSAKTGFGVREVFE 178

>Sklu_1655.1 YKR055W, Contig c1655 395-1258 reverse complement
          Length = 287

 Score = 79.7 bits (195), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 84/167 (50%), Gaps = 8/167 (4%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIW 61
              K+V++GD +VGK+ ++  + +  F      TI   ++S+     +    +V++  +W
Sbjct: 76  CHLKIVVVGDGAVGKTCLLISYTQGRFPTEYVPTIFENYVSKV----QGPRNKVIELALW 131

Query: 62  DTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAK-LWVDELKEKVNDDKLIICLVG 120
           DTAGQE Y  L P+ Y + +  +V Y V    S    + LW  E+K    D  ++  LVG
Sbjct: 132 DTAGQEEYNRLRPLSYTDVDILMVCYSVDSKTSFYNVQELWFPEVKHFCPDAPVM--LVG 189

Query: 121 NKLDLVSERESTSLVDEADAREFAQENNLLFH-QVSAKTGENVIKVF 166
            K DL +      LVD  DA   AQ+     H Q SAK+ +NV +VF
Sbjct: 190 LKSDLYALDNLEQLVDPKDADTLAQQLGAFAHVQCSAKSRDNVDEVF 236

>YPR165W (RHO1) [5580] chr16 (875362..875991) GTP-binding protein
           required to activate the PKC1 pathway and
           beta-1,3-glucan synthase and to coordinate exocyst
           assembly, member of the rho family of the ras
           superfamily [630 bp, 209 aa]
          Length = 209

 Score = 77.8 bits (190), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 57/194 (29%), Positives = 91/194 (46%), Gaps = 34/194 (17%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDTA 64
           KLV++GD + GK+ ++  F K  F E    T+   +++       E D + ++  +WDTA
Sbjct: 12  KLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVADV-----EVDGRRVELALWDTA 66

Query: 65  GQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAK-LWVDELKEKVNDDKLIICLVGNKL 123
           GQE Y  L P+ Y ++N  L+ + +  PDSL   +  W+ E+        +I  LVG K+
Sbjct: 67  GQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVQEKWIAEVLHFCQGVPII--LVGCKV 124

Query: 124 DL-----------------VSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVF 166
           DL                 V+ +E  S+ D+  A          +++ SAKTG  V +VF
Sbjct: 125 DLRNDPQTIEQLRQEGQQPVTSQEGQSVADQIGATG--------YYECSAKTGYGVREVF 176

Query: 167 QDIGERLYLQNKDK 180
            +   R  L  K K
Sbjct: 177 -EAATRASLMGKSK 189

>Sklu_2151.3 YPR165W, Contig c2151 2495-3124 reverse complement
          Length = 209

 Score = 77.8 bits (190), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 56/173 (32%), Positives = 90/173 (52%), Gaps = 17/173 (9%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDTA 64
           KLV++GD + GK+ ++  F K  F +    T+   +++       E D + ++  +WDTA
Sbjct: 14  KLVIVGDGACGKTCLLIVFAKGKFPQVYVPTVFDNYVADV-----EVDGRRVELALWDTA 68

Query: 65  GQERYKSLAPMYYRNANAALVVYDVTEPDSLPKA-KLWVDELKEKVNDDKLIICLVGNKL 123
           GQE Y  L P+ Y ++N  L+ + +  PDSL    + W+ E+        +I  LVG K+
Sbjct: 69  GQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVMEKWISEVLHFCQGVPII--LVGCKV 126

Query: 124 DL-----VSERESTS---LVDEADAREFA-QENNLLFHQVSAKTGENVIKVFQ 167
           DL     V E   T+    V +A A+E A Q   + + + SAKTG  V +VF+
Sbjct: 127 DLRNDPQVVESLRTNGQEPVSQASAQEVADQIGAVEYIECSAKTGFGVREVFE 179

>CAGL0K08316g 838393..839364 some similarities with sp|Q00246
           Saccharomyces cerevisiae YKR055w RHO4 GTP-binding
           protein, hypothetical start
          Length = 323

 Score = 79.3 bits (194), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 91/184 (49%), Gaps = 13/184 (7%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWD 62
             K+V++GD +VGK+S++  +V+  F      TI   +++      +    Q+++  +WD
Sbjct: 83  HLKIVVVGDGAVGKTSLLISYVEKVFKHENIPTIFENYVTNI----QGPKGQIIELALWD 138

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAK-LWVDELKEKVNDDKLIICLVGN 121
           TAGQE Y  L P+ Y  A+  ++ Y +    SL   + +W  E++       ++  LVG 
Sbjct: 139 TAGQEEYSRLRPLSYTGADVLMICYAIDSITSLKNVEDVWFPEVRHFCPGTPVM--LVGL 196

Query: 122 KLDLVSERESTSLVDEADAREFAQENNLLFH-QVSAKTGENVIKVF-----QDIGERLYL 175
           K DL  E    S VD A+A   A++N    H Q SAK    V  VF     + + E+L  
Sbjct: 197 KSDLYEEESCDSKVDPAEADSIAKKNGAFAHIQCSAKLRVKVDNVFYAAINELLAEQLIS 256

Query: 176 QNKD 179
           QN +
Sbjct: 257 QNHN 260

>KLLA0D08327g 708240..709004 similar to sp|P53879 Saccharomyces
           cerevisiae YNL180c RHO5, start by similarity
          Length = 254

 Score = 78.6 bits (192), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 59/190 (31%), Positives = 91/190 (47%), Gaps = 24/190 (12%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEY----DEQVL 56
           M   K V++GD +VGK+S++  +  ++F +    T+   + S TI L + Y    + Q+ 
Sbjct: 1   MRSIKCVIVGDGAVGKTSLLISYTTNTFPQDYIPTVFDNY-STTIALPDPYNPDSEPQIF 59

Query: 57  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKA-KLWVDELKEKVN----- 110
           K  +WDTAGQE Y  L P+ Y   +  L+ + V EP+S       W  E+K   N     
Sbjct: 60  KLNLWDTAGQEEYDRLRPLSYPQTDIFLICFSVNEPNSFENVYDKWFPEIKHSTNFENLD 119

Query: 111 ----DDKLIICLVGNKLDLVSE-------RESTS-LVDEADAREFAQENNLL-FHQVSAK 157
                 KL I LVG K DL  +       +ES S  V +   +E   +  L+ + + SA 
Sbjct: 120 LYHQSGKLPILLVGTKADLRDDDHERDRLQESNSDFVSQQQIQELVNKLGLMGYVECSAA 179

Query: 158 TGENVIKVFQ 167
           T   V +VF+
Sbjct: 180 TQVGVREVFE 189

>Scas_575.10
          Length = 271

 Score = 78.6 bits (192), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 61/209 (29%), Positives = 113/209 (54%), Gaps = 20/209 (9%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEI 60
           M  +KLV+LG   VGKS +  +FV+  + +  + TI  ++  +TI    E D +V   EI
Sbjct: 1   MRDYKLVVLGAGGVGKSCLTVQFVQGIYLDTYDPTIEDSY-RKTI----EIDNKVFDLEI 55

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKV----NDDKLII 116
            DTAG  ++ ++  +Y ++    L+VY VT+P SL +    + EL+E+V    + D++ +
Sbjct: 56  LDTAGVAQFTAMRELYIKSGMGFLLVYSVTDPQSLDE----LMELREQVLRIKDTDRVPM 111

Query: 117 CLVGNKLDLVSERESTSLVDEADAREFAQE-NNLLFHQVSAKTGENVIKVFQDIGERLYL 175
            LVGNK DL  +R    ++   +  E + +   + F++ SA    NV +VF D+  ++  
Sbjct: 112 VLVGNKADLTEDR----VISVEEGIEVSSKWGKVPFYETSALLRSNVDEVFVDLVRQIIR 167

Query: 176 QNKDKI--QESKKPNNNNISLQRPSTNDS 202
              + +   E++ P+  N+S +  S +++
Sbjct: 168 NEMETVAKSEARYPSQQNLSTRNTSRSNT 196

>Scas_691.36
          Length = 212

 Score = 77.0 bits (188), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 89/173 (51%), Gaps = 17/173 (9%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDTA 64
           KLV++GD + GK+ ++  F K  F E    T+   +++       E D + ++  +WDTA
Sbjct: 12  KLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVADV-----EVDGRRVELALWDTA 66

Query: 65  GQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAK-LWVDELKEKVNDDKLIICLVGNKL 123
           GQE Y  L P+ Y ++N  L+ + +  PDSL   +  W+ E+        +I  LVG K+
Sbjct: 67  GQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVQEKWIAEVLHFCQGVPII--LVGCKV 124

Query: 124 DLVSERESTSL--------VDEADAREFAQENNLL-FHQVSAKTGENVIKVFQ 167
           DL ++ ++           V  A+ +  A++     +++ SAKTG  V +VF+
Sbjct: 125 DLRNDPQAIEALRADEQQPVSTAEGQSVAEQIGATGYYECSAKTGLGVREVFE 177

>Kwal_55.21941
          Length = 209

 Score = 76.6 bits (187), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 51/176 (28%), Positives = 91/176 (51%), Gaps = 17/176 (9%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIW 61
           ++ KLV++GD + GK+ ++  F K  F +    T+   +++       E D + ++  +W
Sbjct: 11  IRRKLVIVGDGACGKTCLLIVFAKGKFPQVYVPTVFDNYVADV-----EVDGRRVELALW 65

Query: 62  DTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKA-KLWVDELKEKVNDDKLIICLVG 120
           DTAGQE Y  L P+ Y ++N  L+ + +  PDSL    + W+ E+        +I  LVG
Sbjct: 66  DTAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVMEKWISEVLHFCQGVPII--LVG 123

Query: 121 NKLDLVSERE--------STSLVDEADAREFAQENNLL-FHQVSAKTGENVIKVFQ 167
            K+DL ++ +            V +  A+E A++   + + + SAKTG  V +VF+
Sbjct: 124 CKVDLRNDSQVIENLRANGHEPVSQGAAQEVAEQIGAVEYIECSAKTGYGVREVFE 179

>CAGL0J05632g complement(537342..537908) highly similar to sp|P06781
           Saccharomyces cerevisiae YNL090w RHO2, start by
           similarity
          Length = 188

 Score = 76.3 bits (186), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 58/193 (30%), Positives = 93/193 (48%), Gaps = 17/193 (8%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDTA 64
           KLV++GD + GK+S+++ F    F E    T+   +++         D   +   +WDTA
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGKFPEQYHPTVFENYVTDC-----RVDGIKVSLALWDTA 63

Query: 65  GQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKL-WVDELKEKVNDDKLIICLVGNKL 123
           GQE Y+ L P  Y  A+  L+ + V   +SL  A+  W +E      D  +I  LVG K 
Sbjct: 64  GQEEYERLRPFSYSGADVILIAFSVDNVESLHNARTKWAEEAFRYCPDAPVI--LVGLKE 121

Query: 124 DLV-SERESTSLVDEADAREFAQE-NNLLFHQVSAKTGENVIKVFQDIGERLYLQNKDKI 181
           DL  S++E    V+  DA + A+      + + SA TGE V  VF+       L  +  +
Sbjct: 122 DLRKSKQEGIVFVNREDAEQVAKAIGAKKYLECSALTGEGVDDVFE-------LATRSSL 174

Query: 182 QESKKPNNNNISL 194
              K+P++   S+
Sbjct: 175 LMHKEPDHFCCSI 187

>Sklu_1816.1 YNL090W, Contig c1816 115-681
          Length = 188

 Score = 76.3 bits (186), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 56/188 (29%), Positives = 92/188 (48%), Gaps = 16/188 (8%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEI 60
           +++ KLV++GD + GK+S+++ F    F E    T+   +++         D   ++  +
Sbjct: 5   VVRRKLVIIGDGACGKTSLLYVFTLGKFPEEYHPTVFENYVTDC-----RVDGIKVQLAL 59

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKL-WVDELKEKVNDDKLIICLV 119
           WDTAGQE Y+ L P  Y  AN  L+ + + +P+SL  A+  W +E         ++  LV
Sbjct: 60  WDTAGQEEYERLRPFSYSKANIILIGFAIDDPESLMNARTKWTEEALRYCPTAPIV--LV 117

Query: 120 GNKLDLVSERESTSLVDEADAREFAQE-----NNLLFHQVSAKTGENVIKVFQDIGERLY 174
           G K DL   R+S    +E   RE A++         + + SA TGE V  +F+       
Sbjct: 118 GLKKDL---RKSVGNGEEVVTREAAEQVARAIGAKRYMECSALTGEGVDDIFEVATRTSL 174

Query: 175 LQNKDKIQ 182
           L NK+  Q
Sbjct: 175 LVNKEPGQ 182

>ABR182W [775] [Homologous to ScYPR165W (RHO1) - SH]
           complement(754517..755146) [630 bp, 209 aa]
          Length = 209

 Score = 76.6 bits (187), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 55/184 (29%), Positives = 90/184 (48%), Gaps = 18/184 (9%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDTA 64
           KLV++GD + GK+ ++  F K  F E    T+   +++       + D + ++  +WDTA
Sbjct: 12  KLVIVGDGACGKTCLLVVFSKGQFPEIHVPTVFENYVADV-----DIDGRRVELALWDTA 66

Query: 65  GQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAK-LWVDELKEKVNDDKLIICLVGNKL 123
           GQE Y  L P+ Y ++N  L+ + V  PDSL   +  WV E+        ++  LVG K+
Sbjct: 67  GQEDYDRLRPLSYPDSNVVLICFSVDLPDSLDNVQEKWVSEVLHFCQGVPIL--LVGCKV 124

Query: 124 DLVS--------ERESTSLVDEADAREFAQE-NNLLFHQVSAKTGENVIKVFQDIGERLY 174
           DL +        + E    V  A+    A +   + + + SA+TG+ V +VF D   R  
Sbjct: 125 DLRNDPQVLQQLQAEGQRPVTAAEGSAVAGKIGAVAYLECSARTGQGVKEVF-DTATRAA 183

Query: 175 LQNK 178
           L  K
Sbjct: 184 LSGK 187

>KLLA0C13816g 1183412..1183975 highly similar to sp|P06781
           Saccharomyces cerevisiae YNL090w RHO2 GTP-binding
           protein of the RHO subfamily of RAS-like proteins, start
           by similarity
          Length = 187

 Score = 75.9 bits (185), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 54/176 (30%), Positives = 87/176 (49%), Gaps = 9/176 (5%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDTA 64
           KLV++GD + GK+S+++ F    F E    T+   +++         D   ++  +WDTA
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGQFPEEYHPTVFENYVTDC-----RVDGIKVQLTLWDTA 63

Query: 65  GQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAK-LWVDELKEKVNDDKLIICLVGNKL 123
           GQE Y+ L P  Y  A+  L+ + + +P+SL  A+  W +E+     +  ++  LVG K 
Sbjct: 64  GQEEYERLRPFSYSKADIILIGFAIDDPESLVNARNKWSEEVLRYCPEAPVV--LVGLKK 121

Query: 124 DLVSERESTSLVDEADAREFAQE-NNLLFHQVSAKTGENVIKVFQDIGERLYLQNK 178
           DL S      +V    A + A+      + + SA TGENV  VF+       L NK
Sbjct: 122 DLRSPDNEHQMVTREQAEQVARAIGAKKYMECSALTGENVDDVFEVATRTSLLVNK 177

>KLLA0A05643g 528976..529632 similar to sp|Q00246 Saccharomyces
           cerevisiae YKR055w RHO4 GTP-binding protein of the rho
           family, hypothetical start
          Length = 218

 Score = 75.9 bits (185), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 97/191 (50%), Gaps = 13/191 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWD 62
             K+V++GD +VGK+S++  + +  F E    TI   +++      E  + ++++  +WD
Sbjct: 31  HLKIVVVGDGAVGKTSLLISYTQGKFPEDYVPTIFENYVTNL----EGPNGKIVELALWD 86

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKA-KLWVDELKEKVNDDKLIICLVGN 121
           TAGQE Y  L P+ Y + +  ++ Y +    S     ++W+ E+K    D  ++I  VG 
Sbjct: 87  TAGQEEYSRLRPLSYTDVDVLMICYAINSKVSFYNIEEMWLPEVKHFCPDVPIMI--VGL 144

Query: 122 KLDLVSERESTSLVDEADAREFAQENNLLFH-QVSAKTGENVIKVFQD-IGERLYLQNKD 179
           K DL +E   +  VD   A E A+      H Q S+K+ + V +VF   I   LY    D
Sbjct: 145 KSDLYAEDNISDFVDAFKAEETAKRIGAFVHLQCSSKSQQKVREVFDTAITAALY----D 200

Query: 180 KIQESKKPNNN 190
           +++  KK  N+
Sbjct: 201 ELKPKKKKLNS 211

>ABL139C [453] [Homologous to ScYNL180C (RHO5) - SH]
           (134875..135759) [885 bp, 294 aa]
          Length = 294

 Score = 76.6 bits (187), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 58/190 (30%), Positives = 92/190 (48%), Gaps = 24/190 (12%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKL----SEEYDEQVL 56
           M   K V++GD +VGK+S++  +  +SF +    T+   + S TI +    S   ++Q+ 
Sbjct: 17  MRSIKCVVIGDGAVGKTSLLISYTTNSFPQDYIPTVFDNY-STTIAVQDPASSTGEQQLF 75

Query: 57  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAK-LWVDELKEKVNDD--- 112
           K  +WDTAGQE Y  L P+ Y   +  L+ + + EP S    +  W  E+K   N +   
Sbjct: 76  KLNLWDTAGQEEYDRLRPLSYPQTDIFLICFSINEPVSFQNIRDKWFPEIKHNTNYENME 135

Query: 113 ------KLIICLVGNKLDLVSE-------RE-STSLVDEADAREFAQENNLL-FHQVSAK 157
                 K  I LVG K DL  +       RE +T  V +A+     Q+   + + + SA 
Sbjct: 136 LFLECGKYPILLVGTKADLRDDDHEEDRLREMNTDFVSQAEIERVVQDCGFMGYVECSAA 195

Query: 158 TGENVIKVFQ 167
           T E V +VF+
Sbjct: 196 TQEGVREVFE 205

>Kwal_14.2244
          Length = 244

 Score = 75.5 bits (184), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 63/214 (29%), Positives = 109/214 (50%), Gaps = 24/214 (11%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEI 60
           M  +KLV+LG   VGKS +  +FV+  + +  + TI  ++     + + E D +V   EI
Sbjct: 1   MRDYKLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTIEDSY-----RKTMEIDNKVFDLEI 55

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKV----NDDKLII 116
            DTAG  ++ ++  +Y ++    L+VY VT+  SL +    + EL+E+V    ++ ++ +
Sbjct: 56  LDTAGVAQFTAMRELYIKSGMGFLLVYSVTDRQSLEE----LIELREQVLRIKDNSRVPM 111

Query: 117 CLVGNKLDLVSERESTSLVDEADAREFAQE-NNLLFHQVSAKTGENVIKVFQDIGERLYL 175
            LVGNK DL  ER    ++   +  E + +   + F++ SA    NV +VF D+  R  +
Sbjct: 112 VLVGNKADLQDER----VISVEEGIEMSSKWGKVPFYETSALLRSNVDEVFVDV-VRQII 166

Query: 176 QNKDKIQESKKPN-----NNNISLQRPSTNDSQS 204
           +N+ + Q S          NN  L  P T+   S
Sbjct: 167 RNEIEAQASSNVGLGHLSRNNTGLSAPGTSSGGS 200

>ACR257C [1304] [Homologous to ScYKR055W (RHO4) - SH]
           (808667..809446) [780 bp, 259 aa]
          Length = 259

 Score = 75.9 bits (185), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 53/166 (31%), Positives = 83/166 (50%), Gaps = 8/166 (4%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWD 62
           + K+V++GD + GK+S++  + +  F E    TI   +++      E    +V++  +WD
Sbjct: 52  RIKIVVVGDGATGKTSLLMSYTQGQFPEDYVPTIFENYVTNI----EGPRGKVIELALWD 107

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKA-KLWVDELKEKVNDDKLIICLVGN 121
           TAGQE Y  L P+ Y + +  +V Y      SL  A +LW  E++       ++  LVG 
Sbjct: 108 TAGQEEYSRLRPLSYGDVDIVMVCYAADNRTSLTNAEELWFPEVRHFCPHAPMM--LVGL 165

Query: 122 KLDLVSERESTSLVDEADAREFAQENNLLFH-QVSAKTGENVIKVF 166
           K DL S      LVD  DA   A++     H Q SAKT + +  VF
Sbjct: 166 KSDLYSLDALDRLVDPTDAELVARKMGAFVHLQCSAKTRQCLEDVF 211

>Kwal_55.21937
          Length = 208

 Score = 74.7 bits (182), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 52/181 (28%), Positives = 87/181 (48%), Gaps = 33/181 (18%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDTA 64
           KLV++GD + GK+ ++  F K  F E    T+   +++       + D + ++  +WDTA
Sbjct: 12  KLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVADV-----QVDGRQVELALWDTA 66

Query: 65  GQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAK-LWVDELKEKVNDDKLIICLVGNKL 123
           GQE Y  L P+ Y ++N  L+ + +  PDSL   +  W+ E+        +I  LVG K+
Sbjct: 67  GQEDYDRLRPLSYPDSNVVLICFSIDLPDSLDNVQEKWIAEVMHFCQGVPII--LVGCKV 124

Query: 124 DL-----------------VSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVF 166
           DL                 V+  E+ S+ D+  A          +++ SAKTG  V +VF
Sbjct: 125 DLRDNPQTVEALRAIGQQPVTGPEAQSVADKIGASA--------YYECSAKTGYGVREVF 176

Query: 167 Q 167
           +
Sbjct: 177 E 177

>Sklu_2151.4 , Contig c2151 3640-4263 reverse complement
          Length = 207

 Score = 74.7 bits (182), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 87/178 (48%), Gaps = 27/178 (15%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDTA 64
           KLV++GD + GK+ ++  F K  F E    T+   +++       E D + ++  +WDTA
Sbjct: 12  KLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVTDV-----EVDGRHVELTLWDTA 66

Query: 65  GQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIIC------L 118
           GQE Y  L P  Y ++N  L+ + +  PDSL       D ++EK  ++ L  C      L
Sbjct: 67  GQEDYDRLRPFSYPDSNVVLICFSIDLPDSL-------DNVQEKWINEVLYFCKGVPIIL 119

Query: 119 VGNKLDLVSERESTSLVDEADAREFAQENN---------LLFHQVSAKTGENVIKVFQ 167
           VG K+DL  + ++   +     R  +  +          + +++ SAK+G  V +VF+
Sbjct: 120 VGCKVDLRDDTQTIETLKAIGQRPVSTTDGQTVADRIGAVGYYECSAKSGLGVREVFE 177

>Scas_578.7
          Length = 187

 Score = 72.8 bits (177), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 53/180 (29%), Positives = 89/180 (49%), Gaps = 9/180 (5%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDTA 64
           KLV++GD + GK+S+++ F    F +    T+   +++         D   +   +WDTA
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGKFPQEYHPTVFENYVTDC-----RVDGIKVSLTLWDTA 63

Query: 65  GQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAK-LWVDELKEKVNDDKLIICLVGNKL 123
           GQE Y+ L P  Y  A+  L+ + + + +SL  A+  W +E      +  +I  LVG K 
Sbjct: 64  GQEEYERLRPFSYSKADIILIGFAINDTESLDNARNKWTEEALRYCPEAPII--LVGLKK 121

Query: 124 DLVSERESTSLVDEADAREFAQ-ENNLLFHQVSAKTGENVIKVFQDIGERLYLQNKDKIQ 182
           DL  +++   +V   DA++ A+      + + SA TGE V  VF+       L NK+  Q
Sbjct: 122 DLRQKQDGVEMVKPEDAQQVARIIGAKKYVECSALTGEGVDDVFELATRTSLLVNKEPGQ 181

>YGR152C (RSR1) [2106] chr7 complement(794677..795495) GTP-binding
           protein involved in bud site selection, member of the
           ras family in the ras superfamily [819 bp, 272 aa]
          Length = 272

 Score = 74.3 bits (181), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 55/174 (31%), Positives = 97/174 (55%), Gaps = 18/174 (10%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEI 60
           M  +KLV+LG   VGKS +  +FV+  + +  + TI  ++  +TI    E D +V   EI
Sbjct: 1   MRDYKLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTIEDSY-RKTI----EIDNKVFDLEI 55

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKV----NDDKLII 116
            DTAG  ++ ++  +Y ++    L+VY VT+  SL +    + EL+E+V    + D++ +
Sbjct: 56  LDTAGIAQFTAMRELYIKSGMGFLLVYSVTDRQSLEE----LMELREQVLRIKDSDRVPM 111

Query: 117 CLVGNKLDLVSERESTSLVDEADAREFAQE-NNLLFHQVSAKTGENVIKVFQDI 169
            L+GNK DL++ER    ++   +  E + +   + F++ SA    NV +VF D+
Sbjct: 112 VLIGNKADLINER----VISVEEGIEVSSKWGRVPFYETSALLRSNVDEVFVDL 161

>Scas_703.41
          Length = 225

 Score = 73.2 bits (178), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 102/209 (48%), Gaps = 41/209 (19%)

Query: 8   LLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDTAGQE 67
           L+GD+ VGK+S++ ++V++ FDE    T+G  FL + +KL        + F + D  GQ+
Sbjct: 25  LVGDAQVGKTSLMVKYVQNIFDEEYTQTLGVNFLKRKVKLHSTD----IVFSLMDLGGQK 80

Query: 68  RYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGNKLDLV- 126
            + ++ P+    ++  + ++D+T P++L   K W  ++K    +D  I  LVG K DL+ 
Sbjct: 81  EFINMLPIAAVGSSVIVFLFDLTRPETLNSIKDWYRQVKGL--NDIAIPILVGTKYDLLI 138

Query: 127 ------SERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVF-------------- 166
                  E+ ST+ +D A+      +  L+F   S     NV K+F              
Sbjct: 139 NLSAEYQEQISTAAIDYAN----VMDAPLIF--CSTAESINVQKIFKIALAKIFNLTLVV 192

Query: 167 ---QDIGERLYL-----QNKDKIQESKKP 187
              +DIG+ L L      N  K+++SK P
Sbjct: 193 PEIRDIGDPLLLYKELGNNIQKVKQSKSP 221

>Kwal_33.14452
          Length = 260

 Score = 72.8 bits (177), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 57/224 (25%), Positives = 101/224 (45%), Gaps = 22/224 (9%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKL--SEEYDEQVLKF 58
           M   K V++GD +VGK+S++  +  ++F +    T+   + + TI L   +  + QV + 
Sbjct: 1   MRSVKCVIVGDGAVGKTSLLISYTTNTFPQDYIPTVFDNY-TTTIALNDGDSAEPQVFRL 59

Query: 59  EIWDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAK-LWVDELKEKVNDDKL--- 114
            +WDTAGQE Y  L P+ Y   +  L+ + + EP+S    K  W  E++   N + L   
Sbjct: 60  NLWDTAGQEEYDRLRPLSYPQTDIFLLCFSINEPNSFENVKDKWFPEIRHNTNYENLELF 119

Query: 115 ------IICLVGNKLDLVSERE--------STSLVDEADAREFAQENNLL-FHQVSAKTG 159
                  I LVG K DL  +          ++  V   D  +   +  L+ + + SA T 
Sbjct: 120 RVCGKYPILLVGTKADLRDDEHEQDRLAEVNSDFVSRGDIDQCVSQCGLMGYVECSAATQ 179

Query: 160 ENVIKVFQDIGERLYLQNKDKIQESKKPNNNNISLQRPSTNDSQ 203
             V  VF+     +  + +  + +SK+  N       P + ++Q
Sbjct: 180 VGVADVFERAVRCVVSEPERLLGQSKQRTNAADHFIDPQSGNTQ 223

>YNL090W (RHO2) [4501] chr14 (456565..457143) GTP-binding protein,
           member of the rho family in the ras superfamily [579 bp,
           192 aa]
          Length = 192

 Score = 70.9 bits (172), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 53/170 (31%), Positives = 82/170 (48%), Gaps = 14/170 (8%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDTA 64
           KLV++GD + GK+S+++ F    F E    T+   +++         D   +   +WDTA
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGKFPEQYHPTVFENYVTDC-----RVDGIKVSLTLWDTA 63

Query: 65  GQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKL-WVDELKEKVNDDKLIICLVGNKL 123
           GQE Y+ L P  Y  A+  L+ + V   +SL  A+  W DE      D  ++  LVG K 
Sbjct: 64  GQEEYERLRPFSYSKADIILIGFAVDNFESLINARTKWADEALRYCPDAPIV--LVGLKK 121

Query: 124 DL-----VSERESTSLVDEADAREFAQE-NNLLFHQVSAKTGENVIKVFQ 167
           DL       E  +  +V   DA++ A+      + + SA TGE V  VF+
Sbjct: 122 DLRQEAHFKENATDEMVPIEDAKQVARAIGAKKYMECSALTGEGVDDVFE 171

>Sklu_2007.2 YNL180C, Contig c2007 789-1574 reverse complement
          Length = 261

 Score = 71.2 bits (173), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 44/139 (31%), Positives = 69/139 (49%), Gaps = 15/139 (10%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYD----EQVL 56
           M   K V++GD +VGK+S++  +  ++F +    T+   + S TI L++  D    ++V 
Sbjct: 1   MRSIKCVIVGDGAVGKTSLLISYTTNTFPQDYIPTVFDNY-STTIALADPSDLSAEQEVF 59

Query: 57  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKA-KLWVDELKEKVNDD--- 112
           K  +WDTAGQE Y  L P+ Y   +  ++ + V EP S       W  E++   N +   
Sbjct: 60  KLNLWDTAGQEEYDRLRPLSYPQTDIFIICFSVNEPSSFENVIDKWFPEIRHNTNYENME 119

Query: 113 ------KLIICLVGNKLDL 125
                 K  I LVG K DL
Sbjct: 120 LFSSCGKFPILLVGTKADL 138

>KLLA0C12001g complement(1029092..1029871) similar to sp|P13856
           Saccharomyces cerevisiae YGR152c RSR1 GTP-binding
           protein, start by similarity
          Length = 259

 Score = 70.5 bits (171), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 94/174 (54%), Gaps = 18/174 (10%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEI 60
           M  +KLV+LG   VGKS +  +FV+  + +  + TI  ++     + + E D +V   EI
Sbjct: 1   MRDYKLVVLGAGGVGKSCLTVQFVQGVYLDSYDPTIEDSY-----RKTMEIDNKVFDLEI 55

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKV----NDDKLII 116
            DTAG  ++ ++  +Y ++    L+VY V++  SL +    + EL+E+V    + D++ I
Sbjct: 56  LDTAGVAQFTAMRELYIKSGMGFLLVYSVSDRQSLNE----LLELREQVLRIKDSDRVPI 111

Query: 117 CLVGNKLDLVSERESTSLVDEADAREFAQE-NNLLFHQVSAKTGENVIKVFQDI 169
            LVGNK DL  ER    ++   +  E + +   + F++ SA    NV +VF D+
Sbjct: 112 VLVGNKADLQDER----VISVEEGIEVSSKWGKVPFYEASALLRSNVDEVFIDL 161

>Kwal_47.16983
          Length = 223

 Score = 70.1 bits (170), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 89/173 (51%), Gaps = 9/173 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDT 63
            K+ L+GD+ VGK+S++ ++V++ FDE    T+G   LS+ I L      ++L F I D 
Sbjct: 19  LKIGLIGDAQVGKTSLMVKYVENVFDEEYTQTLGVNCLSKKITLG---SAEIL-FYIMDL 74

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGNKL 123
            GQ  + ++ P+    A A + ++D+T P++L   K W    +    +++ +  LVG K 
Sbjct: 75  GGQREFINMLPLASEGAKAIIFLFDLTRPETLKSIKEW--HRQATGFNEQAVPLLVGTKY 132

Query: 124 DLVS--ERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERLY 174
           DL    + E  + + +   R +AQ  +      S     NV K+F+ +  +LY
Sbjct: 133 DLFVNLDPEYQAQISKQSMR-YAQAMDAPLIFCSTSHSINVQKIFKIVIAKLY 184

>AFR464W [3656] [Homologous to ScYGR152C (RSR1) - SH]
           complement(1274158..1274952) [795 bp, 264 aa]
          Length = 264

 Score = 70.5 bits (171), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 57/173 (32%), Positives = 96/173 (55%), Gaps = 16/173 (9%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEI 60
           M  +KLV+LG   VGKS +  +FV+  + +  + TI  ++     + S E D++    EI
Sbjct: 1   MRDYKLVVLGAGGVGKSCLTVQFVQGEYLDTYDPTIEDSY-----RKSMEIDDKAFDLEI 55

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKE---KVNDDKLI-I 116
            DTAG  ++ ++  +Y ++    L+VY VT+  SL  A+L   EL+E   ++ D K + +
Sbjct: 56  LDTAGVAQFTAMRELYIKSGMGFLLVYSVTDRQSL--AELM--ELREQILRIKDSKRVPM 111

Query: 117 CLVGNKLDLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDI 169
            LVGNK DL +ER + S+ +  D    ++   + F++ SA    NV +VF D+
Sbjct: 112 VLVGNKADLQNER-AISVEEGIDVS--SRWGKVPFYETSALLKSNVDEVFIDL 161

>YOR101W (RAS1) [4906] chr15 (515244..516173) GTP-binding protein
           involved in regulation of cAMP pathway, homolog of
           mammalian proto-oncogene ras [930 bp, 309 aa]
          Length = 309

 Score = 69.3 bits (168), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 54/165 (32%), Positives = 90/165 (54%), Gaps = 11/165 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSF-DEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIW 61
           ++K+V++G   VGKS++  +F++  F DEY + TI  ++  Q +      D++V   +I 
Sbjct: 10  EYKIVVVGGGGVGKSALTIQFIQSYFVDEY-DPTIEDSYRKQVV-----IDDKVSILDIL 63

Query: 62  DTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGN 121
           DTAGQE Y ++   Y R     L+VY VT  +S  +   +  +++   + D + + +VGN
Sbjct: 64  DTAGQEEYSAMREQYMRTGEGFLLVYSVTSRNSFDELLSYYQQIQRVKDSDYIPVVVVGN 123

Query: 122 KLDLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVF 166
           KLDL +ER+    V   D    A++ N  F + SAK   NV + F
Sbjct: 124 KLDLENERQ----VSYEDGLRLAKQLNAPFLETSAKQAINVDEAF 164

>Kwal_55.21971
          Length = 421

 Score = 69.7 bits (169), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 53/171 (30%), Positives = 85/171 (49%), Gaps = 19/171 (11%)

Query: 34  STIGAAFLSQTIKLSEEYDEQVLKFEIWDTAGQERYK-SLAPMYYRNANAALVVYDVTEP 92
           STIG    +  + +   Y     K  +WDTAGQERY+ ++ P  Y+ +N  L+ YD+   
Sbjct: 202 STIGVDIRTNLVNIDNRY----FKVTMWDTAGQERYRNAMIPSLYKGSNGILLSYDICSR 257

Query: 93  DSLPKA-KLWVDELKEKVNDDK-LIICLVGNKLDLVSERESTS-----LVDEADAREFAQ 145
            S       W+ E+     DDK L I LVGNK+DL   R+ T       +++A+ R   +
Sbjct: 258 KSFQNCLDYWLQEVLNCCADDKALRIYLVGNKIDLYKVRQVTHEDVLQFINKAEKRYNVK 317

Query: 146 -----ENNLLFHQVSAKTGENVIKVFQDIGERLYLQNKDKIQESKKPNNNN 191
                E +  +HQV  +T   +IK   + G   Y  +  +I+ES +P++ +
Sbjct: 318 IAGNFEVSCKWHQVVERTFNIIIKDLVENG--CYEDDFQRIEESPQPSHGH 366

>KLLA0B05038g complement(457608..458279) similar to sp|P38987
           Saccharomyces cerevisiae YML064c TEM1 GTP-binding
           protein of the RAS superfamily, start by similarity
          Length = 223

 Score = 67.4 bits (163), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 94/175 (53%), Gaps = 19/175 (10%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIW 61
           ++ K+ L+GD+ VGK+S++ ++V++ FDE    T+G  +L + + L       V+ F I 
Sbjct: 15  VKVKVGLIGDAQVGKTSLMVKYVQNVFDEEYTQTLGVHYLERKVVLG---STDVI-FSIM 70

Query: 62  DTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGN 121
           D  GQ  + ++ P+    A A + ++D+T P++L   K W  + +    +D  I  LVG 
Sbjct: 71  DLGGQREFINMLPLVSEGAVAIVFLFDLTRPETLNSIKEWYRQARG--FNDTAISILVGT 128

Query: 122 KLDLVSE-----RESTSLVDEADAREFAQ--ENNLLFHQVSAKTGENVIKVFQDI 169
           K DL  +     +E+ S      A ++AQ  ++ L+F   S ++  NV K+F+ +
Sbjct: 129 KYDLFVDMDPEYQENVS----RTAMKYAQVMKSPLIF--CSTQSSINVQKIFKVV 177

>Scas_547.3
          Length = 223

 Score = 67.4 bits (163), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 70/124 (56%), Gaps = 6/124 (4%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIW 61
           +Q ++ L+GD+ VGK+S++ ++ ++ FDE    T+G   L + +++        + F + 
Sbjct: 23  IQIQVGLVGDAQVGKTSLMVKYAQNGFDEEYTQTLGVNLLKRKVRIKSSN----IVFSLM 78

Query: 62  DTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGN 121
           D  GQ+ + ++ P+   N++  + ++D+T P+SL   K W  +    +N D + I LVG 
Sbjct: 79  DLGGQKEFINMLPIASVNSSVIIFLFDLTRPESLESIKNWYMQ-AHGLNHDAVCI-LVGT 136

Query: 122 KLDL 125
           K DL
Sbjct: 137 KYDL 140

>Sklu_1653.3 YML064C, Contig c1653 2277-3047
          Length = 256

 Score = 67.4 bits (163), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 68/124 (54%), Gaps = 6/124 (4%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIW 61
           ++ K+ L+GD+ VGK+S++ ++V++ FDE    T+G  +L + I L        + F I 
Sbjct: 58  VKVKIGLIGDAQVGKTSLMVKYVQNVFDEEYTQTLGVHYLERKIALGST----DVVFSIM 113

Query: 62  DTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGN 121
           D  GQ  + ++ P+    A + + ++D+T P++L   K W  + +    ++  I  LVG 
Sbjct: 114 DLGGQREFINMLPLVSEGAVSIIFLFDLTRPETLSSIKEWYRQARG--FNETAIALLVGT 171

Query: 122 KLDL 125
           K DL
Sbjct: 172 KYDL 175

>AER132W [2636] [Homologous to ScYML064C (TEM1) - SH]
           complement(888052..888750) [699 bp, 232 aa]
          Length = 232

 Score = 67.4 bits (163), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 69/124 (55%), Gaps = 6/124 (4%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIW 61
           ++ K+ L+GD+ VGK+S++ ++V++ FDE    T+G  +L + I L       V+ F I 
Sbjct: 14  VKIKIGLIGDAQVGKTSLMVKYVQNVFDEEYTQTLGVHYLERKINLG---STDVI-FSIM 69

Query: 62  DTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGN 121
           D  GQ  + ++ P+    A A + ++D+T P++L   + W  + +    ++  I  LVG 
Sbjct: 70  DLGGQREFINMLPLVSNRAVAIIFLFDLTRPETLTSIREWYRQARG--FNETAIPLLVGT 127

Query: 122 KLDL 125
           K DL
Sbjct: 128 KYDL 131

>ADL252W [1489] [Homologous to ScYIL118W (RHO3) - SH]
           complement(258349..259023) [675 bp, 224 aa]
          Length = 224

 Score = 65.9 bits (159), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 66/130 (50%), Gaps = 8/130 (6%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIW 61
           ++ K+V+LGD + GK+S+++ F +  F +  E T+   ++          D Q +   +W
Sbjct: 14  IERKIVILGDGACGKTSLLNVFTRGYFPKVYEPTVFENYIHDIF-----VDNQHITLSLW 68

Query: 62  DTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAK-LWVDELKEKVNDDKLIICLVG 120
           DTAGQE +  L  + Y + +  ++ + V   DSL   K  WV E+ +     KL+  LV 
Sbjct: 69  DTAGQEEFDRLRSLSYSDTHTIMLCFSVDSRDSLENVKNKWVSEIADHCEGVKLV--LVA 126

Query: 121 NKLDLVSERE 130
            K DL S  E
Sbjct: 127 LKCDLRSSDE 136

>Kwal_23.4875
          Length = 230

 Score = 65.9 bits (159), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 68/134 (50%), Gaps = 8/134 (5%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIW 61
           ++ K+V+LGD + GK+S+++ F +  F +  E T+   ++          D Q +   +W
Sbjct: 14  IERKIVILGDGACGKTSLLNVFTRGYFPKVYEPTVFENYIHDIF-----VDNQHITLSLW 68

Query: 62  DTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKL-WVDELKEKVNDDKLIICLVG 120
           DTAGQE +  L  + Y + +  ++ + V   DSL   +  WV E+ +     KL+  LV 
Sbjct: 69  DTAGQEEFDRLRSLSYSDTHTIMLCFSVDSRDSLDNVQHKWVGEIADHCEGVKLV--LVA 126

Query: 121 NKLDLVSERESTSL 134
            K DL S  E  +L
Sbjct: 127 LKCDLRSNNEEFAL 140

>Scas_417.3
          Length = 291

 Score = 65.9 bits (159), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 45/147 (30%), Positives = 72/147 (48%), Gaps = 22/147 (14%)

Query: 1   MLQFKLVLLGDSSVGKSSIV---------HRFVKDSFDEYRES-TIGAAFLSQTIKLSEE 50
           M Q K V++GD +VGK+S++           ++   FD Y  + ++   FLS+    +E 
Sbjct: 1   MRQIKTVIVGDGAVGKTSLLISYTTNTFPQDYIPTVFDNYSTTISLRDPFLSRESLANEN 60

Query: 51  YDE--QVLKFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPK-AKLWVDELKE 107
            ++  ++ K  +WDTAGQE Y  L P+ Y   +  L+ + V E  S       W+ E+K+
Sbjct: 61  ENDHLELFKLNLWDTAGQEEYDRLRPLSYPQTDVFLICFSVAELSSFENVVDKWLPEIKQ 120

Query: 108 KVNDD---------KLIICLVGNKLDL 125
             N +         KL I L+G K DL
Sbjct: 121 NANVESSELFLQFGKLPIMLIGTKADL 147

>YNL098C (RAS2) [4493] chr14 complement(439602..440570) GTP-binding
           protein involved in regulation of cAMP pathway, homolog
           of mammalian proto-oncogene ras [969 bp, 322 aa]
          Length = 322

 Score = 65.9 bits (159), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 54/165 (32%), Positives = 87/165 (52%), Gaps = 11/165 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSF-DEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIW 61
           ++KLV++G   VGKS++  +  +  F DEY + TI  ++  Q +      D++V   +I 
Sbjct: 10  EYKLVVVGGGGVGKSALTIQLTQSHFVDEY-DPTIEDSYRKQVV-----IDDEVSILDIL 63

Query: 62  DTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGN 121
           DTAGQE Y ++   Y RN    L+VY +T   SL +   +  ++    + D + I +VGN
Sbjct: 64  DTAGQEEYSAMREQYMRNGEGFLLVYSITSKSSLDELMTYYQQILRVKDTDYVPIVVVGN 123

Query: 122 KLDLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVF 166
           K DL +E++    V   D    A++ N  F + SAK   NV + F
Sbjct: 124 KSDLENEKQ----VSYQDGLNMAKQMNAPFLETSAKQAINVEEAF 164

>YIL118W (RHO3) [2558] chr9 (139749..140444) GTP-binding protein
           involved in control of actin cytoskeleton, exocytosis,
           and beta 1,6-glucan biosynthesis, member of the rho
           family in the ras superfamily [696 bp, 231 aa]
          Length = 231

 Score = 64.7 bits (156), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 91/191 (47%), Gaps = 15/191 (7%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIW 61
           ++ K+V+LGD + GK+S+++ F +  F E  E T+   ++          D + +   +W
Sbjct: 15  IERKIVILGDGACGKTSLLNVFTRGYFPEVYEPTVFENYIHDIF-----VDSKHITLSLW 69

Query: 62  DTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAK-LWVDELKEKVNDDKLIICLVG 120
           DTAGQE +  L  + Y +    ++ + +   DSL   +  WV E+ +     KL+  LV 
Sbjct: 70  DTAGQEEFDRLRSLSYSDTQCIMLCFSIDSRDSLENVQNKWVGEITDHCEGVKLV--LVA 127

Query: 121 NKLDLV-SERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIK------VFQDIGERL 173
            K DL  +E ES ++      ++ +  N+   +  S   G+N+I       + + IG   
Sbjct: 128 LKCDLRNNENESNAITPNNIQQDNSVSNDNGNNINSTSNGKNLISYEEGLAMAKKIGALR 187

Query: 174 YLQNKDKIQES 184
           YL+   K+ + 
Sbjct: 188 YLECSAKLNKG 198

>KLLA0F03443g 324020..324691 highly similar to sp|Q9HF51 Ashbya
           gossypii Rho3, start by similarity
          Length = 223

 Score = 64.7 bits (156), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 64/125 (51%), Gaps = 8/125 (6%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIW 61
           ++ K+V+LGD + GK+S+++ F +  F +  E TI   ++          D Q +   +W
Sbjct: 13  IERKIVILGDGACGKTSLLNVFTRGYFPKVYEPTIFENYIHDIF-----VDNQHISLSLW 67

Query: 62  DTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAK-LWVDELKEKVNDDKLIICLVG 120
           DTAGQE +  L  + Y + +  ++ + V   DSL   +  WV E+ +     KL+  LV 
Sbjct: 68  DTAGQEEFDRLRSLSYSDTHTIMLCFSVDSRDSLENVQNKWVGEIADHCEGVKLV--LVA 125

Query: 121 NKLDL 125
            K DL
Sbjct: 126 LKCDL 130

>Scas_671.35
          Length = 234

 Score = 64.3 bits (155), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 64/125 (51%), Gaps = 8/125 (6%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIW 61
           ++ K+V+LGD + GK+S+++ F +  F E  E T+   ++          D + +   +W
Sbjct: 15  IERKIVILGDGACGKTSLLNVFTRGYFPEVYEPTVFENYIHDIF-----VDNKHITLSLW 69

Query: 62  DTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKL-WVDELKEKVNDDKLIICLVG 120
           DTAGQE +  L  + Y + +  ++ + +   DSL   +  WV E+ +     KL+  LV 
Sbjct: 70  DTAGQEEFDRLRSLSYSDTHTIMLCFSIDSRDSLANVQHKWVGEIADHCEGVKLV--LVA 127

Query: 121 NKLDL 125
            K DL
Sbjct: 128 LKCDL 132

>Scas_697.46
          Length = 324

 Score = 63.9 bits (154), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 51/165 (30%), Positives = 85/165 (51%), Gaps = 11/165 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSF-DEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIW 61
           ++KLV++G   VGKS++  + +   F DEY + TI  ++  Q +      D++V   ++ 
Sbjct: 10  EYKLVVVGGGGVGKSALTIQLIHSHFVDEY-DPTIEDSYRKQVV-----IDDKVTVLDVL 63

Query: 62  DTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGN 121
           DTAGQE Y ++   Y R     L+VY VT  +S  +   +  +++   + D + + +VGN
Sbjct: 64  DTAGQEEYSAMREQYMRTGEGFLLVYSVTSKNSFEELLTYYQQIQRVKDSDYIPVVIVGN 123

Query: 122 KLDLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVF 166
           K DL  ER+    V        A++ N  F + SAK   NV + F
Sbjct: 124 KSDLEDERQ----VPYQSGVNLAKQMNAPFLETSAKQAINVEEAF 164

>YNL180C (RHO5) [4420] chr14 complement(299654..300649) GTPase of
           the rho family in the ras superfamily, involved in
           negative regulation of the Slt2p MAP kinase branch of
           the Pkc1p pathway [996 bp, 331 aa]
          Length = 331

 Score = 63.9 bits (154), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 57/211 (27%), Positives = 91/211 (43%), Gaps = 44/211 (20%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSF---------DEYRES-TIGAAFLSQTIKL--- 47
           M   K V++GD +VGK+S++  +  +SF         D Y  +  I     S  ++L   
Sbjct: 1   MRSIKCVIIGDGAVGKTSLLISYTTNSFPTDYVPTVFDNYSTTIAIPNGTASSPLELDNG 60

Query: 48  ------------SEEYDEQVLKFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSL 95
                       S   D ++ K  +WDTAGQE Y  L P+ Y   +  L+ + V+E  S 
Sbjct: 61  NDKRGSLSSASSSPSTDRKLYKINLWDTAGQEDYDRLRPLCYPQTDIFLICFSVSEHASF 120

Query: 96  PK-AKLWVDELKEKVNDD---------KLIICLVGNKLDLVSERESTSLVDEADAREFAQ 145
               + W+ ELK+  N +         K  I LVG K DL  +  +   + EA++   +Q
Sbjct: 121 ANVTEKWLPELKQTSNIEGTSLYTKLGKYPILLVGTKSDLRDDPATQKKLQEANSDYVSQ 180

Query: 146 E---------NNLLFHQVSAKTGENVIKVFQ 167
           E           + + + SA T   V +VF+
Sbjct: 181 EEIDELVQRCGFMGYTECSAATQAGVREVFE 211

>CAGL0G08558g complement(804969..805652) highly similar to sp|Q00245
           Saccharomyces cerevisiae YIL118w RHO3, start by
           similarity
          Length = 227

 Score = 62.8 bits (151), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 61/122 (50%), Gaps = 8/122 (6%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDTA 64
           K+V+LGD + GK+S+++ F +  F E  E T+   ++          D + +   +WDTA
Sbjct: 22  KIVILGDGACGKTSLLNVFTRGYFPEVYEPTVFENYIHDIF-----VDNRHITLSLWDTA 76

Query: 65  GQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAK-LWVDELKEKVNDDKLIICLVGNKL 123
           GQE +  L  + Y + +  ++ + +   DSL   K  WV E+ +      L+  LV  K 
Sbjct: 77  GQEEFDRLRSLSYSDTHTIMLCFSIDSRDSLENVKNKWVGEITDHCEGVNLV--LVALKC 134

Query: 124 DL 125
           DL
Sbjct: 135 DL 136

>CAGL0L11242g 1197075..1197839 highly similar to sp|P38987
           Saccharomyces cerevisiae YML064c TEM1 GTP-binding
           protein of the RAS superfamily, hypothetical start
          Length = 254

 Score = 62.8 bits (151), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 68/123 (55%), Gaps = 6/123 (4%)

Query: 8   LLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDTAGQE 67
           L+GD+ VGK+S++ ++V++ FDE    T+G  FL + + +        + F + D  GQ 
Sbjct: 33  LIGDAQVGKTSLMVKYVQNIFDEEYTQTLGVNFLKRKVSIRSTD----IVFSLMDLGGQR 88

Query: 68  RYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGNKLDLVS 127
            + ++ P+    ++  ++++D+T P++L   K W  +    +ND  + I LVG K DL  
Sbjct: 89  EFINMLPIATLGSSVIILLFDLTRPETLNSIKEWYRQ-ALGLNDSAIPI-LVGTKYDLFI 146

Query: 128 ERE 130
           + E
Sbjct: 147 DLE 149

>ADL162W [1579] [Homologous to ScYNL304W (YPT11) - SH]
           complement(405601..406815) [1215 bp, 404 aa]
          Length = 404

 Score = 63.5 bits (153), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 38/116 (32%), Positives = 59/116 (50%), Gaps = 10/116 (8%)

Query: 33  ESTIGAAFLSQTIKLSEEYDEQVLKFEIWDTAGQERYK-SLAPMYYRNANAALVVYDVTE 91
           +STIG    +  + +    D Q+ K  +WDTAGQERY+ ++ P  Y+     ++ YD+  
Sbjct: 165 KSTIGVDIKTSFVDI----DRQLFKVIMWDTAGQERYRNAMVPSLYKGTQGIILSYDICS 220

Query: 92  PDSLPKA-KLWVDELKEKVNDDKLIICLVGNKLDLVSERESTSLVDEADAREFAQE 146
            ++ P   + W+ E  E    +     LVGNK+DL  +R+    V  AD   FA E
Sbjct: 221 RETFPDCLEHWLPEALEHCQVEHTRFYLVGNKVDLYKQRQ----VTHADVLAFADE 272

>Sklu_2345.5 YCR027C, Contig c2345 9936-10595
          Length = 219

 Score = 61.6 bits (148), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 78/159 (49%), Gaps = 6/159 (3%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDTA 64
           K+ ++G  +VGKSSI  +FV+  F E    TI   F S+T+KL +     +   EI DTA
Sbjct: 27  KIAVVGARNVGKSSITVQFVESHFVESYYPTIENEF-SRTVKLGK----VMYTLEICDTA 81

Query: 65  GQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVN-DDKLIICLVGNKL 123
           GQ+ +  +           LVVY V    S     L  D++ +++  D+ + + + GNK+
Sbjct: 82  GQDEFSLVNNRSLMGVAGFLVVYSVVNRHSFELVGLIRDKILDQLGLDENVPVVVAGNKI 141

Query: 124 DLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENV 162
           DL  +  +   V   + ++ A+     F + SAK   NV
Sbjct: 142 DLCPDGGNNRQVTREEGQQLAKSLGAGFSECSAKLNWNV 180

>YML064C (TEM1) [3905] chr13 complement(145139..145876) GTP-binding
           protein involved in termination of M-phase, member of
           the ras superfamily [738 bp, 245 aa]
          Length = 245

 Score = 61.2 bits (147), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 70/125 (56%), Gaps = 6/125 (4%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIW 61
           ++ ++ L+GD+ VGK+S++ ++V++ +D+    T+G  FL + + +        + F I 
Sbjct: 19  VEVQVGLVGDAQVGKTSLMVKYVQNIYDKEYTQTLGVNFLKRKVSIRSTD----IIFSIM 74

Query: 62  DTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGN 121
           D  GQ  + ++ P+    ++  + ++D+T P++L   K W  +    +ND  + I LVG 
Sbjct: 75  DLGGQREFINMLPIATVGSSVIIFLFDLTRPETLSSIKEWYRQ-AYGLNDSAIPI-LVGT 132

Query: 122 KLDLV 126
           K DL+
Sbjct: 133 KYDLL 137

>CAGL0J11242g 1092630..1093784 similar to sp|P53879 Saccharomyces
           cerevisiae YNL180c RHO5, start by similarity
          Length = 384

 Score = 61.6 bits (148), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 70/151 (46%), Gaps = 20/151 (13%)

Query: 54  QVLKFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPK-AKLWVDELKE----- 107
           Q+ K  +WDTAGQE Y  L P+ YR  +  L+ + V+EP S       W  ELK      
Sbjct: 115 QIFKLNLWDTAGQEEYDRLRPLSYRQTDVFLICFSVSEPSSFRNVVDKWFPELKRVSGIE 174

Query: 108 ----KVNDDKLIICLVGNKLDLVSER--------ESTSLVDEADAREFAQENNLL-FHQV 154
                 N  K  I LVG K DL  +         ++ S V + +  +  ++N  + + + 
Sbjct: 175 SGDLYTNFKKYPILLVGTKSDLRDDENEIQKMRDQNLSFVSKEEIDKVVEDNGFMGYVEC 234

Query: 155 SAKTGENVIKVFQDIGERLYLQNKDKIQESK 185
           SA T  NV +VF+     +  +  DK+Q +K
Sbjct: 235 SAATQNNVRQVFEKAVHIVAFE-PDKLQRAK 264

>Scas_677.20
          Length = 283

 Score = 61.2 bits (147), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 71/148 (47%), Gaps = 8/148 (5%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSE----EYDEQVL 56
           M   K  ++GD  VGK+ ++  +  ++F      T+   + S TI L      + + +  
Sbjct: 1   MRSIKCTVIGDGCVGKTCLLISYTTNTFPNEYVPTVFDNY-STTITLPPVGKGKEEPEYY 59

Query: 57  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKL-WVDELKEKVNDDKLI 115
           K  +WDTAGQ+ Y +L P+ Y   +  ++ + V +  SL   K  WV E+K   N+D+L 
Sbjct: 60  KLNLWDTAGQDDYDTLRPLSYPQTDIFIICFAVNDLVSLDNVKSKWVPEIKNSFNEDELK 119

Query: 116 ICLVGNKLD--LVSERESTSLVDEADAR 141
           +    N+    LV  +  T   DE D +
Sbjct: 120 VFQSRNRFPMLLVGTKADTRYDDEIDGK 147

>ADL262W [1479] [Homologous to ScYOR101W (RAS1) - SH; ScYNL098C
           (RAS2) - SH] complement(243998..244012,244074..244871)
           [813 bp, 270 aa]
          Length = 270

 Score = 60.5 bits (145), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 58/185 (31%), Positives = 90/185 (48%), Gaps = 14/185 (7%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSF-DEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIW 61
           ++KLV++G   VGKS++  + ++  F DEY + TI  ++  Q +      D QV   +I 
Sbjct: 10  EYKLVVVGGGGVGKSALTIQLIQSHFVDEY-DPTIEDSYRKQVV-----IDGQVSILDIL 63

Query: 62  DTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGN 121
           DTAGQE Y ++   Y R     L+VY VT   S  +   +  ++    + + + I +VGN
Sbjct: 64  DTAGQEEYSAMREQYMRTGEGFLLVYSVTSRTSFEELMTYYQQILRVKDVEYVPIFVVGN 123

Query: 122 KLDLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERLYLQNKDKI 181
           K DL  ER+    V   +  E A+  N  F + SAK   NV + F  +     L   D I
Sbjct: 124 KSDLEGERQ----VSFEEGAELARHFNASFLETSAKQAINVEESFYGLAR---LVRDDGI 176

Query: 182 QESKK 186
              K+
Sbjct: 177 HAGKR 181

>Kwal_26.8387
          Length = 292

 Score = 59.7 bits (143), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 84/165 (50%), Gaps = 11/165 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSF-DEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIW 61
           ++KLV++G   VGKS++  + ++  F DEY + TI  ++  Q +      D++V   +I 
Sbjct: 16  EYKLVVVGGGGVGKSALTIQLIQSHFVDEY-DPTIEDSYRKQVV-----IDDKVSILDIL 69

Query: 62  DTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGN 121
           DTAGQE Y ++   Y R     L+VY VT   S  +   +  ++    + D + + LVGN
Sbjct: 70  DTAGQEEYSAMREQYMRTGEGFLLVYSVTSRTSFDELMTYYQQILRVKDADYVPVFLVGN 129

Query: 122 KLDLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVF 166
           K DL  ER+    V   +    A++ N  F + SAK   NV   F
Sbjct: 130 KSDLEDERQ----VAYEEGVSLAKQFNAPFMETSAKQAINVEDSF 170

>CAGL0B04521g complement(439732..440751) similar to sp|P01120
           Saccharomyces cerevisiae YNL098c RAS2 GTP-binding
           protein or sp|P01119 Saccharomyces cerevisiae YOR101w
           RAS1, hypothetical start
          Length = 339

 Score = 59.7 bits (143), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 87/166 (52%), Gaps = 13/166 (7%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSF-DEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIW 61
           ++KLV++G   VGKS++  + V   F DEY + TI  ++  Q +      D++V   +I 
Sbjct: 8   EYKLVVVGGGGVGKSALTIQLVHSHFVDEY-DPTIEDSYRKQVV-----IDDKVTILDIL 61

Query: 62  DTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLI-ICLVG 120
           DTAGQE Y ++   Y R     L+VY VT   S  +   +  ++ ++V D + I + +VG
Sbjct: 62  DTAGQEEYSAMREQYMRTGEGFLLVYSVTSRTSFEELITYYQQI-QRVKDVEYIPVVVVG 120

Query: 121 NKLDLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVF 166
           NK DL +ER+    V   +    A++ N  F + SAK   NV   F
Sbjct: 121 NKSDLETERQ----VSFEEGASLAKQLNAPFLETSAKQAINVEDAF 162

>CAGL0G05764g complement(552809..553681) similar to sp|P53879
           Saccharomyces cerevisiae YNL180c RHO5, start by
           similarity
          Length = 290

 Score = 58.9 bits (141), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 50/188 (26%), Positives = 83/188 (44%), Gaps = 20/188 (10%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEI 60
           M   K VL+GDS VGK++ +  +   SF      T+   +L+ TI+  E           
Sbjct: 1   MKSLKCVLVGDSEVGKTAFLMSYTTGSFSPEYVPTVFDEYLT-TIQDKET--GYTFHTTF 57

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAK-LWVDELKEKV----NDDKLI 115
           WDT+G +++  L P+ Y   +  L  +   +  S    K  W+ ELK+ +    N   + 
Sbjct: 58  WDTSGDKQHDHLRPLTYPQTDVFLACFPYNDIRSFRNVKDKWIPELKKYIRKSDNSSTVP 117

Query: 116 ICLVGNKLDLVSERESTSLVD---EADAREFAQ---------ENNLLFHQVSAKTGENVI 163
           I LV  K DL  +  S ++++   E D     +         EN L F + S+KTG  + 
Sbjct: 118 ILLVATKCDLNDDNSSNNILNQSQEVDGMPLPESLVDGLVIDENLLGFVKCSSKTGYGLQ 177

Query: 164 KVFQDIGE 171
            V  ++ +
Sbjct: 178 DVIDNVAK 185

>YNL304W (YPT11) [4309] chr14 (60482..61549) Predicted GTPase
           possibly involved in non-selective vesicle transport,
           interacts with Myo2p and plays a role in distribution of
           mitochondria into growing buds [1068 bp, 355 aa]
          Length = 355

 Score = 58.9 bits (141), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 35/104 (33%), Positives = 54/104 (51%), Gaps = 9/104 (8%)

Query: 34  STIGAAFLSQTIKLSEEYDEQVLKFEIWDTAGQERYK-SLAPMYYRNANAALVVYDVTEP 92
           STIG    +  + +    D +     +WDTAGQERY+ ++ P  Y+  NA ++ YD+T  
Sbjct: 142 STIGIDIKTNLVNI----DNRFFNVILWDTAGQERYQNAIIPSLYKKTNAVILTYDITNA 197

Query: 93  DSLPKA-KLWVDELKEKVNDDKLI---ICLVGNKLDLVSEREST 132
            S     + W+ +  E  +   L+     LVGNK+DL  ER+ T
Sbjct: 198 KSFQSCMERWIVQALENFSSQDLLKARFFLVGNKIDLYKERQVT 241

>Scas_628.21
          Length = 208

 Score = 57.0 bits (136), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 86/184 (46%), Gaps = 18/184 (9%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIW 61
            Q K+ +LG  +VGK+++  R+V+  F E    T+   F         ++  Q    EI 
Sbjct: 13  FQRKIAVLGAKNVGKTTLTIRYVESRFLESYYPTVENHFTKLI-----DFKNQHFTLEIV 67

Query: 62  DTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGN 121
           DTAGQ+    L           ++ Y V    +     +  D+L +++  D + + +VGN
Sbjct: 68  DTAGQDESSLLNLKSLAGVRGVILCYSVVNISTFDMIPVVWDKLLDQLERDDIPVIIVGN 127

Query: 122 KLDLVSERESTSLVDEADAREFAQENNLL----------FHQVSAKTGENVIKVFQDIGE 171
           K+DL ++ ++ ++V + + ++ A   NL+          F + SAK   NV   FQ + +
Sbjct: 128 KIDLRNDLDNRTVVTKQEGKKLA---NLIRSSDKNIKAGFIECSAKDDTNVGTTFQKLLK 184

Query: 172 RLYL 175
           ++ L
Sbjct: 185 QMEL 188

>Sklu_2354.10 YNL304W, Contig c2354 13851-15119
          Length = 422

 Score = 55.8 bits (133), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 61/130 (46%), Gaps = 19/130 (14%)

Query: 18  SIVHRFVKDSFDEYRES------------TIGAAFLSQTIKLSEEYDEQVLKFEIWDTAG 65
           S  H+ +K+  D  ++S            TIG    +  I +    D +  K  +WDTAG
Sbjct: 180 STSHQMIKEEPDNQKDSQDPDEIVIDTKTTIGIDIKTSLINI----DNRFFKVIMWDTAG 235

Query: 66  QERYK-SLAPMYYRNANAALVVYDVTEPDSLPKA-KLWVDELKEKVND-DKLIICLVGNK 122
           QERY+ ++ P  Y+ +N  ++ YD+ +  S       W+ E  +   D  K    LVGNK
Sbjct: 236 QERYRNAMIPSLYKGSNGIILTYDICDRASFDSCLNHWLREAIQNCKDLGKTRFYLVGNK 295

Query: 123 LDLVSEREST 132
           +DL   R+ T
Sbjct: 296 IDLYKNRKIT 305

>AGL093W [4218] [Homologous to ScYLR229C (CDC42) - SH]
           complement(532002..532577) [576 bp, 191 aa]
          Length = 191

 Score = 53.9 bits (128), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 56/126 (44%), Gaps = 8/126 (6%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEI 60
           M   K V++GD +VGK+ ++  +  + F      T+   +    +   E Y        +
Sbjct: 1   MQTLKCVVVGDGAVGKTCLLISYTTNQFPADYVPTVFDNYAVTVMIGDEPY-----TLGL 55

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAK-LWVDELKEKVNDDKLIICLV 119
           +DTAGQE Y  L P+ Y + +  LV + V  P S    K  W  E+         +I  V
Sbjct: 56  FDTAGQEDYDRLRPLSYPSTDVFLVCFSVVSPPSFENVKEKWFPEVHHHCPGVPCLI--V 113

Query: 120 GNKLDL 125
           G ++DL
Sbjct: 114 GTQIDL 119

>KLLA0A04213g complement(382243..382818) highly similar to sp|P19073
           Saccharomyces cerevisiae YLR229c CDC42 GTP-binding
           protein of RAS superfamily, start by similarity
          Length = 191

 Score = 53.5 bits (127), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 56/126 (44%), Gaps = 8/126 (6%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEI 60
           M   K V++GD +VGK+ ++  +  + F      T+   +    +   E Y        +
Sbjct: 1   MQTLKCVVIGDGAVGKTCLLISYTTNQFPADYVPTVFDNYAVTVMIGDEPY-----TLGL 55

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAK-LWVDELKEKVNDDKLIICLV 119
           +DTAGQE Y  L P+ Y + +  LV + V  P S    K  W  E+         +I  V
Sbjct: 56  FDTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHCPGVPCLI--V 113

Query: 120 GNKLDL 125
           G ++DL
Sbjct: 114 GTQIDL 119

>Kwal_34.16142
          Length = 192

 Score = 53.5 bits (127), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 67/153 (43%), Gaps = 5/153 (3%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDTA 64
           K+ ++G  +VGKSS+  +FV+  F E    TI   F  Q +     Y       EI DTA
Sbjct: 13  KIAVVGARNVGKSSLTVQFVESRFVEPYYPTIENQFTKQIVLGRTTY-----TLEICDTA 67

Query: 65  GQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGNKLD 124
           GQ+ +  +            +VY      S    +L  D++ ++V  +++   ++GNK+D
Sbjct: 68  GQDEFSLINTKSLIGVKGVAIVYSCVNRASFEIVELIRDKILDQVGLEQIPTVILGNKID 127

Query: 125 LVSERESTSLVDEADAREFAQENNLLFHQVSAK 157
           L     +   V   +  E A      F + SAK
Sbjct: 128 LRDSGINGGKVRRQEGEELAARLGAGFVECSAK 160

>Kwal_23.3135
          Length = 191

 Score = 53.5 bits (127), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 56/126 (44%), Gaps = 8/126 (6%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEI 60
           M   K V++GD +VGK+ ++  +  + F      T+   +    +   E Y        +
Sbjct: 1   MQTLKCVVVGDGAVGKTCLLISYTTNQFPADYVPTVFDNYAVTVMIGDEPY-----TLGL 55

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAK-LWVDELKEKVNDDKLIICLV 119
           +DTAGQE Y  L P+ Y + +  LV + V  P S    K  W  E+         +I  V
Sbjct: 56  FDTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHCPGVPCLI--V 113

Query: 120 GNKLDL 125
           G ++DL
Sbjct: 114 GTQIDL 119

>YCR027C (RHB1) [561] chr3 complement(167365..167994) Protein
           involved in regulation of arginine and lysine uptake,
           member of the Rheb family in the Ras superfamily of G
           proteins [630 bp, 209 aa]
          Length = 209

 Score = 53.5 bits (127), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 88/205 (42%), Gaps = 21/205 (10%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIW 61
            Q K+ L+G  +VGK+++  RFV+  F E    TI   F ++ I     Y       EI 
Sbjct: 15  FQRKIALIGARNVGKTTLTVRFVESRFVESYYPTIENEF-TRIIP----YKSHDCTLEIL 69

Query: 62  DTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGN 121
           DTAGQ+    L           ++ Y +    S     +  D+L +++  D L + LVG 
Sbjct: 70  DTAGQDEVSLLNIKSLTGVRGIILCYSIINRASFDLIPILWDKLVDQLGKDNLPVILVGT 129

Query: 122 KLDLV-SERESTSLVDEADAREFA-------QENNLLFHQVSAKTGENVIKVFQDIGERL 173
           K DL  S +     V +A+  + A       + N   F + SA+   NV + F      L
Sbjct: 130 KADLGRSTKGVKRCVTKAEGEKLASTIGSQDKRNQAAFIECSAELDYNVEETFM-----L 184

Query: 174 YLQNKDKIQES---KKPNNNNISLQ 195
            L+  ++++ +      NNN  S+ 
Sbjct: 185 LLKQMERVEGTLGLDAENNNKCSIM 209

>KLLA0C12881g 1090895..1092016 weakly similar to sp|P48559
           Saccharomyces cerevisiae YNL304w YPT11, start by
           similarity
          Length = 373

 Score = 53.9 bits (128), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 57/108 (52%), Gaps = 7/108 (6%)

Query: 28  FDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDTAGQERYK-SLAPMYYRNANAALVV 86
           F+    STIG    +  + +    D +  +  +WDTAGQERY+ ++    Y+ +N  ++ 
Sbjct: 153 FEINTTSTIGIDIKTNLVNI----DNRFFRVIMWDTAGQERYRNAMISSLYKGSNGVILS 208

Query: 87  YDVTEPDS-LPKAKLWVDELKEKVNDDKLI-ICLVGNKLDLVSEREST 132
           YD+ + +S L     W+ E  E + +  +    LVGNKLDL  ER+ T
Sbjct: 209 YDICDFNSFLNCLNFWLVESIENIPNLSMTRFYLVGNKLDLYKERKVT 256

>YLR229C (CDC42) [3629] chr12 complement(604214..604789) Rho-type
           GTPase involved in bud site assembly, cell polarity, and
           exocytosis, member of the rho family of the ras
           superfamily [576 bp, 191 aa]
          Length = 191

 Score = 52.8 bits (125), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 56/126 (44%), Gaps = 8/126 (6%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEI 60
           M   K V++GD +VGK+ ++  +  + F      T+   +    +   E Y        +
Sbjct: 1   MQTLKCVVVGDGAVGKTCLLISYTTNQFPADYVPTVFDNYAVTVMIGDEPY-----TLGL 55

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAK-LWVDELKEKVNDDKLIICLV 119
           +DTAGQE Y  L P+ Y + +  LV + V  P S    K  W  E+         ++  V
Sbjct: 56  FDTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHCPGVPCLV--V 113

Query: 120 GNKLDL 125
           G ++DL
Sbjct: 114 GTQIDL 119

>Scas_721.96
          Length = 191

 Score = 52.4 bits (124), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 57/129 (44%), Gaps = 8/129 (6%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEI 60
           M   K V +GD +VGK+ ++  +  + F      T+   +    +   E Y        +
Sbjct: 1   MKTIKAVTIGDGAVGKTCLLISYTTNQFPADYVPTVFDNYAVTVMIGDEPY-----TLGL 55

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAK-LWVDELKEKVNDDKLIICLV 119
           +DTAGQE Y  L P+ Y + +  LV + V  P S    K  W  E+         +I  V
Sbjct: 56  FDTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHCPGVPCLI--V 113

Query: 120 GNKLDLVSE 128
           G ++DL S+
Sbjct: 114 GTQIDLRSD 122

>CAGL0F05269g complement(533759..534334) highly similar to sp|P19073
           Saccharomyces cerevisiae YLR229c CDC42, start by
           similarity
          Length = 191

 Score = 52.4 bits (124), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 56/126 (44%), Gaps = 8/126 (6%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEI 60
           M   K V++GD +VGK+ ++  +  + F      T+   +    +   E Y        +
Sbjct: 1   MQTLKCVVVGDGAVGKTCLLISYTTNQFPADYVPTVFDNYAVTVMIGDEPY-----TLGL 55

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAK-LWVDELKEKVNDDKLIICLV 119
           +DTAGQE Y  L P+ Y + +  LV + V  P S    K  W  E+         ++  V
Sbjct: 56  FDTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHCPGVPCLV--V 113

Query: 120 GNKLDL 125
           G ++DL
Sbjct: 114 GTQVDL 119

>CAGL0M03817g complement(431237..432664) weakly similar to sp|P48559
           Saccharomyces cerevisiae YNL304w YPT11, hypothetical
           start
          Length = 475

 Score = 53.5 bits (127), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 56/105 (53%), Gaps = 9/105 (8%)

Query: 33  ESTIGAAFLSQTIKLSEEYDEQVLKFEIWDTAGQERYK-SLAPMYYRNANAALVVYDVTE 91
           ++TIG    +  I +    D ++    +WDTAGQERY+ ++ P  Y+ +NA ++ YD+T+
Sbjct: 237 KTTIGVDIKTNIINI----DNRIFNCILWDTAGQERYRNAIMPSLYKKSNAIILSYDITD 292

Query: 92  PDSLPKA-KLWVDELKEKV---NDDKLIICLVGNKLDLVSEREST 132
             S   + + W+ E        + +K     +GNK DL  +RE T
Sbjct: 293 KCSFKNSYEHWLVEAMGHFAARDYEKARFYFIGNKTDLYKQREVT 337

>KLLA0A11330g 982552..983124 similar to ca|CA6070|IPF4842 Candida
           albicans, start by similarity
          Length = 190

 Score = 51.2 bits (121), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 38/169 (22%), Positives = 79/169 (46%), Gaps = 6/169 (3%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDTA 64
           K+++LG  +VGK++++ +  +  F E    TI   F+ + +       E     +I DT+
Sbjct: 7   KIIVLGSRNVGKTTLLVQLTESHFVESYYPTIENQFIHEFVLKKPNGTELKFNLDIVDTS 66

Query: 65  GQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGNKLD 124
           GQ+ +  +           +++Y V    S    +L  D++ + +   +L + LVGNK+D
Sbjct: 67  GQDEFSMINAKSMLGVAGCILMYSVANRHSFEIVELIRDKMLDMLGLLELPMVLVGNKID 126

Query: 125 LVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERL 173
           L  +R+    V   +  E A+     F ++  K G  +   F+ + +++
Sbjct: 127 L--DRQ----VSYKEGEELAKRLKCGFVEICVKQGSGIEMPFKTLIQKI 169

>Scas_697.54*
          Length = 181

 Score = 49.3 bits (116), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 66/126 (52%), Gaps = 15/126 (11%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWD 62
           + K+++LG  + GK++I+++      ++ + ST    F  +T+          +KF +WD
Sbjct: 17  EMKILMLGLDNAGKTTILYKL---KLNKIKTSTPTVGFNVETVSYKN------VKFNMWD 67

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVND---DKLIICLV 119
             GQER + L   Y+    A + V D ++ + L +AK   +EL   +++   +K+++ + 
Sbjct: 68  VGGQERLRPLWRHYFPATTALIFVIDSSDQERLNEAK---EELYSIISEKEMEKVVLLVW 124

Query: 120 GNKLDL 125
            NK DL
Sbjct: 125 ANKQDL 130

>Sklu_2320.2 YOR094W, Contig c2320 3571-4065
          Length = 164

 Score = 47.8 bits (112), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 62/125 (49%), Gaps = 15/125 (12%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDT 63
            K+++LG  + GK++I+++      ++ + S     F  +T+          +KF +WD 
Sbjct: 1   MKILMLGLDNAGKTTILYKL---KLNKIKTSAPTVGFNVETVTYKN------VKFNMWDV 51

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVND---DKLIICLVG 120
            GQER + L   Y+    A + V D  + D L +AK   +E    V +   +K+++ ++ 
Sbjct: 52  GGQERLRPLWRHYFPATTALIFVIDSQDKDRLNEAK---EEFYSIVGEKEMEKVVLLVLA 108

Query: 121 NKLDL 125
           NK DL
Sbjct: 109 NKQDL 113

>CAGL0I03916g 343014..343559 highly similar to sp|P11076
           Saccharomyces cerevisiae YDL192w ARF1 or sp|P19146
           Saccharomyces cerevisiae YDL137w ARF2, start by
           similarity
          Length = 181

 Score = 47.4 bits (111), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/163 (21%), Positives = 72/163 (44%), Gaps = 16/163 (9%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWD 62
           + +++++G    GK++++++       E   +     F  +T++         + F +WD
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVITTIPTIGFNVETVQYKN------ISFTVWD 67

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKL---IICLV 119
             GQ+R +SL   YYRN    + V D  +   + +A+   + ++  +N+D+L   +  + 
Sbjct: 68  VGGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAR---EVMQRMLNEDELRNAVWLVF 124

Query: 120 GNKLDLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENV 162
            NK DL  E  S + + E       +          A TGE +
Sbjct: 125 ANKQDL-PEAMSAAEITEKLGLHSIRNRPWFIQATCATTGEGL 166

>Kwal_47.18241
          Length = 230

 Score = 47.8 bits (112), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 64/129 (49%), Gaps = 8/129 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWD 62
           Q  +V++G  + GK+S+    +   F++    T+G           E++   +    I+D
Sbjct: 4   QLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRM--------EQFTMGLNIVRIFD 55

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGNK 122
            AGQ R++ L   Y+  A+  + V D+ +  +  + K  V ++    N D + + ++GNK
Sbjct: 56  LAGQYRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNK 115

Query: 123 LDLVSERES 131
           +DL++  ++
Sbjct: 116 IDLITTLDT 124

>Kwal_23.2944
          Length = 184

 Score = 46.2 bits (108), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 63/126 (50%), Gaps = 15/126 (11%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWD 62
           + K+++LG  + GK++I+++      ++ + S     F  +T+          +KF +WD
Sbjct: 17  EMKILMLGLDNAGKTTILYKL---KLNKIKTSAPTVGFNVETVSFRN------VKFNMWD 67

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKL---IICLV 119
             GQ+R + L   Y+    A + V D  + + L +AK   +EL   + D ++   ++ ++
Sbjct: 68  VGGQDRLRPLWRHYFPATTALIFVVDSQDMERLNEAK---EELYSIIGDKEMENVVLLVL 124

Query: 120 GNKLDL 125
            NK DL
Sbjct: 125 ANKQDL 130

>YDL137W (ARF2) [731] chr4 (216529..217074) GTP-binding protein of
           the arf family (ras superfamily) involved in assembly of
           coated vesicles of the secretory system [546 bp, 181 aa]
          Length = 181

 Score = 46.2 bits (108), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/163 (20%), Positives = 72/163 (44%), Gaps = 16/163 (9%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWD 62
           + +++++G    GK++++++       E   +     F  +T++         + F +WD
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVITTIPTIGFNVETVQYKN------ISFTVWD 67

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKL---IICLV 119
             GQ+R +SL   YYRN    + V D  +   + +A+   + ++  +N+D+L   +  + 
Sbjct: 68  VGGQDRIRSLWRHYYRNTEGVIFVIDSNDRSRIGEAR---EVMQRMLNEDELRNAVWLVF 124

Query: 120 GNKLDLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENV 162
            NK DL  E  S + + E       +          A +GE +
Sbjct: 125 ANKQDL-PEAMSAAEITEKLGLHSIRNRPWFIQSTCATSGEGL 166

>Scas_624.4*
          Length = 181

 Score = 46.2 bits (108), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/163 (20%), Positives = 72/163 (44%), Gaps = 16/163 (9%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWD 62
           + +++++G    GK++++++       E   +     F  +T++         + F +WD
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVITTIPTIGFNVETVQYKN------ISFTVWD 67

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKL---IICLV 119
             GQ+R +SL   YYRN    + V D  +   + +A+   + ++  +N+D+L   +  + 
Sbjct: 68  VGGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAR---EVMQRMLNEDELRNAVWLVF 124

Query: 120 GNKLDLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENV 162
            NK DL  E  S + + E       +          A +GE +
Sbjct: 125 ANKQDL-PEAMSAAEITEKLGLHSIRNRPWFIQATCATSGEGL 166

>Scas_701.42*
          Length = 181

 Score = 46.2 bits (108), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/163 (20%), Positives = 72/163 (44%), Gaps = 16/163 (9%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWD 62
           + +++++G    GK++++++       E   +     F  +T++         + F +WD
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVITTIPTIGFNVETVQYKN------ISFTVWD 67

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKL---IICLV 119
             GQ+R +SL   YYRN    + V D  +   + +A+   + ++  +N+D+L   +  + 
Sbjct: 68  VGGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAR---EVMQRMLNEDELRNAVWLVF 124

Query: 120 GNKLDLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENV 162
            NK DL  E  S + + E       +          A +GE +
Sbjct: 125 ANKQDL-PEAMSAAEITEKLGLHSIRNRPWFIQATCATSGEGL 166

>KLLA0C13563g complement(1157278..1157826) highly similar to
           sp|P40994 Saccharomyces cerevisiae YOR094w ARF3
           ADP-ribosylation factor 3, start by similarity
          Length = 182

 Score = 45.8 bits (107), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 64/126 (50%), Gaps = 15/126 (11%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWD 62
           + K+++LG  + GK++I+++      ++ + S     F  +T+          +KF +WD
Sbjct: 17  EMKILMLGLDNAGKTTILYKL---KLNKIKTSAPTVGFNVETLSFKN------VKFNMWD 67

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVND---DKLIICLV 119
             GQ R + L   Y+   +A + V D  + + L +AK   +EL   + +   +K+++ ++
Sbjct: 68  VGGQARLRPLWRHYFPATSALIFVIDSNDKERLDQAK---EELFSIIGEKEMEKVVLLVL 124

Query: 120 GNKLDL 125
            NK DL
Sbjct: 125 ANKQDL 130

>CAGL0J09064g 892556..893101 highly similar to sp|P11076
           Saccharomyces cerevisiae YDL192w ARF1 or sp|P19146
           Saccharomyces cerevisiae YDL137w ARF2, start by
           similarity
          Length = 181

 Score = 45.8 bits (107), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/163 (20%), Positives = 72/163 (44%), Gaps = 16/163 (9%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWD 62
           + +++++G    GK++++++       E   +     F  +T++         + F +WD
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVITTIPTIGFNVETVQYKN------ISFTVWD 67

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKL---IICLV 119
             GQ+R +SL   YYRN    + V D  +   + +A+   + ++  +N+D+L   +  + 
Sbjct: 68  VGGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAR---EVMQRMLNEDELRNAVWLVF 124

Query: 120 GNKLDLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENV 162
            NK DL  E  S + + E       +          A +GE +
Sbjct: 125 ANKQDL-PEAMSAAEITEKLGLHSIRNRPWFIQATCATSGEGL 166

>Scas_503.2
          Length = 527

 Score = 46.6 bits (109), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 42/76 (55%), Gaps = 5/76 (6%)

Query: 60  IWDTAGQERYKS-LAPMYYRNANAALVVYDVTEPDSLPK-AKLWVDELKEKVNDDKLI-- 115
            WD AGQ+R+K+ +    Y+ +NA ++ YD+    S     + W++E  E V    L   
Sbjct: 273 FWDPAGQDRFKNVMMDSLYKISNAIILCYDICNLTSFQNCCRYWLNETLENVRSGDLSEI 332

Query: 116 -ICLVGNKLDLVSERE 130
              LVGNKLDL ++R+
Sbjct: 333 KFYLVGNKLDLYAKRQ 348

>ACL078W [971] [Homologous to ScYOR094W (ARF3) - SH]
           complement(212664..213209) [546 bp, 181 aa]
          Length = 181

 Score = 45.1 bits (105), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 62/126 (49%), Gaps = 15/126 (11%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWD 62
           + K+++LG  + GK++I+++      ++ + S     F  +T+          +KF +WD
Sbjct: 17  EMKILMLGLDNAGKTTILYKL---KLNKIKTSAPTVGFNVETVAFRN------VKFNMWD 67

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKL---IICLV 119
             GQER + L   Y+    A + V D  +   L +AK   +EL   + + ++   ++ ++
Sbjct: 68  VGGQERLRPLWRHYFPATTALIFVIDSHDQARLNEAK---EELYSIIGEKEMENVVLLVL 124

Query: 120 GNKLDL 125
            NK DL
Sbjct: 125 ANKQDL 130

>Sklu_1681.2 YDL137W, Contig c1681 2279-2767
          Length = 162

 Score = 44.3 bits (103), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 34/162 (20%), Positives = 75/162 (46%), Gaps = 16/162 (9%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDT 63
            +++++G    GK++I+++       E   +     F  +T+    EY    + F +WD 
Sbjct: 1   MRVLMVGLDGAGKATILYKL---KLGEVVTTIPTIGFNVETV----EYKN--ISFTVWDV 51

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKL---IICLVG 120
            GQ++ + L   Y+RN    + V D  +   + +A+   + L+  +N+D++   ++ +  
Sbjct: 52  GGQDKIRPLWRHYFRNTEGIIFVVDSNDRSRISEAR---EVLQRMLNEDEIRNAVLLVFA 108

Query: 121 NKLDLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENV 162
           NK DL  E  S + + E       +++  +     A +GE +
Sbjct: 109 NKQDL-PEAMSAAEITEKLGLHSIRQHPWIIQATCAASGEGL 149

>YOR094W (ARF3) [4899] chr15 (502795..503346) Protein with
           similarity to members of the arf family (ras
           superfamily) of GTP-binding proteins [552 bp, 183 aa]
          Length = 183

 Score = 44.7 bits (104), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 62/126 (49%), Gaps = 15/126 (11%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWD 62
           + K+++LG    GK++I+++      ++ + ST    F  +T+          +KF +WD
Sbjct: 17  EMKILMLGLDKAGKTTILYKL---KLNKIKTSTPTVGFNVETVTYKN------VKFNMWD 67

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKL---IICLV 119
             GQ+R + L   Y+    A + V D +  + + +AK   +EL   + + ++   ++ + 
Sbjct: 68  VGGQQRLRPLWRHYFPATTALIFVIDSSARNRMEEAK---EELYSIIGEKEMENVVLLVW 124

Query: 120 GNKLDL 125
            NK DL
Sbjct: 125 ANKQDL 130

>YDL192W (ARF1) [681] chr4 (116322..116867) GTP-binding protein
           involved in assembly of coated vesicles of the secretory
           system, member of the arf family in the ras superfamily
           [546 bp, 181 aa]
          Length = 181

 Score = 43.9 bits (102), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/163 (20%), Positives = 71/163 (43%), Gaps = 16/163 (9%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWD 62
           + +++++G    GK++++++       E   +     F  +T++         + F +WD
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVITTIPTIGFNVETVQYKN------ISFTVWD 67

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKL---IICLV 119
             GQ+R +SL   YYRN    + V D  +   + +A+   + ++  +N+D+L      + 
Sbjct: 68  VGGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAR---EVMQRMLNEDELRNAAWLVF 124

Query: 120 GNKLDLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENV 162
            NK DL  E  S + + E       +          A +GE +
Sbjct: 125 ANKQDL-PEAMSAAEITEKLGLHSIRNRPWFIQATCATSGEGL 166

>Kwal_56.24453
          Length = 181

 Score = 43.1 bits (100), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/163 (20%), Positives = 74/163 (45%), Gaps = 16/163 (9%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWD 62
           + +++++G    GK++++++       E   +     F  +T+    EY    + F +WD
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVVTTIPTIGFNVETV----EYKN--ISFTVWD 67

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKL---IICLV 119
             GQ++ + L   Y+RN    + V D  +   + +A+   + L+  +N+D++   ++ + 
Sbjct: 68  VGGQDKIRPLWRHYFRNTEGIIFVVDSNDRSRISEAR---EVLQRMLNEDEIRNAVLLVF 124

Query: 120 GNKLDLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENV 162
            NK DL  E  S + + E       ++         A +GE +
Sbjct: 125 ANKQDL-PEAMSAAEITEKLGLHSIRQRPWFIQAACATSGEGL 166

>Kwal_56.24462
          Length = 181

 Score = 43.1 bits (100), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/178 (20%), Positives = 79/178 (44%), Gaps = 16/178 (8%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWD 62
           + +++++G    GK++++++       E   +     F  +T+    EY    + F +WD
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVVTTIPTIGFNVETV----EYKN--ISFTVWD 67

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKL---IICLV 119
             GQ++ + L   YYRN    + V D  +   + +A+   + L+  +N+D++    + + 
Sbjct: 68  VGGQDKIRPLWRHYYRNTEGIIFVVDSNDRSRISEAR---EVLQRMLNEDEIRNASLLVF 124

Query: 120 GNKLDLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERLYLQN 177
            NK DL  E  S + + E       ++         A +GE + +  + +   L  QN
Sbjct: 125 ANKQDL-PEAMSAAEITEKLGLHSIRQRPWFIQATCATSGEGLYEGLEWLSNSLKNQN 181

>KLLA0B02046g 178646..179218 highly similar to sp|P20606
           Saccharomyces cerevisiae YPL218w SAR1 GTP-binding
           protein of the ARF family, start by similarity
          Length = 190

 Score = 43.1 bits (100), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 63/137 (45%), Gaps = 15/137 (10%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDTA 64
           KL+ LG  + GK++++H    D     R +T+   +       SEE     +KF  +D  
Sbjct: 25  KLLFLGLDNAGKTTLLHMLKND-----RLATLQPTWHPT----SEELAIGNIKFTTFDLG 75

Query: 65  GQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGNKLD 124
           G  + + L   Y+   N  + + D  +P+   +A++ +D L +    D +   ++GNK+D
Sbjct: 76  GHLQARRLWKDYFPEVNGIVFLVDAADPERFNEARIELDALFQIKELDNVPFAVLGNKID 135

Query: 125 LVSERESTSLVDEADAR 141
                 S S V E + R
Sbjct: 136 ------SPSAVSETELR 146

>ADR094W [1835] [Homologous to ScYDL192W (ARF1) - SH; ScYDL137W
           (ARF2) - SH] complement(878123..878668) [546 bp, 181 aa]
          Length = 181

 Score = 42.7 bits (99), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/163 (20%), Positives = 74/163 (45%), Gaps = 16/163 (9%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWD 62
           + +++++G    GK++++++       E   +     F  +T+    EY    + F +WD
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVVTTIPTIGFNVETV----EYKN--ISFTVWD 67

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKL---IICLV 119
             GQ++ + L   Y+RN    + V D  +   + +A+   + L+  +N+D++   ++ + 
Sbjct: 68  VGGQDKIRPLWRHYFRNTEGIIFVVDSNDRSRIAEAR---EVLQRMLNEDEIRNAVLLVF 124

Query: 120 GNKLDLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENV 162
            NK DL  E  S + + E       ++         A +GE +
Sbjct: 125 ANKQDL-PEAMSAAEITEKLGLHSIRQRPWYIQATCATSGEGL 166

>CAGL0I00858g complement(63365..63958) similar to sp|P39110
           Saccharomyces cerevisiae YMR138w CIN4 GTP-binding
           protein, start by similarity
          Length = 197

 Score = 42.7 bits (99), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 73/169 (43%), Gaps = 15/169 (8%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWD 62
           + + ++LG  + GKS+IV+  + +S ++    T    F   +I +    D +  K  +WD
Sbjct: 16  EIRCLILGLDNSGKSTIVNGLLPES-EKCNSITPTVGFQIHSIVVESAQDGKTYKVNLWD 74

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGNK 122
             GQ   +     Y+   +  L   D+       ++    +EL+E V  D+  I   G +
Sbjct: 75  IGGQRTLRPFWDNYFDKTDVLLWCVDIASSLRFDES---FNELRELVMQDRDRI---GYQ 128

Query: 123 LDLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGE 171
             LV       LV++AD   +A       H +  K  E+++   Q +GE
Sbjct: 129 CKLVVAINKIDLVEQADLEHYA-------HDIEQKI-EHILHHGQSVGE 169

>KLLA0F05225g 515391..515936 highly similar to sp|P19146
           Saccharomyces cerevisiae YDL137w ARF2 GTP-binding
           protein of the ARF family, start by similarity
          Length = 181

 Score = 41.6 bits (96), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/126 (21%), Positives = 62/126 (49%), Gaps = 15/126 (11%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWD 62
           + +++++G    GK++++++       E   +     F  +T+    EY    + F +WD
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVVTTIPTIGFNVETV----EYKN--ISFTVWD 67

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKL---IICLV 119
             GQ++ + L   Y+RN    + V D  +   + +A+   + L+  +N+D++   ++ + 
Sbjct: 68  VGGQDKIRPLWRHYFRNTEGIIFVVDSNDRARIAEAR---EVLQRMLNEDEIRNAVLLVF 124

Query: 120 GNKLDL 125
            NK DL
Sbjct: 125 ANKQDL 130

>Sklu_2365.2 YPL051W, Contig c2365 827-1420 reverse complement
          Length = 197

 Score = 41.2 bits (95), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 48/100 (48%), Gaps = 9/100 (9%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIK---LSEEYDEQVLKFE 59
           QF +++LG  + GK++ +    K    EY   +     ++ T+     +    + VLKF 
Sbjct: 17  QFSILILGLDNAGKTTFLETLKK----EYSLHSKPLEKITPTVGQNVATIPVQDCVLKF- 71

Query: 60  IWDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAK 99
            WD  GQE  +SL   YY  A+  + V D T+ D L + K
Sbjct: 72  -WDVGGQETLRSLWAEYYSQAHGIIFVVDSTDRDRLDECK 110

>CAGL0E05896g
           join(complement(585178..585202),
           complement(584348..584892)) highly similar to sp|P20606
           Saccharomyces cerevisiae YPL218w SAR1 GTP-binding
           protein of the ARF family
          Length = 189

 Score = 41.2 bits (95), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 62/137 (45%), Gaps = 15/137 (10%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDTA 64
           KL+ LG  + GK++++H    D     R +T+   +       SEE     +KF  +D  
Sbjct: 24  KLLFLGLDNAGKTTLLHMLKND-----RLATLQPTWHPT----SEELAIGNIKFTTFDLG 74

Query: 65  GQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGNKLD 124
           G  + + L   Y+   N  + + D  +PD   +A++ +D L        +   ++GNK+D
Sbjct: 75  GHVQARRLWKDYFPEVNGIVFLVDSADPDRFDEARVELDALFNITELKDVPFVILGNKID 134

Query: 125 LVSERESTSLVDEADAR 141
                 + + V EA+ R
Sbjct: 135 ------AANAVSEAELR 145

>Scas_706.2*
          Length = 190

 Score = 40.4 bits (93), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 64/144 (44%), Gaps = 15/144 (10%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDTA 64
           KL+ LG  + GK++++H    D     R +T+   +       SEE     +KF  +D  
Sbjct: 25  KLLFLGLDNAGKTTLLHMLKND-----RLATLQPTWHPT----SEELAIGNIKFTTFDLG 75

Query: 65  GQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGNKLD 124
           G  + + L   Y+   N  + + D  +P+   +A + +D L +      +   ++GNK+D
Sbjct: 76  GHIQARRLWKDYFPEVNGIVFLVDAADPERFHEAYVELDALFKIAELKDVPFVILGNKID 135

Query: 125 LVSERESTSLVDEADAREFAQENN 148
                 + + V EA+ R     NN
Sbjct: 136 ------APTAVSEAELRNALGLNN 153

>Scas_567.9
          Length = 199

 Score = 40.4 bits (93), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 77/167 (46%), Gaps = 14/167 (8%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKD-SFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIW 61
           Q+ +++LG  + GK++ +    K+ + +      I          +S E ++++LKF  W
Sbjct: 17  QYSILILGLDNAGKTTFLETCKKEFNLNSKPLDKITPTVGQNVATISVENNKKLLKF--W 74

Query: 62  DTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDK---LIICL 118
           D  GQE  +S+   YY   +  + V D T+   + +       L + V DD+   + I +
Sbjct: 75  DVGGQENLRSMWSEYYSQCHGIIFVVDSTDRSRIDECS---KTLGKIVMDDEVEGVPILM 131

Query: 119 VGNKLDLVSERES---TSLVDEADAREFAQENNLLFHQVSAKTGENV 162
           + NK D+    E      + ++      A+++ +L   VSA TGE V
Sbjct: 132 LANKQDMPERMEVQDIKEIFNQIAEHLSARDSRVL--PVSALTGEGV 176

>YPL218W (SAR1) [5231] chr16 (138697..138724,138864..139408)
           Component of COPII coat of vesicles involved in
           endoplasmic reticulum to Golgi transport, GTP-binding
           protein of the arf family in the ras superfamily [573
           bp, 190 aa]
          Length = 190

 Score = 39.7 bits (91), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 60/132 (45%), Gaps = 12/132 (9%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDTA 64
           KL+ LG  + GK++++H    D     R +T+   +       SEE     +KF  +D  
Sbjct: 25  KLLFLGLDNAGKTTLLHMLKND-----RLATLQPTWHPT----SEELAIGNIKFTTFDLG 75

Query: 65  GQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGNKLD 124
           G  + + L   Y+   N  + + D  +P+   +A++ +D L        +   ++GNK+D
Sbjct: 76  GHIQARRLWKDYFPEVNGIVFLVDAADPERFDEARVELDALFNIAELKDVPFVILGNKID 135

Query: 125 ---LVSERESTS 133
               VSE E  S
Sbjct: 136 APNAVSEAELRS 147

>Sklu_2202.6 YBR164C, Contig c2202 5407-5958
          Length = 183

 Score = 39.7 bits (91), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 41/96 (42%), Gaps = 9/96 (9%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWD 62
           + ++++LG    GK++I++R       E   +     F  +T+          LK  +WD
Sbjct: 18  ELRILILGLDGAGKTTILYRL---QIGEVVTTKPTIGFNVETLTYKN------LKLNVWD 68

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKA 98
             GQ   +     YY N  A + V D T+ D +  A
Sbjct: 69  LGGQTSIRPYWRCYYANTAAVIFVVDSTDKDRMSTA 104

>KLLA0E24805g 2194554..2195105 highly similar to sp|P38116
           Saccharomyces cerevisiae YBR164c ARL1 ADP-ribosylation
           factor, start by similarity
          Length = 183

 Score = 39.3 bits (90), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 44/95 (46%), Gaps = 13/95 (13%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQ-TIKLS-EEYDEQVLKFEI 60
           + ++++LG    GK++I++R             IG    ++ TI  + E  + + LK  +
Sbjct: 18  ELRILILGLDGAGKTTILYRL-----------QIGEVITTKPTIGFNVETLNYKNLKLNV 66

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSL 95
           WD  GQ   +     YY N  A + V D T+ D +
Sbjct: 67  WDLGGQTSIRPYWRCYYANTAAVIFVVDSTDKDRM 101

>Kwal_27.11872
          Length = 197

 Score = 39.3 bits (90), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 47/96 (48%), Gaps = 9/96 (9%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIK---LSEEYDEQVLKFE 59
           Q+ +++LG  + GK++ +    +    EY +S      ++ T+     +      +LKF 
Sbjct: 17  QYSILILGLDNAGKTTFLEMLKR----EYSKSGKAPDKITPTVGQNVATVPVGNCLLKF- 71

Query: 60  IWDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSL 95
            WD  GQE  ++L P YY+ A+  + V D  + + L
Sbjct: 72  -WDVGGQESLRALWPEYYKQAHGIIFVIDSADRERL 106

>AGR221W [4532] [Homologous to ScYBR164C (ARL1) - SH]
           complement(1164831..1165382) [552 bp, 183 aa]
          Length = 183

 Score = 38.1 bits (87), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 43/96 (44%), Gaps = 9/96 (9%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWD 62
           + ++++LG    GK++I++R         +  TIG  F  +T+          LK  +WD
Sbjct: 18  ELRILILGLDGAGKTTILYRLQVGEVVTTK-PTIG--FNVETLTYRN------LKLNVWD 68

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKA 98
             GQ   +     YY N  A + V D T+ D +  A
Sbjct: 69  LGGQTSIRPYWRCYYANTAAVIFVVDSTDKDRMGVA 104

>YBR164C (ARL1) [350] chr2 complement(567832..568383) GTP-binding
           protein of the arf-sar family in the ras superfamily,
           possibly involved in signal transduction, and plays a
           role in membrane trafficking [552 bp, 183 aa]
          Length = 183

 Score = 37.7 bits (86), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 44/98 (44%), Gaps = 13/98 (13%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQ-TIKLS-EEYDEQVLKFEI 60
           + ++++LG    GK++I++R             IG    ++ TI  + E    + LK  +
Sbjct: 18  ELRILILGLDGAGKTTILYRL-----------QIGEVVTTKPTIGFNVETLSYKNLKLNV 66

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKA 98
           WD  GQ   +     YY +  A + V D T+ D +  A
Sbjct: 67  WDLGGQTSIRPYWRCYYADTAAVIFVVDSTDKDRMSTA 104

>CAGL0I10835g 1060258..1060809 highly similar to sp|P38116
           Saccharomyces cerevisiae YBR164c ADP-ribosylation
           factor, start by similarity
          Length = 183

 Score = 37.4 bits (85), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 41/96 (42%), Gaps = 9/96 (9%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWD 62
           + ++++LG    GK++I++R       E   +     F  +T+          LK  +WD
Sbjct: 18  ELRILILGLDGAGKTTILYRL---QIGEVVTTKPTIGFNVETLTYKN------LKLNVWD 68

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKA 98
             GQ   +     YY +  A + V D T+ D +  A
Sbjct: 69  LGGQTSIRPYWRCYYADTAAVIFVVDSTDKDRMSTA 104

>Scas_700.11
          Length = 183

 Score = 37.4 bits (85), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 41/96 (42%), Gaps = 9/96 (9%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWD 62
           + ++++LG    GK++I++R       E   +     F  +T+          LK  +WD
Sbjct: 18  ELRILILGLDGAGKTTILYRL---QIGEVVTTKPTIGFNVETLTYKN------LKLNVWD 68

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKA 98
             GQ   +     YY +  A + V D T+ D +  A
Sbjct: 69  LGGQTSIRPYWRCYYADTAAVIFVVDSTDKDRMGTA 104

>AFL114W [3081] [Homologous to ScYPL218W (SAR1) - SH]
           complement(222754..223326) [573 bp, 190 aa]
          Length = 190

 Score = 37.4 bits (85), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 58/130 (44%), Gaps = 9/130 (6%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDTA 64
           KL+ LG  + GK++++H    D     R +T+   +       SEE     +KF  +D  
Sbjct: 25  KLLFLGLDNAGKTTLLHMLKND-----RLATLQPTWHPT----SEELAIGSIKFTTFDLG 75

Query: 65  GQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGNKLD 124
           G  + + L   Y+   N  + + D  + +   +A++ +D L +      +   ++GNK+D
Sbjct: 76  GHIQARRLWKDYFPEVNGIVFLVDAADSERFNEARVELDALFQIPELKTVPFVILGNKID 135

Query: 125 LVSERESTSL 134
             S    T L
Sbjct: 136 APSAVSETEL 145

>YPL051W (ARL3) [5389] chr16 (459958..460554) ADP-ribosylation
           factor-like protein, member of the arf-sar family in the
           ras superfamily [597 bp, 198 aa]
          Length = 198

 Score = 36.2 bits (82), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/93 (22%), Positives = 44/93 (47%), Gaps = 2/93 (2%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWD 62
           Q+ +++LG  + GK++ +    K+    ++        + Q +       +Q+LKF  WD
Sbjct: 17  QYSILILGLDNAGKTTFLETLKKEYSLAFKALEKIQPTVGQNVATIPVDSKQILKF--WD 74

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTEPDSL 95
             GQE  +S+   YY   +  + + D ++ + L
Sbjct: 75  VGGQESLRSMWSEYYSLCHGIIFIVDSSDRERL 107

>KLLA0E11638g 1028781..1029998 some similarities with sp|P01120
           Saccharomyces cerevisiae YNL098c RAS2 GTP-binding
           protein, hypothetical start
          Length = 405

 Score = 36.2 bits (82), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 56/256 (21%), Positives = 103/256 (40%), Gaps = 66/256 (25%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVK----------------DSFD---EYRESTIGAAF- 40
           +L  K+ L+G+S+VGK+ +V R++K                D F    EY   T  A F 
Sbjct: 24  VLTSKVALIGNSTVGKTCMVGRWIKGHSVLHDVDETGEHEEDLFHKIIEYDALTKSANFQ 83

Query: 41  ----------LSQTIKLSE--------------------EYDEQVLKFEIWDTAGQERYK 70
                     L +  K+S                     + D QV+    +D      Y 
Sbjct: 84  ECCKLLKHASLDEIKKVSSNVYQNMAYSDSQNTKYDATLKLDVQVVDVTHFDATD---YS 140

Query: 71  SLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGNKLDLVSERE 130
            L  +    A+  ++ YD T P +L    L+   +  ++  D + I + G K+D +SER+
Sbjct: 141 DLRHLQVNQADGFILCYDTTNPATLADMTLY-HRIITRIKGDDVPIIVCGTKIDCISERK 199

Query: 131 STSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERLYLQNKDKIQES-----K 185
            +         E   + +  + + SA    N+ + F  I   L+L  K K+ ++     K
Sbjct: 200 VSEDEVIGLCEEMGVDFDTCYFENSAMENINIDETFYAI---LHLIEKRKLAKTHTNCCK 256

Query: 186 KPNNNNIS----LQRP 197
           +P +++++    L++P
Sbjct: 257 EPQHHSMANGTVLEKP 272

>Scas_698.27
          Length = 701

 Score = 35.8 bits (81), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 68/143 (47%), Gaps = 24/143 (16%)

Query: 6   LVLLGDSSVGKSSIVHRFVKDS----FDEYR-------ESTIGAA--FLSQTI--KLSEE 50
            V+LG+ S GKS+I+ R ++DS     DE R       +S + A   +LS+ +  K+S  
Sbjct: 273 FVMLGNESAGKSTIIGRLLEDSGLVRIDEIRSVKKELEKSKLNAEMLYLSKLMEKKMSST 332

Query: 51  Y--DEQVLKFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTEPD-----SLPKAKLWVD 103
           +  D+ V +F  +D  G  ++ S +    R    A++  D          ++  A +   
Sbjct: 333 FSLDKNVSEFSAFDIPGDLKHLSSSIKAIRQCTTAILTIDCNTDAFESAFNMGSATIQHI 392

Query: 104 ELKEKVNDDKLIICLVGNKLDLV 126
            L ++ N D +II +  NK+D +
Sbjct: 393 YLCKQANIDNIIIMM--NKMDTI 413

>KLLA0C06358g complement(563583..564482) highly similar to sp|Q00582
           Saccharomyces cerevisiae YML121w GTR1 GTP-binding
           protein singleton, start by similarity
          Length = 299

 Score = 35.4 bits (80), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 62/141 (43%), Gaps = 16/141 (11%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQV--LKFEIWD 62
           KL+L+G S  GKSS+    +  ++  +    +GA     TI +   +   +  +   +WD
Sbjct: 8   KLLLMGRSGSGKSSM-RSIIFSNYSAFDTRRLGA-----TIDVEHSHLRFLGNMTLNLWD 61

Query: 63  TAGQE-----RYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKE--KVNDDKLI 115
             GQ+      +       ++     + V+DV   D L    ++   LK+  K + D  I
Sbjct: 62  CGGQDVFMENYFTQQKDHIFQMVQVLIHVFDVESKDVLKDVDIFTRALKQLKKYSPDAKI 121

Query: 116 ICLVGNKLDLVSERESTSLVD 136
             LV +K+DLV   + T L D
Sbjct: 122 FVLV-HKMDLVQLDKRTELFD 141

>KLLA0C13387g complement(1142002..1142637) similar to sp|P01119
           Saccharomyces cerevisiae YOR101w RAS1 GTP-binding
           protein, start by similarity
          Length = 211

 Score = 35.0 bits (79), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 44/95 (46%), Gaps = 4/95 (4%)

Query: 72  LAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGNKLDLVSERES 131
           +   Y R     L+VY VT   S  +   +  ++    + D + + ++GNK DL  ER+ 
Sbjct: 1   MREQYMRTGEGFLLVYSVTSKTSFEELMTYYQQILRVKDSDYVPVFVIGNKSDLEDERQ- 59

Query: 132 TSLVDEADAREFAQENNLLFHQVSAKTGENVIKVF 166
              V   + +  A++ +  F + SAK   NV + F
Sbjct: 60  ---VSYEEGQTLAKQFDAPFLETSAKQNINVEESF 91

>CAGL0L12826g complement(1370767..1371366) highly similar to
           tr|Q02804 Saccharomyces cerevisiae YPL051w
           ADP-ribosylation factor-like protein, start by
           similarity
          Length = 199

 Score = 34.7 bits (78), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 38/166 (22%), Positives = 68/166 (40%), Gaps = 12/166 (7%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKD-SFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIW 61
           Q+ +++LG  + GK++ +    K+ S        I          +  + +  +LKF  W
Sbjct: 17  QYSILILGLDNAGKTTFLETLKKEYSMHSKPLDKIAPTVGQNVATIPVDNNRSILKF--W 74

Query: 62  DTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDK---LIICL 118
           D  GQ   +++   YY   +  + V D T+   + +     + L+  V DD+   + I +
Sbjct: 75  DVGGQASLRAMWSEYYPQCHGIIFVVDSTDRSRIDECS---ETLRTIVMDDEIEGIPILM 131

Query: 119 VGNKLDLVSERESTSLVDEADAR--EFAQENNLLFHQVSAKTGENV 162
           + NK D   ER     + E   R  E     +     V A TGE +
Sbjct: 132 LANKQD-KPERMEVQDIKEIFNRIAEHMSARDSRVLPVCALTGEGI 176

>Scas_680.21
          Length = 183

 Score = 34.7 bits (78), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 30/133 (22%), Positives = 58/133 (43%), Gaps = 18/133 (13%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWD 62
           + K ++LG  + GKS++V++ + +      E T    F  Q +     ++       +WD
Sbjct: 16  ELKCLILGLDNSGKSTLVNKLLPEEERSQVEITPTIGF--QIVN----FNHGGYTISMWD 69

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLI------- 115
             GQ   +     Y+    A +   DV+ P    ++   + EL + +N D+ +       
Sbjct: 70  IGGQTTLRPFWDNYFDKMEALVWCVDVSAPSRFQES---LRELSQLLNLDRTVESGETLP 126

Query: 116 --ICLVGNKLDLV 126
             + +V NK+DLV
Sbjct: 127 FKLIVVLNKIDLV 139

>Kwal_56.24149
          Length = 149

 Score = 34.3 bits (77), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 42/89 (47%), Gaps = 3/89 (3%)

Query: 48  SEEYDEQVLKFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKE 107
           SEE     +KF  +D  G  + + L   Y+   N  + + D  +P+ L +A++ +D L  
Sbjct: 18  SEELAIGNIKFTTFDLGGHIQARRLWKDYFPEVNGIVFLVDAADPERLNEARVELDALFN 77

Query: 108 KVNDDKLIICLVGNKLD---LVSERESTS 133
                 +   ++GNK+D    VSE E  S
Sbjct: 78  IAELKDVPFVILGNKIDSPNAVSETELRS 106

>AGL261W [4051] [Homologous to ScYPL051W (ARL3) - SH]
           complement(218211..218807) [597 bp, 198 aa]
          Length = 198

 Score = 34.3 bits (77), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 78/179 (43%), Gaps = 39/179 (21%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEYRES------TIGAAFLSQTIKLSEEYDEQVL 56
            + +++LG  + GK++ + + +K  +  Y +       T+G      T+ L +     +L
Sbjct: 17  HYSVLILGLDNAGKTTFLEQ-LKAVYHLYAKPLEKIVPTVGQNV--ATVPLDKT---TLL 70

Query: 57  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDD---K 113
           KF  WD  GQE  +++   YY   +  + + D T+ + L +     D L+  V DD    
Sbjct: 71  KF--WDVGGQEALRAMWSEYYVQTHGIIFIIDSTDRERLQEC---CDSLRSIVTDDGVEG 125

Query: 114 LIICLVGNKLDLVSERESTSLVDEADAREFAQE-NNLLFH---------QVSAKTGENV 162
           + I ++ NK D    RE     D+ +  +  Q  N L  H          +SA TGE +
Sbjct: 126 VPILMLANKQD----RE-----DKMELHDIKQVFNKLALHLEARDSRVLPISALTGEGI 175

>KLLA0F02662g 241804..242565 some similarities with sp|Q8VEH3 Mus
           musculus Hypothetical 21.4 kDa protein, hypothetical
           start
          Length = 253

 Score = 34.3 bits (77), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 27/140 (19%), Positives = 67/140 (47%), Gaps = 7/140 (5%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWD 62
           Q  + ++G  + GK++  +    + F      T+G     + +KL    +      +++D
Sbjct: 23  QLSIAVVGLQNSGKTTFTNLIAGEEFVVDTIPTLGVNI--KDVKLPNHTN-----LKVYD 75

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGNK 122
            AGQ R++ L    ++  +  + + D+++  +  +AK  + ++    N + + I ++GNK
Sbjct: 76  LAGQTRFQKLWDRCFQQVDLLVFMIDLSDLTNWEQAKNKLHDVIIATNLEHVPILILGNK 135

Query: 123 LDLVSERESTSLVDEADARE 142
           +DL+ +      V ++D  +
Sbjct: 136 VDLIPKFHRDLYVAKSDVSD 155

>Sklu_1358.1 YMR138W, Contig c1358 536-1192
          Length = 218

 Score = 33.5 bits (75), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 63/139 (45%), Gaps = 21/139 (15%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEYRES-TIGAAFLSQTIKLSEEYDEQVLKFEIW 61
           + + ++LG  + GKS++V   ++      R + T+G  F   TI    EY       ++W
Sbjct: 42  ELRSLVLGLDNSGKSTVVDWLLERGEKRSRITPTVG--FRIHTI----EYAGH--NVQLW 93

Query: 62  DTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDD-------KL 114
           D  GQ   +     Y+   +  L V DVT      ++     EL++ + D        K+
Sbjct: 94  DIGGQRTLRPFWDNYFDKTDVLLWVIDVTARSRFSES---FAELEKLLQDRDRLGYRCKM 150

Query: 115 IICLVGNKLDLVSERESTS 133
           I+ L  NK+DL+ E ES +
Sbjct: 151 IVLL--NKMDLIDEDESVT 167

>KLLA0E07634g 688734..690239 similar to sp|P32559 Saccharomyces
           cerevisiae YMR023c MSS1 mitochondrial GTPase involved in
           expression of COX1 singleton, start by similarity
          Length = 501

 Score = 32.3 bits (72), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 76/169 (44%), Gaps = 33/169 (19%)

Query: 4   FKLVLLGDSSVGKSSIVHRF--------------VKDSFDEYRESTIGAAFLSQTIKLSE 49
            KL LLG+ + GKSS+V+                 +DS D   +       L+ T  + +
Sbjct: 257 IKLTLLGEPNSGKSSLVNEISQDDVAIVSDIPGTTRDSIDVMMDINGFKCILTDTAGIRQ 316

Query: 50  EYDEQVLKFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKV 109
              + +      +  G +R K  +      ++  ++V DV+ P+    +K + + +K+ +
Sbjct: 317 GTSDSI------EIKGIDRSKKKS----LQSDLVVLVIDVSNPNI---SKHFEEFIKDNL 363

Query: 110 NDDKLIICLVGNKLDLVSERESTSLVDEADAREFAQENNLLFHQVSAKT 158
           +D  LI+ L  NK DL +E +   L+++ DA EF     L  H VS  T
Sbjct: 364 SDKPLIVVL--NKSDLATETQLKYLIEKFDA-EFKA---LKIHTVSCLT 406

>AEL232C [2274] [Homologous to NOHBY] (196356..197285) [930 bp, 309
           aa]
          Length = 309

 Score = 32.3 bits (72), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 28/133 (21%), Positives = 57/133 (42%), Gaps = 26/133 (19%)

Query: 5   KLVLLGDSSVGKSSIV-----HRFVKDSFD----EYRESTIGAAFLSQTIKLSEEYDEQV 55
           ++ ++G  + GK+++      H F  D+      + R +TIG   L              
Sbjct: 70  QIAIVGLQNSGKTTLAALLTGHPFRADTIPTLGIDVRHATIGQTLL-------------- 115

Query: 56  LKFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLI 115
              +++D AGQ R++ L        +  + V D+++  +   AK  +  +    N  +  
Sbjct: 116 ---QVYDLAGQARHRFLWDRCLDTTDLVVYVLDLSDDTAWEAAKHALQSVLVATNARRTP 172

Query: 116 ICLVGNKLDLVSE 128
           + ++GNK DLV+ 
Sbjct: 173 VLIIGNKADLVAP 185

>Scas_688.24
          Length = 393

 Score = 31.6 bits (70), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 47/98 (47%), Gaps = 7/98 (7%)

Query: 55  VLKFEIWDTAGQER--YKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDEL-KEKVND 111
            L  EI D+   E   +  L     + ++A ++ +D T  DS    + +   + + +  D
Sbjct: 146 TLDVEILDSQAIETADFSELTSAQIKQSDAFILCFDCTNRDSFNDLRTYQRRIERARGID 205

Query: 112 DKLIICLVGNKLDLVSERESTSLVDEADAREFAQENNL 149
           DK+ + +   K+D++SER+    VD  D ++F  +  L
Sbjct: 206 DKVPVIICCTKVDVMSERK----VDLEDVQDFINKAGL 239

>KLLA0A03465g complement(314573..316552) similar to sp|P39722
           Saccharomyces cerevisiae YAL048c vacuolar aspartic
           proteasse singleton, start by similarity
          Length = 659

 Score = 31.2 bits (69), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 28/123 (22%), Positives = 57/123 (46%), Gaps = 10/123 (8%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWD 62
           + ++V+ GDS VGK+S++   VKD F  + +  +    + +    S    E  +  +  +
Sbjct: 5   RIRIVVCGDSGVGKTSLIACLVKDQFISWLQDVLPPITIPKDFSSSRYSPENTVVVDTGN 64

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKL-WVDELKEKVNDDKLIICLVGN 121
           +     +K L     +NA+   +VY  ++ DS  +  L W+   +    +  +++C   N
Sbjct: 65  SDLATLHKEL-----KNADVIWLVY--SDHDSYERIALYWMMMFRSLGVNLPVVLC--RN 115

Query: 122 KLD 124
           K D
Sbjct: 116 KCD 118

>Scas_721.90
          Length = 397

 Score = 31.2 bits (69), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 14/63 (22%), Positives = 33/63 (52%)

Query: 2  LQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIW 61
          +QF L+LLG++ +GK++ ++       +   ++ +    LS  I+ +    ++ +K +  
Sbjct: 27 IQFNLLLLGETGIGKTTFLNNLCNQVIENDNDTQVNVNPLSNNIETTTHVIKRTIKLKEK 86

Query: 62 DTA 64
          D A
Sbjct: 87 DGA 89

>YMR023C (MSS1) [3987] chr13 complement(319436..321016)
           Mitochondrial GTPase involved in expression of COX1/OXI3
           [1581 bp, 526 aa]
          Length = 526

 Score = 31.2 bits (69), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 73/173 (42%), Gaps = 29/173 (16%)

Query: 4   FKLVLLGDSSVGKSSIVHRF--------------VKDSFDEYRESTIGAAFLSQTIKLSE 49
            KLVLLG  +VGKSS+V+                 +DS D           +  T  + E
Sbjct: 275 IKLVLLGAPNVGKSSLVNSLTNDDISIVSDIPGTTRDSIDAMINVNGYKVIICDTAGIRE 334

Query: 50  EYDEQVLKFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKV 109
           +  +++    I D A ++  +S         +  L + D T+   L    +    L  K 
Sbjct: 335 KSSDKIEMLGI-DRAKKKSVQS---------DLCLFIVDPTDLSKLLPEDILA-HLSSKT 383

Query: 110 NDDKLIICLVGNKLDLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENV 162
             +K II +V NK DLVS+ E T ++++   R  ++   L    VS KT E +
Sbjct: 384 FGNKRIIIVV-NKSDLVSDDEMTKVLNKLQTRLGSKYPIL---SVSCKTKEGI 432

>Kwal_26.6810
          Length = 664

 Score = 31.2 bits (69), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 18/26 (69%)

Query: 3  QFKLVLLGDSSVGKSSIVHRFVKDSF 28
          Q K+V+ GD  VGK+S++   +KD F
Sbjct: 5  QIKIVVCGDDGVGKTSLIAALLKDQF 30

>ADR402W [2142] [Homologous to ScYAL048C - SH]
          complement(1426900..1428885) [1986 bp, 661 aa]
          Length = 661

 Score = 30.8 bits (68), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 18/26 (69%)

Query: 3  QFKLVLLGDSSVGKSSIVHRFVKDSF 28
          + ++V+ GD  VGKSS++   VKD F
Sbjct: 5  RIRIVVCGDKGVGKSSLIACLVKDQF 30

>YML121W (GTR1) [3850] chr13 (26930..27862) GTP-binding protein
           involved in the function of the Pho84p phosphate
           transporter [933 bp, 310 aa]
          Length = 310

 Score = 30.4 bits (67), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 59/131 (45%), Gaps = 16/131 (12%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQV--LKFEIWD 62
           KL+L+G S  GKSS+    +  ++  +    +GA     TI +   +   +  +   +WD
Sbjct: 8   KLLLMGRSGSGKSSM-RSIIFSNYSAFDTRRLGA-----TIDVEHSHLRFLGNMTLNLWD 61

Query: 63  TAGQE-----RYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKE--KVNDDKLI 115
             GQ+      +       ++     + V+DV   + L   +++   LK+  K + D  I
Sbjct: 62  CGGQDVFMENYFTKQKDHIFQMVQVLIHVFDVESTEVLKDIEIFAKALKQLRKYSPDAKI 121

Query: 116 ICLVGNKLDLV 126
             L+ +K+DLV
Sbjct: 122 FVLL-HKMDLV 131

>CAGL0E06292g 633135..634361 some similarities with sp|P01119
          Saccharomyces cerevisiae YOR101w RAS1, start by
          similarity
          Length = 408

 Score = 30.4 bits (67), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 24/32 (75%)

Query: 4  FKLVLLGDSSVGKSSIVHRFVKDSFDEYREST 35
          F++++LGD  VGK+S++ +++ D++    E+T
Sbjct: 21 FRIMVLGDPKVGKTSMIMQWLTDNYRSGDEAT 52

>Sklu_2411.4 YMR023C, Contig c2411 8898-10388
          Length = 496

 Score = 30.4 bits (67), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 58/131 (44%), Gaps = 16/131 (12%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTI-KLSEEYDEQVLKFEIWD 62
            KLVLLG  + GKSS+++    D      E++I ++    T   +    D    K  + D
Sbjct: 248 IKLVLLGPPNAGKSSLLNSLTND------ETSIVSSIPGTTRDSIDVPIDVNGYKVVLCD 301

Query: 63  TAG-------QERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLI 115
           TAG       Q   + +     +++ + LVV  V   + L       D +K ++ D  +I
Sbjct: 302 TAGIRKNSSDQIELQGIRRAKMKSSQSDLVVLLVDASNELYITDDLKDHIKSQLRDKNII 361

Query: 116 ICLVGNKLDLV 126
           I +  NK DLV
Sbjct: 362 IVV--NKSDLV 370

>ABL104C [488] [Homologous to ScYDR232W (HEM1) - SH]
           (202777..204447) [1671 bp, 556 aa]
          Length = 556

 Score = 30.0 bits (66), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 25/54 (46%), Gaps = 8/54 (14%)

Query: 59  EIWDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDD 112
           ++W T    R    A      A+  L+   V EPD +P+A LW +E     NDD
Sbjct: 490 DVWKTLQLPRVSDWA------AHGGLL--GVGEPDYVPEANLWTEEQMSLTNDD 535

>Kwal_33.14296
          Length = 299

 Score = 29.3 bits (64), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 61/131 (46%), Gaps = 16/131 (12%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQV--LKFEIWD 62
           KL+L+G S  GKSS+    +  ++  +    +GA     TI +   +   +  +   +WD
Sbjct: 8   KLLLMGRSGSGKSSM-RSIIFSNYSAFDTRRLGA-----TIDVEHSHLRFLGNMTLNLWD 61

Query: 63  TAGQ----ERYKSLAPMY-YRNANAALVVYDVTEPDSLPKAKLWVDELKE--KVNDDKLI 115
             GQ    E Y S    + ++     + V+DV   + +   +++   LK+  K + D  I
Sbjct: 62  CGGQDVFMENYFSQQKDHIFQMVQVLIHVFDVESQEVIKDIEIFTKALKQLKKYSPDAKI 121

Query: 116 ICLVGNKLDLV 126
             L+ +K+DLV
Sbjct: 122 FVLL-HKMDLV 131

>Sklu_2335.9 YML121W, Contig c2335 18260-19255 reverse complement
          Length = 331

 Score = 28.9 bits (63), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 60/134 (44%), Gaps = 22/134 (16%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQV--LKFEIWD 62
           KL+L+G S  GKSS+    +  ++  +    +GA     TI +   +   +  +   +WD
Sbjct: 40  KLLLMGRSGSGKSSM-RSIIFSNYSAFDTRRLGA-----TIDVEHSHLRFLGNMTLNLWD 93

Query: 63  TAGQERYKSLAPMYYRN--------ANAALVVYDVTEPDSLPKAKLWVDELKE--KVNDD 112
             GQ+ +      Y+ N            + V+DV   + +   +++   LK+  K + D
Sbjct: 94  CGGQDVF---MENYFTNQKDHIFQMVQVLIHVFDVESQEVIKDIEIFTRALKQLKKYSPD 150

Query: 113 KLIICLVGNKLDLV 126
             I  L+ +K+DLV
Sbjct: 151 AKIFVLL-HKMDLV 163

>Scas_692.9
          Length = 309

 Score = 28.9 bits (63), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 30/131 (22%), Positives = 59/131 (45%), Gaps = 16/131 (12%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQV--LKFEIWD 62
           KL+L+G S  GKSS+    +  ++  +    +GA     TI +   +   +  +   +WD
Sbjct: 14  KLLLMGRSGSGKSSM-RSIIFSNYSAFDTRRLGA-----TIDVEHSHLRFLGNMTLNLWD 67

Query: 63  TAGQE-----RYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKE--KVNDDKLI 115
             GQ+      +       ++     + V+DV   D +   +++   LK+  K + +  I
Sbjct: 68  CGGQDVFMENYFTKQKDHIFQMVQVLIHVFDVESTDVIKDIEIFTRALKQLKKYSPEAKI 127

Query: 116 ICLVGNKLDLV 126
             L+ +K+DLV
Sbjct: 128 FVLL-HKMDLV 137

>Scas_691.35*
          Length = 2632

 Score = 29.3 bits (64), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 29/61 (47%), Gaps = 8/61 (13%)

Query: 70   KSLAPMYY---RNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKL-----IICLVGN 121
            KSL  M+Y    + N  ++   V +  SLPK KL    L   +NDD       +IC +G 
Sbjct: 1024 KSLKQMFYSLKTSKNDLIIFPKVQKAPSLPKIKLKSGRLLFSINDDPFEAQMNMICQIGT 1083

Query: 122  K 122
            +
Sbjct: 1084 Q 1084

>AGR030C [4340] [Homologous to ScYDR044W (HEM13) - SH]
           (768609..769583) [975 bp, 324 aa]
          Length = 324

 Score = 28.5 bits (62), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 30/75 (40%), Gaps = 18/75 (24%)

Query: 42  SQTIKLSEEYDEQVLKFEIWDTAGQERY------KSLAPMYYRNANAAL------VVYDV 89
           + T+ L+  Y      FE WD AG+ +         L P Y    +A L         D 
Sbjct: 122 APTVHLNYRY------FETWDAAGKPQTWWFGGGSDLTPSYLYEEDARLFHAAHKAALDR 175

Query: 90  TEPDSLPKAKLWVDE 104
           T+P   P+ K W DE
Sbjct: 176 TDPALYPRFKKWCDE 190

>KLLA0E12837g 1135181..1135780 similar to sgd|S0005972 Saccharomyces
           cerevisiae YPL051w ARL3 ADP-ribosylation factor-like
           protein, member of the arf-sar family in the ras
           superfamily, start by similarity
          Length = 199

 Score = 28.1 bits (61), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 27/54 (50%), Gaps = 8/54 (14%)

Query: 58  FEIWDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVND 111
           ++I D +GQE ++ L   Y+   N   +VY V   DS        D L+E +N+
Sbjct: 70  WKIIDVSGQESFRYLWDSYFNKDNIHGIVYMVDTSDS--------DRLQESINE 115

>CAGL0B02453g complement(234125..235075) highly similar to sp|Q00582
           Saccharomyces cerevisiae YML121w GTR1 GTP-binding
           protein, hypothetical start
          Length = 316

 Score = 28.1 bits (61), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 63/135 (46%), Gaps = 24/135 (17%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKF------ 58
           KL+L+G S  GKSS+        F  Y      +AF ++ + ++ + +   L+F      
Sbjct: 9   KLLLMGRSGSGKSSMRSII----FSNY------SAFDTRRLGVTMDVEHSHLRFLGNMTL 58

Query: 59  EIWDTAGQ----ERYKSLAPMY-YRNANAALVVYDVTEPDSLPKAKLWVDELKE--KVND 111
            +WD  GQ    E Y S    + ++     + V+DV   + +   +++   L++  K + 
Sbjct: 59  NLWDCGGQDVFMENYFSKQKDHIFQMVQVLIHVFDVESQEVMKDIEIFTRALRQLRKYSP 118

Query: 112 DKLIICLVGNKLDLV 126
           D  I  L+ +K+DLV
Sbjct: 119 DAKIFVLL-HKMDLV 132

>YAL048C (YAL048C) [19] chr1 complement(52804..54792) Protein
           involved in the secretory pathway, has weak similarity
           to GTP-binding proteins of the RAS superfamily [1989 bp,
           662 aa]
          Length = 662

 Score = 28.1 bits (61), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 41/95 (43%), Gaps = 9/95 (9%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKL--SEEYDEQVLKFEIW 61
           F   ++G    GKSS++  F+  SF E    TI       +++L   ++Y      + I 
Sbjct: 449 FNCFVIGKPCCGKSSLLEAFLGRSFSEEYSPTIKPRIAVNSLELKGGKQY------YLIL 502

Query: 62  DTAGQERYKSLAPM-YYRNANAALVVYDVTEPDSL 95
              G++ Y  L      +  +   + YD ++P+S 
Sbjct: 503 QELGEQEYAILENKDKLKECDVICLTYDSSDPESF 537

>AFR446W [3638] [Homologous to ScYML121W (GTR1) - SH]
           complement(1240754..1241653) [900 bp, 299 aa]
          Length = 299

 Score = 27.3 bits (59), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 29/131 (22%), Positives = 59/131 (45%), Gaps = 16/131 (12%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQV--LKFEIWD 62
           KL+L+G S  GKSS+    +  ++  +    +GA     TI +   +   +  +   +WD
Sbjct: 8   KLLLMGRSGAGKSSM-RSIIFSNYSAFDTRRLGA-----TIDVEHSHLRFLGNMTLNLWD 61

Query: 63  TAGQE-----RYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELK--EKVNDDKLI 115
             GQ+      +       ++     + V+DV   + +   +++   LK  ++ + D  I
Sbjct: 62  CGGQDVFMENYFTQQKDHIFQMVQVLIHVFDVESQEVIRDIEIFTRALKHLKRYSPDAKI 121

Query: 116 ICLVGNKLDLV 126
             L+ +K+DLV
Sbjct: 122 FVLL-HKMDLV 131

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.312    0.130    0.355 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,938,671
Number of extensions: 300815
Number of successful extensions: 1403
Number of sequences better than 10.0: 224
Number of HSP's gapped: 1185
Number of HSP's successfully gapped: 224
Length of query: 204
Length of database: 16,596,109
Length adjustment: 97
Effective length of query: 107
Effective length of database: 13,238,163
Effective search space: 1416483441
Effective search space used: 1416483441
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 59 (27.3 bits)